Human cytomegalovirus immunogenic composition

JP2024026160A5Pending Publication Date: 2026-02-13SANOFI PASTEUR SA
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
JP2023198785
Authority / Receiving Office
JP · JP
Patent Type
Applications
Current Assignee / Owner
Priority Date
2017-09-13
Filing Date
2023-11-24
Publication Date
2026-02-13

AI Technical Summary

Technical Problem

Current HCMV vaccines fail to induce sustained neutralizing antibody levels and broad immune responses, necessitating the development of vaccines that enhance immune response persistence and specificity.

Method used

An immunogenic composition comprising HCMV gB antigen, HCMV gH/gL/UL128/UL130/UL131 pentameric complex antigen, and a Th1-inducing adjuvant, such as a TLR-4 agonist or polyacrylic acid polymer salts, is used to enhance immune response and induce long-term protection.

Benefits of technology

The composition significantly increases neutralizing antibody levels and induces a sustained Th1 immune response, providing enhanced protection against HCMV infection.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 00000059_0000
    Figure 00000059_0000
  • Figure 00000059_0001
    Figure 00000059_0001
  • Figure 00000059_0002
    Figure 00000059_0002
Patent Text Reader

Abstract

To provide a vaccine that increases neutralizing antibody levels and induces long lasting protection by inducing persistent immune response, specifically a HCMV vaccine that induces a broader immune response.SOLUTION: The invention provides an immunogenic composition comprising an HCMV gB antigen, an HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen and a Th1-inducing adjuvant. The invention further provides an immunogenic composition for use as an HCMV vaccine.SELECTED DRAWING: None
Need to check novelty before this filing date? Find Prior Art

Description

[Technical field]

[0001] The present invention relates to an immunogenic composition comprising an HCMV gB antigen, an HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen and a Th1-inducing adjuvant. The present invention further relates to an immunogenic composition for use as an HCMV vaccine. [Background technology]

[0002] Human cytomegalovirus (HCMV) is a ubiquitous virus that belongs to the herpesvirus family. The virus consists of linear double-stranded deoxyribonucleic acid (DNA) contained in a capsid surrounded by a lipid bilayer with glycoprotein spikes on its surface and surrounded by a tegument. Like other members of this family, HCMV has the characteristics of latent infection and reactivation. HCMV has the ability to infect and remain latent in many cells.

[0003] In immunocompetent hosts, most HCMV infections are asymptomatic or very mild, with a few nonspecific symptoms such as fatigue, malaise, mild fever, lymphadenopathy, hepatomegaly, or slight elevations in liver enzymes. However, heterophil-negative mononucleosis is observed in approximately 10% of previously healthy individuals.

[0004] In contrast, clinical signs can be extremely severe in newborns infected in utero and in adults immunosuppressed by AIDS, or in the context of solid organ or bone marrow transplantation.

[0005] The prevalence of HCMV infection increases with age and is influenced by socio-economic factors. Serological surveys have shown a higher prevalence in developing and lower socio-economic groups in developed countries. Regarding women of childbearing age, the percentage of HCMV seropositive women ranges from approximately 50% in high- and middle-income groups in developed countries to more than 80% in low-income groups. Surveys conducted in the last two decades in different Western countries and among the general population including different age classes, women and men, have shown globally that HCMV seroprevalence in young children and adolescents ranges from 40-50%, while in older subjects (over 40 years), HCMV seroprevalence is higher than 80%.

[0006] HCMV is shed for a long period of time in the secretions of infected individuals, including urine, saliva, milk, semen, and genital secretions; HCMV can therefore be transmitted either horizontally (from child to child, child to parent, and through close contact between sex partners) or vertically from mother to fetus or infant through the placenta or through body fluid contact at birth and breastfeeding, or by exposure to blood products or transplanted organs.

[0007] HCMV is the most common cause of congenital infection in the developed world. Congenital infection refers to infection transmitted from the mother to the fetus before the birth of the newborn. Each year in the United States, an estimated 8,000 infants suffer from disabilities, including mental retardation, blindness, and sensorineural hearing loss, as a result of congenital HCMV infection.

[0008] Among congenitally infected newborns, 5%–10% have cardinal signs at birth, including microcephaly, chorioretinitis, intracranial calcifications, hepatosplenomegaly, hepatitis, jaundice, hyperbilirubinemia, thrombocytopenia, petechiae, and anemia. Among these newborns with symptomatic congenital HCMV disease, mortality is approximately 10% in infancy and survivors, but 50–90% have sequelae such as mental retardation, cerebral palsy, sensorineural hearing loss, or visual impairment.

[0009] Many infants with congenital HCMV infection are asymptomatic at birth. HCMV is transmitted by innate immunity to viruses, and follow-up studies have shown that approximately 15% of infants identified as HCMV seropositive by viral screening in the neonatal period have sequelae such as hearing loss or central nervous system abnormalities.

[0010] Overall, approximately 17,000 infants born each year in Europe and the United States have permanent disabilities.

[0011] Congenital HCMV infection is more common and more severe when primary infection occurs in the first trimester than when primary infection occurs later in pregnancy. Overall, primary HCMV infection during pregnancy carries a 40% risk of transmission to the fetus.

[0012] No effective means are currently available to prevent or treat maternal or congenital HCMV infection during pregnancy.

[0013] HCMV is also an important viral pathogen in organ and bone marrow transplant recipients and AIDS patients.HCMV-related morbidity in HCMV seronegative solid organ transplant recipients is close to 60%.In solid organ transplantation, the disease is most severe when seronegative patients receive grafts from HCMV positive donors.In contrast, in bone marrow or stem cell transplantation, the disease is most severe in HCMV seropositive subjects who receive cells from seronegative donors, which indicates that the origin of HCMV infection is reactivation of endogenous infection.

[0014] HCMV causes interstitial pneumonitis, hepatitis, gastrointestinal disease, bone marrow suppression, and retinitis in approximately 15% of allogeneic transplant recipients. In addition to these direct end-organ diseases, HCMV is associated with indirect effects such as graft rejection, accelerated atherosclerosis, and immunosuppression that can lead to bacterial or fungal infections.

[0015] The development of an HCMV vaccine is therefore considered a major public health objective in the Institute of Medicine Vaccine Prioritization Report (Non-Patent Document 1). Many candidate vaccines have been described, but none have been licensed so far (Non-Patent Document 2).

[0016] A cytomegalovirus glycoprotein B vaccine with MF59 adjuvant showed promising results in a phase 2 randomized placebo-controlled trial in transplant recipients (Non-Patent Document 3). A phase 2 placebo-controlled randomized double-blind trial in women of childbearing age evaluated the same vaccine consisting of recombinant HCMV envelope glycoprotein B with MF59 adjuvant compared to placebo. Results showed 50% efficacy in preventing HCMV acquisition of primary HCMV. However, immunogenicity results showed that the levels of neutralizing antibodies (Abs) induced by the gB / MF59 formulation peaked at 1 month after administration of the third dose and then declined rapidly (Non-Patent Document 4). [Prior art documents] [Non-patent literature]

[0017] [Non-Patent Document 1] Vaccines for the 21st century:A tool for decision making.Washington DC:National Academy Press;2000 Kathleen R, Stratton, Jane S, Durch, Lawrence RS.Editors committee to study priorities for Vaccine Development Division of Health Promotion and Disease Prevention Institute of Medicine [Non-Patent Document 2] Plotkin et al., Vaccines, 6th ed., Elsevier, 2013; Schleiss et al., Cytomegalovirus vaccines, pp. 1032-1041 [Non-Patent Document 3] Griffiths et al., Lancet, 2011, 377(9773):1256-63 [Non-Patent Document 4] Pass et al., The New England Journal of Medicine, 2009, 360:1191-9. Summary of the Invention [Problem to be solved by the invention]

[0018] As a result, there is a need to improve HCMV vaccine efficacy, in particular to find vaccines that enhance neutralizing antibody levels and induce sustained immune responses leading to long-term protection, and more particularly to find HCMV vaccines that induce a broader immune response. [Means for solving the problem]

[0019] Unexpectedly, the inventors of the present invention have now found a new immunogenic composition that meets these requirements.

[0020] The present invention therefore relates to an immunogenic composition comprising an HCMV gB antigen, an HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen and a Th1 inducing adjuvant.

[0021] In particular, the Th1 inducing adjuvant comprises: - a TLR-4 agonist; or - Polyacrylic acid polymer salts having a weight average molecular weight Mw in the range of 350-650 kDa Includes.

[0022] In one embodiment, the Th1 inducing adjuvant comprises a TLR-4 agonist.

[0023] In particular, said TLR4 agonist is in combination with a delivery system such as aqueous nanosuspensions, calcium phosphates, liposomes, virosomes, ISCOMs, micro- and nanoparticles, or emulsions.

[0024] More specifically, said delivery system is an oil-in-water emulsion.

[0025] In particular, said TLR-4 agonist is selected from E6020 (CAS number: 287180-63-6) and GLA (CAS number 1246298-63-4) TLR-4 agonists.

[0026] In one embodiment, the Th1 inducing adjuvant comprises a linear or branched polyacrylic acid polymer salt having a weight average molecular weight Mw in the range of 350-650 kDa, in particular PAA225000.

[0027] In particular, said HCMV gB antigen contains one or several mutations in the intracellular proteolytic cleavage site.

[0028] More specifically, the HCMV gB antigen may be a full-length gB polypeptide, a full-length gB polypeptide lacking at least a portion of the transmembrane domain, a full-length gB polypeptide lacking substantially all of the transmembrane domain, a full-length gB polypeptide lacking at least a portion of the intracellular domain, or a full-length gB polypeptide lacking at least a portion of the intracellular domain. The gB polypeptide may be a full-length gB polypeptide lacking substantially all of the intracellular domain, or a full-length gB polypeptide lacking substantially both the transmembrane domain and the intracellular domain.

[0029] More specifically, said HCMV gB antigen is gBdTm.

[0030] In particular, in said HCMV gH / gL / UL128 / UL130 / UL131 pentameric composite antigen, the gH antigen lacks at least a portion of the transmembrane domain, preferably the gH antigen lacks substantially all of the transmembrane domain.

[0031] More specifically, said gH comprises the ectodomain of the full-length gH encoded by the UL75 gene.

[0032] More specifically, in the immunogenic compositions according to the invention, HCMV gB and the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex are the only HCMV antigens.

[0033] The present invention further relates to an immunogenic composition according to the invention for use as an HCMV vaccine.

[0034] In particular, the vaccine enhances neutralizing antibody levels and / or duration. [Brief description of the drawings]

[0035] [Figure 1] FIG. 1 shows the study schedule. [Diagram 2] Figure 1 shows the kinetics of neutralizing antibody titers specific for the HCMV BAD-rUL131-Y4 GFP strain in sera collected on days 20 to 257 from mice immunized with 2 μg of CMV-gB and pentamers with or without various adjuvants at days 0, 20, and 227, as measured by serum neutralization assay in epithelial cells with (panel A) or without (panel B) complement. [Diagram 3] Figure 1 shows neutralizing antibody titers specific for the HCMV BAD-rUL131-Y4 GFP strain in sera collected on day 34 from mice immunized on days 0 and 20 with 2 μg of CMV-gB and pentamers with or without various adjuvants, as measured by serum neutralization assays on epithelial cells with (panel A) or without (panel B) complement and on fibroblasts with (panel C) or without (panel D) complement. [Figure 4] Figure 1 shows neutralizing antibody titers specific for HCMV BAD-rUL131-Y4 GFP strain in sera collected on day 208 from mice immunized on days 0 and 20 with 2 μg of CMV-gB and pentamers with or without various adjuvants, as measured by serum neutralization assays on epithelial cells with (panel A) or without (panel B) complement and on fibroblasts with (panel C) or without (panel D) complement. [Diagram 5]FIG. 1 shows neutralizing antibody titers specific for the HCMV BAD-rUL131-Y4 GFP strain in sera collected at day 257 from mice immunized at days 0, 20 and 227 with 2 μg of CMV-gB and pentamers with or without various adjuvants, as measured by serum neutralization assays on epithelial cells with (panel A) or without (panel B) complement and on fibroblasts with (panel C) or without (panel D) complement. [Figure 6] Figure 1 shows anti-gB IgG1 and IgG2c antibody titers specific for CMV-gB (panel A) or CMV-pentamer (panel B) measured by ELISA in sera collected at days 34, 208 and 257 from mice immunized at days 0, 21 and 227 with 2 μg CMV-gB and pentamers with or without various adjuvants. [Figure 7] FIG. 1 shows the mean IgG1 / IgG2c antibody ratios calculated at 34, 208 and 257 days for each group from mice immunized at 0, 21 and 227 days with MF59 or CMV-gB 2 μg and pentamers with various adjuvants. [Figure 8] Figure 1 shows IL-5 and IFN-γ cytokine-secreting cell frequencies (cytokine-secreting cells / 106 spleen cells) upon ex vivo stimulation with recombinant CMV-gB (panel A) or CMV-pentamer (panel B) monitored at days 34, 208 and 257 in spleen cells from mice immunized at days 0, 20 and 227 with 2 μg CMV-gB and pentamers with or without various adjuvants. [Figure 9] Figure 1 shows the IgG1 and IgG2c percentages of antibody-secreting plasmablasts specific for either CMV-gB (panel A) or CMV-pentamer (panel B) at days 34, 208 and 257 from mice immunized with 2 μg CMV-gB and pentamers with or without various adjuvants at days 0, 20 and 227. [Figure 10]FIG. 1 shows the IgG1 and IgG2c percentages of antibody-secreting memory B cells specific for either CMV-gB (panel A) or CMV-pentamer (panel B) at days 34, 208 and 257 from mice immunized with 2 μg CMV-gB and pentamers with or without various adjuvants at days 0, 20 and 227. [Figure 11] FIG. 1 shows neutralizing antibody titers specific for the HCMV BAD-rUL131-Y4 GFP strain measured by serum neutralization assay on epithelial cells ARPE-19 or fibroblast cells MRC-5 in the presence of complement in sera collected on D20 from mice immunized on DO with various doses of CMV-gB and CMV-gH / gL / UL128 / UL130 / UL131 pentamers formulated with PAA adjuvant. [Figure 12] FIG. 12 shows neutralizing antibody titers specific for HCMV BAD-rUL131-Y4 GFP strain measured by serum neutralization assay on epithelial cells ARPE-19 either in the presence (12A) or absence (12B) of complement in sera collected on D35 from mice immunized on DO and D21 with various doses of CMV-gB and CMV-gH / gL / UL128 / UL130 / UL131 pentamers formulated with PAA adjuvant. [Figure 13] FIG. 1 shows IFN-γ cytokine producing cell quantification in mouse splenocytes upon ex vivo stimulation with either CMV-gB, CMV-gH / gL / UL128 / UL130 / UL131 pentamers (panel A) or CMV-pentamer peptide pools (panel B) measured by ELISPOT assay on splenocytes harvested on D35 from mice immunized on DO and D21 with 3 μg of CMV-gB and CMV-gH / gL / UL128 / UL130 / UL131 pentamers formulated with PAA adjuvant. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0036] immunogenic composition As previously mentioned, the immunogenic composition according to the invention comprises: - HCMV gB antigen; - HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen; - Th1-inducing adjuvants Includes.

[0037] "HCMV" is used for human cytomegalovirus and is any strain of human cytomegalovirus.

[0038] The terms "comprising" / "comprises" / "comprise" / "comprised" are intended to mean "including" / "includes" / "included" / "included" respectively and "consisting" / "consists" / "consist" / "consist" / "consist" respectively. For example, a composition "comprising" X may consist of X alone, or it may include something more, e.g., X+Y.

[0039] "Antigen" as used herein has its ordinary meaning known to those of skill in the art. In particular, "antigen" refers to any molecule that contains one or more epitopes (either linear, conformational, or both) that trigger an immunological response.

[0040] In the context of the present invention, antigens further include proteins with modifications such as deletions, additions and substitutions to the native sequence, so long as the protein maintains sufficient immunogenicity. These modifications may be deliberate, for example through site-directed mutagenesis, or may be accidental, such as mutations that occur during the expression of the antigen in a host cell. Antigens may also be proteins or fragments thereof that are coded for by consensus sequences.

[0041] Antigens which may be used in the immunogenic composition according to the invention are in particular the HCMV gB antigen and the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0042] HCMV gB antigen An HCMV gB antigen according to the invention is a full-length gB polypeptide or a gB-derived polypeptide that induces neutralizing antibodies.

[0043] gB is encoded by the UL55 gene of the HCMV genome. The size of the native form of gB (i.e., gp130) depends on the size of the open reading frame (ORF), which may vary slightly from strain to strain. For example, the ORF of the AD169 strain, which is 2717 bp long, encodes a full-length gB of 906 amino acids, whereas the ORF of the Towne strain encodes a full-length gB of 907 amino acids. The protein sequences of these two strains are described in US2002 / 0102562 (Figure 2), which is incorporated by reference in its entirety. The native form of gB contains an amino acid signal sequence, usually 23-25 ​​amino acids long, followed by an extracellular domain containing an intracellular proteolytic cleavage site between residues arginine 460 and serine 461, a transmembrane domain, and an intracellular domain. Usually, full-length gB lacks the amino acid signal sequence as a result of post-translational mechanisms occurring in the cell. It will be appreciated that the full-length gB suitable for the purposes of the present invention encompasses both the full-length gB of HCMV strains Towne and AD169, as well as other equivalent strains. Several antigenic domains that induce neutralizing antibodies have been described. In particular, the domains include the domain located between amino acid residues 461 and 680 of gp130, which is further divided into two discontinuous domains, the domain between residues 461 and 619 and the domain between residues 620 and 680 (US 5,547,834). The domains also include antigen domain 1 (AD-1), located between amino acid residues 560 and 640 (Schoppel K. et al., Virology, 1996, 216:133-45), or antigen domain 2 (AD-2), located between amino acid residues 65 and 84 (Axelsson F et al., Vaccine, 2007, 26:41-6) or between amino acid residues 27 and 84 (Burke HG et al., PLoS pathogens, 2015, 11:e1005227). Thus, polypeptides that contain in their amino acid sequence a sequence homologous to one or several of the above cited antigen domains are also suitable for the purposes of the present invention.The term "sequence homologous to" is intended to mean an amino acid sequence that has at least 80% identity with the amino acid sequence of the antigenic domain believed to be native gB from the Towne or AD169 strains (described in US2002 / 0102562). Typically, the sequence homology is based on at least 90% sequence identity, and even more specifically, the sequence homology is complete (100% sequence identity).

[0044] As used herein, a first sequence having at least x% identity with a second sequence means that x% represents the number of amino acids in the first sequence that are identical to the matched amino acids in the second sequence compared to the full length of the second amino acid sequence when both sequences are optimally aligned by global alignment, where x is maximum. Alignment and determination of percentage identity can be performed manually or automatically using a global alignment algorithm, for example the Needleman and Wunsch algorithm described in Needleman and Wunsch, J. Mol Biol., 48, 443-453 (1970), with, for example, the following parameters for polypeptide sequence comparison: comparison matrix: BLOSUM62 from Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA., 89, 10915-10919 (1992), gap penalty: 8 and gap length penalty: 2; and the following parameters for polynucleotide sequence comparison: comparison matrix: match = +10, mismatch = 0; gap penalty: 50 and gap length penalty: 3.

[0045] The program used with the above parameters is the "Gap" program published by Genetics Computer Group, Madison Wis. The aforementioned parameters are the default parameters for peptide comparisons (plus no penalty for end gaps) and nucleic acid comparisons, respectively.

[0046] A gB-derived peptide or polypeptide particularly suitable for the purposes of the present invention is gp55, as described in US 5,547,834. gp55 is derived from cleavage of gB at the intracellular proteolytic cleavage site; its amino acid sequence corresponds to the sequence between serine residue 461 and the C-terminus. Truncated forms of gp55 can also be used, such as gp55 with all or part of the transmembrane sequence and all or part of the intracellular C-terminal domain deleted (e.g., a peptide with a sequence homologous to the amino acid sequence of naturally occurring gB between residues 461 and 646) or gp55 with all or part of the intracellular C-terminal domain deleted (e.g., a peptide with a sequence homologous to the amino acid sequence of naturally occurring gB between residues 461 and 680). Such truncated forms of gp55 are also described in US 5,547,834, which is incorporated by reference in its entirety.

[0047] It is also possible to use a variant of full-length gB with one or several mutations in the intracellular proteolytic cleavage site so that the latter is abolished. In particular, the mutations are located between residues 457 and 460 of the sequence of gp130, more particularly at arginine 460 and / or lysine 459 and / or arginine 457. In this embodiment, the variant of full-length gB has the entire extracellular domain, all of which are targeted by neutralizing antibodies. Such variants are secondarily deleted of all or part of the transmembrane sequence and / or all or part of the intracellular C-terminal domain, in order to allow its secretion in the host when produced as a recombinant protein, and its easy downstream purification. Such gB derivatives are preferred as long as substantially all of the domains targeted by neutralizing antibodies are preserved.

[0048] Thus, in one embodiment of the invention, HCMV gB comprises one or several mutations in the intracellular proteolytic cleavage site, in particular HCMV gB is further selected from the group of full-length HCMV gB, full-length HCMV gB lacking at least a portion of the transmembrane domain, full-length gB polypeptide lacking substantially all of the transmembrane domain, full-length gB polypeptide lacking at least a portion of the intracellular domain, full-length HCMV gB lacking substantially all of the intracellular domain, and full-length HCMV gB polypeptide lacking substantially both the transmembrane domain and the intracellular domain.

[0049] The phrases "lacking substantially all of the intracellular domain" or "lacking substantially all of the transmembrane domain" are "Lacks" means that at least 80% of the amino acid sequence corresponding to said domain is deleted.

[0050] In the context of the present invention, "lacking at least a portion of a domain" means lacking at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60% or at least 70% of the domain, but less than 80%.

[0051] In one embodiment, the HCMV gB antigen is the ectodomain of gB, i.e., full-length gB in which all of the transmembrane sequences and all of the intracellular C-terminal domain have been deleted. The "ectodomain" is the part of a transmembrane-anchored protein that extends across the membrane into the extracellular space.

[0052] The HCMV gB antigen according to the invention may also contain other mutations and / or deletions and / or additions. For example, the HCMV gB antigen may contain a deletion or substitution of at least one amino acid in at least one of the fusion loop 1 (FL1) and fusion loop 2 (FL2) domains located in the extracellular domain as described in EP2627352. Alternatively or additionally, the antigen may contain a deletion of at least a part of the leader sequence as described in EP2627352. The HCMV gB antigen according to the invention may also contain a mutation resulting in a glycosylation site within hydrophobic surface 1 (amino acid residues 154-160 and 236-243) as described in WO2016092460. In particular, said glycosylation site is an N-glycosylation site comprising a NXS / T / C motif, where X is any amino acid residue (but preferably is not proline). The HCMV gB antigen may contain a mutation resulting in a glycosylation site, the glycosylation site being (1) within hydrophobic face 2 (amino acid residues 145-167 and 230-252); or (2) at residues within 20 angstroms of fusion loop 1 (FL1) (amino acid residues 155-157) and / or fusion loop 2 (FL2) (amino acid residues 240-242), as described in WO2016092460. The HCMV gB antigen may contain a heterologous sequence that is at least 12 residues long at the C-terminus, as described in WO2016092460. In particular, the gB protein may be a fusion protein in which the heterologous sequence is fused at the C-terminus of the ectodomain.

[0053] Native HCMV gB is hypothesized to be homotrimeric based on the 3D crystallographic structures of the gB protein in related viruses, Herpes Simplex Virus 1 (HSV-1) gB and Epstein-Barr Virus (EBV) gB, which are homotrimeric (Heldwein et al., Science, 2006, 313:217-220; Backovic et al., PNAS, 2009, 106(8):2880-2885). The HCMV gB antigen according to the invention may be in trimeric (native form), and / or hexameric (dimer of trimeric native form), and / or dodecameric (dimer of hexamers) form. In particular, the HCMV gB antigen portion of the immunogenic composition according to the invention is substantially not monomeric, more particularly not monomeric. The expression "is substantially not monomeric" means that less than 20%, particularly less than 10%, particularly less than 5% of the HCMV gB antigen is monomeric.

[0054] According to an embodiment, the gB antigen comprises an amino acid sequence having at least 80% identity with SEQ ID NO: 1. In particular, said gB antigen comprises an amino acid sequence having at least 80% identity with SEQ ID NO: 1: SSTRGTSATHSHHSSHTTSAAHSRSGSVSQRVTSSQTVSHGVNETIYNTTLKYGDVVGVNTTKYPYRVCSMAQGTDLIRFERNIVCTSMKPINEDLDEGIMVVYKRNIVAHTFKVRVYQKVLTFRRSYAYIHTTYLLGSNTEYVAPPMWEIHHINSHSQCYSSYSRVIAGTVFVAYHRDSYENKTMQLMPDDYSNTHSTRYVTVKDQWHSRGSTW The present invention includes amino acid sequences having at least 85% identity, at least 90% identity, at least 95% identity, at least 97% identity, at least 98% identity, at least 99% identity or even 100% identity to.

[0055] In a preferred embodiment, the gB antigen comprises an amino acid sequence having 100% identity to SEQ ID NO:1.

[0056] A particularly suitable HCMV gB antigen in the context of the present invention is a truncated full-length gB with all or part of the C-terminal domain deleted and / or all or part of the transmembrane sequence deleted, with the cleavage site disabled. A particularly preferred truncated gB corresponds to that called gBdTM, described in US 6,100,064, which is incorporated by reference in its entirety. In US 6,100,064, the signal sequence is assumed to be 24 amino acids long, and the amino acid positions are shown accordingly in Figure 10. The inventors have found that this signal sequence is in fact 25 amino acids long. In Figure 10 of US 6,100,064, all amino acid positions shown at the C-terminus of Ser-1 (i.e., the C-terminus of the signal sequence) must therefore be subtracted from 1. Thus, gBdTM has three mutations in the cleavage site (arginine 432 replaced by threonine, lysine 434 replaced by glutamine, and arginine 435 replaced by threonine; considering the renumbered positions) so that the extracellular domain is directly linked to the cytoplasmic domain, and a deletion of the transmembrane region between amino acid residues valine 676 and arginine 751 (considering the renumbered positions). Such a gB-derived polypeptide is easier to purify, since it is produced by recombinant cells expressing this product in a secreted form. The resulting form, when it is derived from the gB Towne strain, is an 806 amino acid long polypeptide with the signal sequence and the transmembrane region deleted.

[0057] The HCMV gB protein or peptides or polypeptides derived therefrom described herein can be synthesized by any method known to those of skill in the art, including conventional chemical synthesis in solid phase (RB Merrifield, J. Am. Chem. Soc., 85(14), pp. 2149-2154 (1963)) or solution phase, enzymatic synthesis from constitutive amino acids or their derivatives (K. Morihara, Trends in Biotechnology, 5(6), pp. 164-170 (1987)), cell-free protein synthesis (Katzen et al., Trends in Biotechnology, 23(3), pp. 150-156 (2005)), and biological production methods by recombinant technology.

[0058] For example, HCMV gB antigen can be obtained using a biological production process using recombinant host cells. In such a process, an expression cassette containing a nucleic acid encoding the HCMV gB antigen described herein is introduced into a host cell, and the host cell is cultured under conditions that allow the expression of the corresponding protein. The protein produced thereby is then recovered and purified. Methods for purifying proteins are well known to those skilled in the art. The obtained recombinant protein can be purified from lysates and cell extracts or culture medium supernatants by methods used individually or in combination, such as fractionation, chromatographic methods, immunoaffinity methods using specific monoclonal or polyclonal antibodies, etc. In particular, the obtained recombinant protein is purified from the culture medium supernatant.

[0059] The HCMV gB protein or peptides or polypeptides derived therefrom are usually obtained by recombinant DNA techniques and purified according to methods well known to those skilled in the art, in particular the methods described in US 6,100,064 and US 2002 / 0102562, the entireties of which are incorporated by reference.

[0060] For example, the gB antigen according to the invention is a recombinant glycoprotein produced in Chinese Hamster Ovary (CHO) cell culture. The gB gene from the Towne strain of HCMV can be mutagenized to remove the cleavage site and the transmembrane portion of the molecule to facilitate secretion in cell culture as described in US 6,100,064. The secreted molecule is a polypeptide of 806 amino acids that retains 19 potential N-linked glycosylation sites and is also called gBdTm. The purification process required affinity and ion exchange chromatography steps.

[0061] HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen Another antigenic moiety of the immunogenic composition according to the invention is the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0062] The pentameric complex assembles through disulfide bonds and non-covalent interactions between the five components to form a functional complex capable of presenting conformational epitopes (Ciferri et al., PNAS, 2015, 112(6):1767-1772; Wen et al., Vaccine, 2014, 32(30):3796-3804).

[0063] Said complex has already been described and is known by those skilled in the art. Said complex is described in particular in Ryckman et al. (Journal of Virology, January 2008, pages 60-70) and in patent application WO2014 / 005959. Said HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex may in particular comprise a modified HCMV gH polypeptide, said polypeptide lacking at least a portion of the transmembrane (TM) domain. In some embodiments, the gH polypeptide may retain a portion of the native TM domain, but not enough to retain the protein in the lipid bilayer. In a preferred embodiment, the gH polypeptide lacks substantially all of the transmembrane domain. In a more preferred embodiment, the gH polypeptide lacks the full-length native TM domain.

[0064] Thus, a gH polypeptide can contain up to 10 amino acids (eg, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acids) of a naturally occurring gH TM domain.

[0065] In the context of the present invention, "lacking at least a portion of a domain" means lacking at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60% or at least 70% of the domain, but less than 80%.

[0066] The expressions "lacking substantially all of the intracellular domain" or "lacking substantially all of the transmembrane domain" mean that at least 80% of the amino acid sequence corresponding to said domain is deleted.

[0067] Alternatively, or in addition to lacking part or all of the TM domain, the polypeptide may lack part or substantially all or all of the intracellular domain of HCMV gH.

[0068] In a preferred embodiment, the gH polypeptide lacks substantially all of the intracellular domain. In a more preferred embodiment, the gH polypeptide lacks the full-length naturally occurring intracellular domain.

[0069] In a preferred embodiment, the gH polypeptide lacks all of the TM domain and all of the intracellular domain.

[0070] In one embodiment, the gH comprises the ectodomain of a full-length gH encoded by the UL75 gene.

[0071] HCMV glycoprotein H (gH), encoded by the UL75 gene, is a virion glycoprotein essential for inactivation and is conserved among members of the alpha, beta and gamma herpesviruses. gH forms a stable complex with gL, and the formation of this complex promotes cell surface expression of gH. Based on the crystal structures of the HSV-2 and EBV gH / gL complexes, the gL subunit and the N-terminal residues of gH form a globular domain ("head") at one end of the structure that is involved in the interaction with gB and activation of membrane fusion. The C-terminal domain ("tail") of gH, proximal to the viral membrane, is also involved in membrane fusion. In one embodiment, the gH polypeptide of the pentameric complex described herein comprises an amino acid sequence having at least 80% identity to SEQ ID NO:2. In particular, the gH antigen is a polypeptide of SEQ ID NO:2: The present invention includes amino acid sequences having at least 85% identity, at least 90% identity, at least 95% identity, at least 97% identity, at least 98% identity, at least 99% identity or even 100% identity to.

[0072] In a preferred embodiment, the gH polypeptide comprises an amino acid sequence having 100% identity to SEQ ID NO:2.

[0073] HCMV glycoprotein L (gL) is encoded by the UL115 gene. gL is thought to be essential for viral replication, and all known functional properties of gL are directly related to its dimerization with gH. The gL / gH complex is required for the fusion of viral and cellular membranes that leads to viral entry into the host cell.

[0074] According to one embodiment, the gL polypeptide of the pentameric complex described herein comprises an amino acid sequence having at least 80% identity to SEQ ID NO: 3. In particular, the gL antigen comprises SEQ ID NO: 3: AAVSVAPTAAEKVPAECPELTRRCLLGEVFQGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYERSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR.

[0075] In a preferred embodiment, the gL polypeptide comprises an amino acid sequence having 100% identity to SEQ ID NO:3.

[0076] According to one embodiment, the UL128 polypeptide of the pentameric complex described herein comprises an amino acid sequence having at least 80% identity to SEQ ID NO: 4. In particular, the UL128 antigen comprises SEQ ID NO: 4: EECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ.

[0077] In a preferred embodiment, the UL128 polypeptide comprises an amino acid sequence having 100% identity to SEQ ID NO:4.

[0078] UL130 is the central and largest (214 codon) gene of the UL131A-128 locus. Conceptual translation of the gene predicts a long (25 amino acids) N-terminal signal sequence preceding a hydrophilic protein containing two potential N-linked glycosylation sites (Asn85 and Asn118) within a putative chemokine domain (amino acids 46-120), and an additional N-glycosylation site (Asn201) near the end of a unique C-terminal region. UL130 is predicted to lack a TM domain.

[0079] UL130 has been reported to be a luminal glycoprotein that is inefficiently secreted from infected cells but is incorporated into the virion envelope as a Golgi-mature form (Patrone et al.: "Human Cytomegalovirus UL130 Protein Promotes Endothelial Cell Infection through a Producer Cell Modification of the Viral Infection"). rion.”, Journal of Virology 79 (2005): pp. 8361-8373).

[0080] According to one embodiment, the UL130 polypeptide of the pentameric complex described herein comprises an amino acid sequence having at least 80% identity to SEQ ID NO: 5. In particular, the UL130 antigen comprises SEQ ID NO: 5: SPWSTLTANQNPSPLWSKLTYSKPHDAATFYCPFIYPSPPRSPLQFSGFQRVLTGPECRNETLYLLYNREGQTLVERSSTWVKKVIWYLSGRNQTILQRMPRTASKPSDGNVQISVEDAKIFGAHMVPKQTKLLRFVVNDGTRYQMCVMKLESWAHVFRDYSVSFQVRLTFTEANNQTYTFCTHPNLIV.

[0081] In a preferred embodiment, the UL130 polypeptide comprises an amino acid sequence having 100% identity to SEQ ID NO:5.

[0082] The function of UL131, also called UL131A, is required for HCMV replication in epithelial cells as well as endothelial cells. According to one embodiment, the UL131A polypeptide of the pentameric complex described herein comprises an amino acid sequence having at least 80% identity with SEQ ID NO: 6. In particular, the UL131A antigen comprises SEQ ID NO: 6: The present invention includes an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 97% identity, at least 98% identity, at least 99% identity or even 100% identity to QCQRETAEKNDYYRVPHYWDACSRALPDQTRYKYVEQLVDLTLNYHYDASHGLDNFDVLKRINVTEVSLLISDFRRQNRRGGTNKRTTFNAAGSLAPHARSLEFSVRLFAN.

[0083] In a preferred embodiment, the UL131 polypeptide comprises an amino acid sequence having 100% identity to SEQ ID NO:6. SEQ ID NOs: 2-6 are derived from strain BE / 28 / 2011 (Genbank ID KP745669, Kremkow et al., 2015).

[0084] In the pentameric complex antigen portion of the immunogenic composition of the present invention, gH, gL and UL128 are linked through disulfide bonds, while UL130 and UL131A are incorporated into the pentameric complex by non-covalent interaction.For example, UL130 protein and / or UL131A protein are incorporated into the pentameric complex by non-covalent interaction.Furthermore, UL130 protein and / or UL131A protein are linked by non-covalent interaction.

[0085] A series of conformational epitopes for the pentameric complex are known. For example, Macagno (Macagno et al.: "Isolation of human monoclonal antibodies that potently neutralize human cytomegalovirus infection by targeting different epitopes on the gH / gL / UL128-131 complex." Journal of Virology 84 (2010): 1005-13) isolated a panel of human monoclonal antibodies that neutralize HCMV infection of endothelial, epithelial, and myeloid cells. In one embodiment, the pentameric complex antigen portion of the immunogenic composition of the invention is one or more of the conformational epitopes identified by Macagno (2010). or more conformational epitopes.

[0086] Each protein of the pentameric complex antigen may contain mutations such as insertions, deletions and substitutions, as long as these mutations are not detrimental to the use of the protein as an antigen.Furthermore, such mutations should not hinder the ability of the protein to form the pentameric complex according to the present invention.The ability to form the pentameric complex of the present invention can be tested by carrying out protein purification and analyzing the protein by non-reducing PAGE, Western blot and / or size exclusion chromatography.If the protein forms part of a complex, the protein may all be present in a single band on a non-denaturing PAGE gel and / or in a single peak on a size exclusion chromatogram.

[0087] The expression of the pentameric complex can be achieved according to methods known to those skilled in the art, for example, the method described in Hofmann et al. (Biotechnology and Bioengineering, 2015).

[0088] Suitable expression systems for use in the context of the present invention are well known to those skilled in the art, and many are described in detail in Doyle (Doyle, ed. High Throughput Protein Expression and Purification: Methods and Protocols (Methods in Molecular Biology). Humana Press, 2008). In general, any system or vector suitable for maintaining, propagating and expressing a nucleic acid molecule that produces a polypeptide in a required host can be used. The appropriate nucleotide sequence can be inserted into the expression system by any of a variety of well-known and routine techniques, such as, for example, the techniques described in Sambrook (Sambrook, J. Molecular Cloning: A Laboratory Manual. 3rd ed. Cold Spring Harbor Laboratory Press, 2000). In general, the coding gene is placed under the control of control elements such as a promoter and, optionally, an operator, such that the DNA sequence encoding the desired peptide is transcribed into RNA in the transformed host cell. Examples of suitable expression systems include, for example, vectors derived from: bacterial plasmids, bacteriophages, transposons, yeast episomes, insertion elements, yeast chromosomal elements, viruses (such as baculoviruses (e.g., as described in patent application WO2015170287), papovaviruses (e.g., SV40), vaccinia viruses, adenoviruses, fowlpox viruses, pseudorabies viruses, and retroviruses), or combinations thereof, such as chromosomal, episomal, and viral-derived systems, including those derived from plasmids and bacteriophage genetic elements, including cosmids and phagemids. Human artificial chromosomes (HACs) can also be used to deliver larger DNA fragments contained and expressed in plasmids.

[0089] There are several possibilities for expressing the five different recombinant proteins of the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen simultaneously and in equimolar conditions. The first possibility (1) for the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen part of the immunogenic composition of the invention is to construct a single vector containing all five ORFs under the control of the same or similar regulatory elements (promoter, enhancer, splice signals, termination signals...) and optionally a selection system for cell line selection. The vector may contain five expression cassettes (e.g., as described in Albers et al., J. Clin. Invest., 2015, 125(4):1603-1619; or Cheshenko et al., Gene Ther., 2001, 8(11):846-854), or the five components (gH, gL, UL128, UL130 and UL131) trigger proper polyprotein maturation into the five proteins of the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen. In the second case, equimolarity is guaranteed assuming that all cleavage occurs correctly. Another possibility (2) regarding the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen portion of the immunogenic composition of the present invention is to construct five vectors, each expressing one component of the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen, and optionally a selection system for cell line selection. The five vectors are co-transfected into the target cell line. Any intermediate system between possibilities (1) and (2) is also designed to minimize the number of vectors required and to keep each vector to a reasonable size (e.g., less than 12 kb).

[0090] Suitable expression systems include microorganisms, such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected or transformed with viral expression vectors (e.g., baculovirus (e.g., as described in patent application WO2015170287)); plant cell systems transformed with viral expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or bacterial expression vectors (e.g., Ti or pBR322 plasmids); or animal cell systems. Cell-free translation systems can also be used to produce proteins.

[0091] Examples of suitable plant cell gene expression systems include those described in U.S. Pat. No. 5,693,506; U.S. Pat. No. 5,659,122; U.S. Pat. No. 5,608,143, and Zenk (1991): "Chasing the enzymes of secondary metabolism: Plant cell cultures as a pot of goal." Phytochemistry, 30(12), pp. 3861-3863. Zess NaukUMK Tornu, 13:253-256. In particular, all plants from which protoplasts are isolated and cultured to result in whole regenerated plants, so that whole plants containing the transgene are recovered, are used. In practice, all plants are regenerated from cultured cells or tissues, including but not limited to sugarcane, sugar beet, cotton, fruit and other trees, legumes, and all major species of vegetables.

[0092] HEK293 cells are suitable for the transient expression of HCMV proteins in the pentameric complex according to the invention due to their high transfection capacity by various techniques, including calcium phosphate and polyethyleneimine (PEI) methods. A useful cell line of HEK293 is one that expresses the EBNA1 protein of EBV, e.g. 293-6E (Loignon et al.: "Stable high volumetric production of glycosylated human recombinant IFNalpha2b in HEK293 cells." BMC Biotechnology 8 (2008): 65). It has been shown that transformed HEK293 cells secrete high levels of proteins into the growth medium, thus allowing the purification of such protein complexes directly from the growth medium.

[0093] CHO cells are a particularly suitable mammalian host for the industrial production of HCMV proteins, and in particular the HCMV gH / gL / UL128 / UL130 / UL131 pentameric composite antigen portion of the immunogenic composition according to the invention.

[0094] Transfection can be carried out by a range of methods well known in the art, including the use of calcium phosphate, electroporation, or by mixing cationic lipids with materials to produce liposomes that fuse with cell membranes and deposit cargo inside.

[0095] Methods for purifying recombinant proteins from cell supernatants or inclusion bodies are well known in the art. In particular, the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen portion of the immunogenic composition according to the invention can be purified by size exclusion chromatography.

[0096] In particular, the immunogenic composition according to the invention does not comprise the HCMV virus. In particular, the immunogenic composition according to the invention is an immunogenic composition as described herein in which HCMV gB and the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex are the only HCMV antigens.

[0097] Th1-inducing adjuvants "Adjuvant" as used herein has the meaning generally known to those skilled in the art. In particular, adjuvant refers to an agent or substance that modulates the immunogenicity of an antigen. "Modulating immunogenicity" includes enhancing the magnitude and / or duration of the immune response generated by an antigen. More specifically, adjuvants can also be classified according to the type of immune response they induce in the presence of an antigen. The adjuvant that can be used in the immunogenic composition according to the present invention is a Th1-inducing adjuvant.

[0098] A "Th1 inducing" adjuvant can be defined as an adjuvant that enhances the Th1 response to an antigen or combination of antigens.

[0099] Immune responses can be broadly divided into two extreme categories: humoral or cell-mediated immune responses (traditionally characterized by antibodies and cellular effector defense mechanisms, respectively). These categories of responses have been termed Th1-type responses (cell-mediated responses), and Th2-type immune responses (humoral responses). In mice, Th1-type responses are often characterized by the production of antibodies of IgG2a or IgG2c subtypes (depending on the mouse strain), whereas in humans these may correspond to IgG1 and IgG3-type antibodies. Th2-type immune responses are characterized by the production of a broad range of immunoglobulin isotypes, including IgG1, IgA, and IgM in mice. Th1-type and Th2-type immune responses are also characterized by different patterns of cytokine secretion (Mosmann et al., Annual Review of Immunology, 1989, 7:145-173; Constant et al., Annual Review of Immunology, 1997, 15:297-322). Th1-type immune responses are associated with increased production of IFN-γ and / or IL-2 cytokines by T lymphocytes, whereas Th-2-type immune responses are associated with increased production of IL-4, IL-5, IL-6, IL-13, and / or IL-10 cytokines. The distinction between Th1 and Th2-type immune responses is not absolute. In practice, subjects will favor immune responses that are described as Th1- or Th2-dominant. Traditionally, the best indicators of the Th1:Th2 balance of immune responses after vaccination or infection include direct measurement of Th1 or Th2 cytokine production by T lymphocytes in vitro when stimulated with antigen, and / or measurement of the IgG1:IgG2a,c ratio of antigen-specific antibody responses (at least in mice).

[0100] Also, in an embodiment of the immunogenic composition according to the invention, an adjuvant that induces an immune response predominantly of the Th1 type is considered a Th1-inducing adjuvant. Preferentially, the adjuvants that can be used in the immunogenic composition according to the invention induce an immune response predominantly of the Th1 type.

[0101] As previously described, this can be determined by measuring the IgG1:IgG2a,c ratio in mice. Increased INF-γ is a further indicator of a dominant Th1 response. Preferably, a decrease in the production of IL-5 is also observed.

[0102] Preferably, a Th1-inducing adjuvant that can be used in an immunogenic composition according to the invention comprising an HCMV gB antigen and an HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen induces a more Th1-biased response profile than MF59 in a composition comprising the same HCMV gB antigen and the same HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0103] MF59 is a squalene-based oil-in-water emulsion described in patent application WO 90 / 14837, U.S. Patent Nos. 6,299,884 and 6,451,325, and in Ott et al., "MF59--Design and Evaluation of a Safe and Potent Adjuvant for Human Vaccines," in Vaccine Design: The Subunit and Adjuvant Approach (eds. Powell, MF and Newman, MJ) Plenum Press, New York, 1995, pp. 277-296).

[0104] In particular, a Th1-inducing adjuvant that can be used in an immunogenic composition according to the invention comprising HCMV gB antigen and HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen induces a lower IgG1:IgG2a,c ratio in mice than MF59 in a composition comprising the same HCMV gB antigen and the same HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0105] More specifically, a Th1-inducing adjuvant that can be used in an immunogenic composition according to the invention comprising an HCMV gB antigen and an HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen induces higher INF-γ levels in mice than MF59 in a composition comprising the same HCMV gB antigen and the same HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0106] Even more specifically, a Th1-inducing adjuvant that can be used in an immunogenic composition according to the invention comprising an HCMV gB antigen and an HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen induces lower IL-5 levels in mice than MF59 in a composition comprising the same HCMV gB antigen and the same HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0107] Even more specifically, a Th1-inducing adjuvant that can be used in an immunogenic composition according to the invention comprising HCMV gB antigen and HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen induces a lower IgG1:IgG2a,c ratio and higher INF-γ levels in mice than MF59 in a composition comprising the same HCMV gB antigen and the same HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0108] In particular, the Th1-inducing adjuvant that can be used in an immunogenic composition according to the invention comprising HCMV gB antigen and HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen induces a lower IgG1:IgG2a,c ratio and lower IL-5 levels in mice than MF59 in a composition comprising the same HCMV gB antigen and the same HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0109] More specifically, the immunogenic composition according to the invention comprises HCMV gB antigen and HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen. A Th1-inducing adjuvant capable of inducing IgG1:IgG2a,c ratios, higher INF-γ levels and lower IL-5 levels in mice than MF59 in a composition containing the same HCMV gB antigen and the same HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0110] In particular, the immunogenic composition according to the invention comprises: - HCMV gB antigen; - HCMV gH / gL / UL128 / UL130 / UL131 pentameric antigen complex; and - Th1-inducing adjuvants wherein the Th1 inducing adjuvant induces a lower IgG1:IgG2a,c ratio and / or higher INF-γ levels and / or lower IL-5 levels in mice than MF59 in a composition comprising the same HCMV gB antigen and the same HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen.

[0111] In particular, the Th1 inducing adjuvant according to the invention comprises: - a TLR-4 agonist; or - Linear or branched chain polyacrylic acid polymer salts having a weight average molecular weight Mw in the range of 350 to 650 kDa Includes.

[0112] In particular, the immunogenic composition according to the invention comprises: - HCMV gB antigen; - HCMV gH / gL / UL128 / UL130 / UL131 pentameric antigen complex; and - Th1-inducing adjuvants wherein the Th1 inducing adjuvant comprises: - a TLR-4 agonist selected from the group consisting of lipopolysaccharide, monophosphoryl lipid A (MPL), 3-O-deacylated monophosphoryl lipid A (3D-MPL), glucopyranosyl lipid adjuvant (GLA), second generation lipid adjuvant (SLA), phospholipid dimers linked by a non-carbohydrate backbone and an aminoalkyl glucosaminide phosphate, or derivatives thereof; or - Polyacrylic acid polymer salts having a weight average molecular weight Mw in the range of 350-650 kDa The immunogenic composition comprises:

[0113] In one embodiment, the Th1 inducing adjuvant comprises a TLR-4 agonist.

[0114] TLR (toll-like receptor) agonists are understood to mean natural TLR ligands, TLR ligand mimetics, synthetic or chemical TLR ligands, cells or particles containing pathogen-associated molecular patterns, microbial pathogens, bacteria, viruses and virus-like particles.

[0115] TLR4 (toll-like receptor type 4) is a receptor expressed by antigen-presenting cells of the immune system; TLR4 is involved in the initial defense mechanism against gram-bacterial infections. Lipopolysaccharide (LPS) of gram-bacteria is the natural ligand for TLR4; TLR4 activates the receptor and triggers a cascade of biochemical events, in particular the activation of the Nf-kappa B transcription factor and the production of proinflammatory cytokines. The ability of a compound to stimulate the TLR4 pathway can be determined by methods known to those skilled in the art, for example as described in Journal of Biological Chemistry, (2001), Vol. 276(3), pp. 1873-1880. It can be evaluated.

[0116] Examples of TLR4 agonists include monophosphoryl lipid A (MPL) or a derivative thereof, in particular 3-O-deacylated monophosphoryl lipid A (3D-MPL) as described in GB2211502 or US4912094, or a derivative thereof, phosphorylated hexaacyl disaccharide (CAS number 1246298-63-4), also called glucopyranosyl lipid adjuvant or GLA, or a derivative thereof, second generation lipid adjuvants (SLA) (see, e.g., Carter et al., Clin. Transl.Immunology, 2016, 5(11):e108 or EP2437753 or US9480740), or derivatives thereof, aminoalkyl glucosaminide phosphates (AGPs) as described in WO98 / 50399 or WO01 / 034617, or derivatives thereof, in particular RC529 as described in US6,113,918, or derivatives thereof, as well as non-carbohydrate backbone phosphates as described in US2003 / 0153532 or US2005 / 0164988. or derivatives thereof, in particular under the names: ER803022 (CAS number: 287180-56-7), ER803058 (CAS number: 287180-57-8), ER803732 (CAS number: 287106-29-0), ER803789 (CAS number: 287180-61-4), ER804053 (CAS number: 287180-62-5), ER804057 (CAS number: No.: 287180-63-6), ER804058 (CAS No.: 287180-65-8), ER804059 (CAS No.: 287180-64-7), ER8044442 (CAS No.: 287180-78-3), ER804764 (CAS No.: 287180-87-4), ER111232 (CAS No.: 287180-48-7), ER112022 (CAS No.: 287180-46-5), ER112048 (CAS No.: 287106-02-9), ER ER112065 (CAS number: 287180-49-8), ER112066 (CAS number: 287180-50-1), ER113651 (CAS number: 287180-51-2), ER118989 (CAS number: 287180-52-3), ER119327 (CAS number: 287180-54-5) and ER119328 (CAS number: 287180-55-6), or derivatives thereof, are identified and exemplified in US2003 / 0153532. These compounds generally have one or several asymmetric carbons. When these compounds have one or several asymmetric carbons, the compounds can be used as a mixture of optical isomers or in the form of a specific isomer.

[0117] In particular, said TLR-4 agonist is selected from phospholipid dimers linked by a non-carbohydrate backbone and GLA TLR-4 agonists.

[0118] In particular, the TLR4 agonists are phospholipid dimers linked by a non-carbohydrate backbone.

[0119] In particular, the TLR4 agonist is a chemical compound or a phospholipid dimer linked by a non-carbohydrate backbone of formula I, II, III or IV: Compounds or phospholipid dimers linked by a non-carbohydrate backbone of formula I [ka]

[0120] Compounds or phospholipid dimers linked by a non-carbohydrate backbone of formula II [ka]

[0121] Compounds or phospholipid dimers linked by a non-carbohydrate backbone of formula III [ka]

[0122] Compounds or phospholipid dimers linked by a non-carbohydrate backbone of formula IV [ka] wherein for each of Formula I, II, III or IV, R1 is: a) C(O); b) C(O)-(C1-C 14 alkyl)-C(O), wherein the C1 to C 14alkyl is optionally substituted with hydroxyl, C1-C5 alkoxy, C1-C5 alkylenedioxy, (C1-C5 alkyl)amino or (C1-C5 alkyl)aryl, wherein the aryl portion of the (C1-C5 alkyl)aryl is optionally substituted with C1-C5 alkoxy, (C1-C5 alkyl)amino, (C1-C5 alkoxy)amino, (C1-C5 alkyl)amino(C1-C5 alkoxy), -O-(C1-C5 alkyl)amino(C1-C5 alkoxy), -O-(C1-C5 alkyl)amino-C(O)-(C1-C5 alkyl)-C(O)OH, or -O-(C1-C5 alkyl)amino-C(O)-(C1-C5 alkyl)-C(O)-(C1-C5 alkyl)-C(O)-(C1-C5)alkyl; c) C2-C alkyl optionally substituted with hydroxyl or alkoxy; 15 Alkyl, including straight or branched chains; and d)-C(O)-(C6-C 12 arylene)-C(O)-, wherein said arylene is optionally substituted with hydroxyl, halogen, nitro, or amino; is selected from the group consisting of a and b are independently 0, 1, 2, 3 or 4; d, d', d'', e, e' and e'' are independently 0, 1, 2, 3 or 4; X 1 , X 2 , Y 1 and Y 2 is the null value, oxygen, NH and N(C(O)(C1-C 14 alkyl), and N(C1-C 14 alkyl); W 1 and W 2 is independently selected from the group consisting of carbonyl, methylene, sulfone, and sulfoxide; R 2 and R 5 teeth: a) C2-C optionally substituted with oxo, hydroxyl or alkoxy. 20 Straight or branched chain alkyl; b) C2-C optionally substituted with oxo, hydroxyl or alkoxy. 20 Straight or branched chain alkenyl or dialkenyl; c) C2-C optionally substituted with oxo, hydroxyl or alkoxy. 20 Straight or branched chain alkoxy; d) NH-(C2-C 20 straight or branched chain alkyl), wherein said alkyl groups are optionally substituted with oxo, hydroxy or alkoxy; and e) [ka] wherein Z is selected from the group consisting of O and NH, and M and N are C2-C 20 independently selected from the group consisting of alkyl, alkenyl, alkoxy, acyloxy, alkylamino and acylamino, including straight or branched chains; R 3 and R 6 is a C2-C optionally substituted with oxo or fluoro; 20 independently selected from the group consisting of straight or branched chain alkyl or alkenyl; R 4 and R 7 is C(O)-(C2~C 20 Straight or branched chain alkyl or alkenyl), C2-C 20 Straight or branched chain alkyl, C2-C 20 Linear or branched chain alkoxy C, and C2~C 20 straight or branched chain alkenyl; wherein said alkyl, alkenyl or alkoxy groups are independently and optionally substituted with hydroxyl, fluoro, or C1-C5 alkoxy; G1, G2, G3 and G4 are independently selected from the group consisting of oxygen, methylene, amino, thiol, -C(O)NH-, -NHC(O)-, and -N(C(O)(C1-C4 alkyl))-; or G2R4 or G4R7 together may be a hydrogen atom or a hydroxyl; And herein, with respect to formula III: a' and b' are independently 2, 3, 4, 5, 6, 7 or 8, preferably 2; Z 1 is -OP(O)(OH)2, -P(O)(OH)2, -OP(O)(OR 8 )(OH), where R 8 are C1-C4 alkyl chains, -OS(O)2OH, -S(O)2OH, -CO2H, -OB(OH)2, -OH, -CH3, -NH2 and -NR 9 3, where R 9 is a C1-C4 alkyl chain; Z 2 is -OP(O)(OH)2, -P(O)(OH)2, -OP(O)(OR 10 )(OH), where R 10 are C1-C4 alkyl chains, -OS(OH)2OH, -S(OH)2OH, -CO2H, -OB(OH)2, -OH, -CH3, -NH2 and -NR 11 where R 11 is a C1-C4 alkyl chain; and in which, with respect to formula IV: R 12 is H or a C1-C4 alkyl chain); or a pharma- ceutically acceptable salt of a compound or phospholipid dimer linked by a non-carbohydrate backbone of formula I, II, III or IV.

[0123] In particular, the TLR4 agonist according to the present invention has the formula I [ka] a chemical compound or a phospholipid dimer linked by a non-carbohydrate backbone of or a pharma- ceutically acceptable salt of this compound or a phospholipid dimer linked by a non-carbohydrate backbone.

[0124] Preferably, R 1 is C(O) or C(O)-(CH2)nC(O), where n is 1, 2, 3, or 4; a, b, d, d', d'', e, e' and e'' are independently 1 or 2; X1, X2, Y1 and Y2 are NH; W1 and W2 are C(O); R 2 and R 5 is an optionally substituted C 10 ~C 15 Straight chain alkyl, NH-(C 10 ~C 15 linear alkyl), and [ka] wherein M and N are independently selected from the group consisting of C2-C20 straight chain alkyl or alkenyl; R3 and R6 are C5 to C10 linear alkyl groups; R4 and R7 are selected from the group consisting of hydrogen, C(O)-(C8-C12 straight chain alkyl) or C(O)(C8 C12 straight chain alkenyl); G1 and G3 are oxygen or -NH(CO)-; G2 and G4 are oxygen.

[0125] In particular, the TLR4 agonist according to the present invention is a symmetric phospholipid dimer (homodimer) linked by a non-carbohydrate backbone. More specifically, the symmetric phospholipid dimer linked by a non-carbohydrate backbone is a dimer of triacyl phospholipid. More specifically, the TLR-4 agonist is E6020 (CAS number: 287180-63-6).

[0126] In particular, said TLR-4 agonist is GLA (CAS number 1246298-63-4).

[0127] These TLR4 agonists can also be combined with delivery systems such as calcium phosphate, liposomes, virosomes, ISCOMs, micro- and nanoparticles, or emulsions.

[0128] Therefore, in particular, the TLR4 agonists according to the invention are in combination with delivery systems such as aqueous nanosuspensions, calcium phosphates, liposomes, virosomes, ISCOMs, micro- and nanoparticles, or emulsions.

[0129] Such delivery systems have been described previously and are well known to those of skill in the art.

[0130] In particular, the TLR-4 agonist is E6020 (CAS number: 287180-63- 6) and GLA (CAS number 1246298-63-4) TLR-4 agonists.

[0131] An example of a suitable formulation of a TLR4 agonist in combination with a delivery system includes a compound of the formula: [ka] Citation may be made of an oil-in-water emulsion comprising as a TLR4 agonist the compound ER804057 (now called E6020) (CAS number: 287180-63-6), which is the disodium salt of a compound having the formula:

[0132] The four asymmetric carbons of E6020 are all in the R configuration (R,R,R,R). Such emulsions can be obtained, for example, by the microfluidization method described in WO2004 / 060396 or the phase inversion temperature process (PIT process) described in WO2007 / 080308.

[0133] Therefore, in particular, the TLR4 agonist according to the present invention is in combination with an oil-in-water emulsion, more particularly a squalene-based oil-in-water emulsion.

[0134] Oil-in-water emulsions suitable for the purposes of the present invention comprise a metabolisable oil (the volume of the oil represents 0.5-20% (v / v), in particular 1-10% (v / v), and more particularly 1-5% (v / v) of the total volume of the emulsion), an aqueous solution (the volume of the aqueous solution represents 80-99.5% (v / v), in particular 90-99% (v / v) of the total volume) and one or several emulsifiers (the total amount of emulsifiers represents 0.001-5% (w / w), in particular 0.001-2% (w / w), and more particularly 0.01-2% (w / w) of the total volume of the emulsion). Metabolisable oils are generally those having from about 6 to about 30 carbon atoms, including but not limited to alkanes, alkenes, alkynes, and their corresponding acids and alcohols, their ethers and esters, and mixtures thereof. The oil may be essentially any vegetable, fish, animal or synthetically produced oil that is metabolized by the body of the human subject to which the emulsion composition is administered and is substantially non-toxic to the subject. The metabolizable oil may be an unsaturated hydrocarbon having 20-40 carbons, or a branched chain polyunsaturated hydrocarbon having 20-40 carbon atoms, such as a terpenoid. Squalene, 2,6,1 The unsaturated terpenoid known as 0,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene, and its saturated analog, squalane, are often preferred. Fish oils, including squalene and squalane, are readily available from commercial sources or can be obtained by methods known in the art. Another commonly used oil is tocopherol. When the composition contains tocopherol, either α, β, γ, δ, ε or ξ tocopherol is used, with α-tocopherol being preferred. A significant number of suitable emulsifiers (also called surface active agents, surfactants, etc.) are used in pharmacy, many of which are useful in the compositions of the emulsions of the present invention, so long as they are sufficiently non-toxic. There are numerous emulsifiers that are specifically designed for and commonly used in biological situations. For example, numerous biological surfactants (surface active agents) are listed by Sigma Chemical for this purpose. Such surfactants are divided into four basic types: anionic, cationic, zwitterionic, and nonionic.

[0135] Examples of anionic surfactants include alginic acid, caprylic acid, cholic acid, 1-decanesulfonic acid, deoxycholic acid, 1-dodecanesulfonic acid, N-lauroylsarcosine, and taurocholic acid.

[0136] Cationic surfactants include dodecyltrimethylammonium bromide, benzalkonium chloride, benzyldimethylhexadecylammonium chloride, cetylpyridinium chloride, methylbenzethonium chloride, and 4-picoline dodecyl sulfate.

[0137] Examples of zwitterionic surfactants include 3-[(3-cholamidopropyl)-dimethylammonio]-1-propanesulfonate (commonly abbreviated as CHAPS), 3-[(cholamidopropyl)dimethylammonio-2-hydroxy-1-propanesulfonate (commonly abbreviated as CHAPSO), N-dodecyl-N,N-dimethyl-3-ammonio-1-propanesulfonate, phosphatidylcholine, and lyso-alpha-phosphatidylcholine.

[0138] Examples of nonionic surfactants include decanoyl-N-methylglucamide, diethylene glycol monopentyl ether, n-dodecyl beta-D-glucopyranoside, poloxamers, ethylene oxide condensates of fatty alcohols (e.g., those sold under the trade name Lubrol), polyoxyethylene ethers of fatty acids (especially C12-C20 fatty acids), polyoxyethylene sorbitan fatty acid esters (e.g., those sold under the trade name Tween®), and sorbitan fatty acid esters (e.g., those sold under the trade name Span®).

[0139] A particularly useful class of surfactants are the sorbitan-based nonionic surfactants. These surfactants are typically prepared by dehydrating sorbitol to give 1,4-sorbitan, which is then reacted with one or more equivalents of a fatty acid. The fatty acid-substituted moiety can be further reacted with ethylene oxide to give a second class of surfactants.

[0140] Fatty acid substituted sorbitan surfactants are typically made by reacting 1,4-sorbitan with a fatty acid such as lauric acid, palmitic acid, stearic acid, oleic acid, or a similar long chain fatty acid to give a 1,4-sorbitan monoester, 1,4-sorbitan sesquiester, or 1,4-sorbitan triester. Common names for some of these surfactants include, for example, sorbitan monolaurate, sorbitan monopalmitate, sorbitan monostearate, sorbitan monooleate, sorbitan sesquioleate, and sorbitan trioleate. These surfactants are generally referred to as S They are commercially available under the names PAN® or ARLACEL®. SPAN® and ARLACEL® surfactants are lipophilic and generally soluble or dispersible in oil. They are also soluble in most organic solvents. They are generally insoluble in water, but dispersible. Generally, these surfactants have a hydrophilic-lipophilic balance (HLB) number between 1.8 and 8.6. Such surfactants can be readily made by means known in the art or are commercially available.

[0141] Related surfactant groups include polyoxyethylene sorbitan monoesters and polyoxyethylene sorbitan triesters. These materials are typically produced by the addition of ethylene oxide to 1,4-sorbitan monoesters or triesters. The addition of polyoxyethylene converts the lipophilic sorbitan monoester or triester surfactants into hydrophilic surfactants that are generally soluble or dispersible in water and soluble to various degrees in organic liquids. TWEEN® surfactants can be combined, for example, with related sorbitan monoester or triester surfactants to promote emulsion stability. TWEEN® surfactants generally have HLB values ​​that lie between 9.6 and 16.7. TWEEN® surfactants are commercially available from a number of manufacturers, such as ICI America's Inc., Wilmington, Delaware, under the registered trademark ATLAS® surfactants.

[0142] Another group of non-ionic surfactants that can be used alone or in combination with SPAN®, ARLACEL® and / or TWEEN® surfactants are the polyoxyethylene fatty acids made by the reaction of ethylene oxide with long chain fatty acids. The most commonly available surfactants of this type are sold under the name MYRJ® and are polyoxyethylene derivatives of stearic acid. MYRJ® surfactants are hydrophilic and soluble or dispersible in water, just like TWEEN® surfactants. MYRJ® surfactants may be blended with, for example, TWEEN® surfactants or TWEEN® / SPAN® or ARLACEL® surfactant mixtures for use in forming emulsions. MYRJ® surfactants can be made by methods known in the art or are commercially available from ICI America's Inc.

[0143] Another group of polyoxyethylene-based nonionic surfactants are the polyoxyethylene fatty acid ethers derived from lauryl, acetyl, stearyl and oleyl alcohols. These materials are typically produced as described above by the addition of ethylene oxide to fatty alcohols. The trade name for these surfactants is BRIJ®; BRIJ® surfactants can be hydrophilic or lipophilic depending on the size of the polyoxyethylene portion of the surfactant. The manufacture of these compounds is available in the art, but they are also readily available from commercial sources such as ICI America's Inc.

[0144] Other nonionic surface-active substances which can be used in the practice of the invention are, for example: polyoxyethylene, polyol fatty acid esters, polyoxyethylene ethers, polyoxypropylene fatty ethers, polyoxyethylene-containing beeswax derivatives, polyoxyethylene lanolin derivatives, polyoxyethylene fatty glycerides, glycerin fatty acid esters or other polyoxyethylene acid alcohols or ether derivatives of long-chain fatty acids of 12 to 22 carbon atoms. Preferably, the polyoxyethylene alkyl ethers are ceteareth-12 (sold under the name Eumulgin® B1), ceteareth-20 (sold under the name Eumulgin® B1), ceteareth-30 (sold under the name Eumulgin® B2), ceteareth-40 (sold under the name Eumulgin® B1), ceteareth-50 (sold under the name Eumulgin® B1), ceteareth-60 (sold under the name Eumulgin® B1), ceteareth-70 (sold under the name Eumulgin® B2), ceteareth-80 (sold under the name Eumulgin® B1), ceteareth-90 (sold under the name Eumulgin® B1), ceteareth-100 (sold under the name Eumulgin® B1), ceteareth-110 (sold under the name Eumulgin® B1), ceteareth-12 ... The polyoxyethylene alkyl ether is selected from the group consisting of ceteth-20 (Eumulgin® B2), steareth-21 (Eumulgin® S21), ceteth-20 (Simulsol® 58 or Brij® 58), ceteth-10 (Brij® 56), steareth-10 (Brij® 76), steareth-20 (Brij® 78), oleth-10 (Brij® 96 or Brij® 97) and oleth-20 (Brij® 98 or Brij® 99). The number ascribed to each chemical name corresponds to the number of ethylene oxide units in the chemical formula. In a particular embodiment, the polyoxyethylene alkyl ether is BRIJ® 56 or polyoxyethylene (12) cetostearyl ether offered by the company Cognis under the name Eumulgin® B1. Among particularly suitable sorbitan ester and mannide ester-based surfactants having an HLB of less than 9, mention may be made of the sorbitan monooleate sold under the name Dehymuls SMO™ or Span® 80. Among mannide ester-based surfactants, mention may be made of the mannide monooleate sold by the company Sigma or under the name Montanide 80™ by the company Seppic.

[0145] Two or more surface-active agents may be combined in the emulsion portion of the compositions of the present invention.

[0146] The aqueous solution of the O / W emulsion portion of the composition of the present invention is a buffered saline solution or pure water. Since the composition of the present invention is intended for parenteral administration, it is preferable to make the final buffer solution used as a vaccine have essentially the same tonicity, i.e., osmotic pressure, as normal physiological fluids, in order to prevent swelling or rapid absorption after administration of the composition due to the difference in ion concentration between the composition and physiological fluids. It is also preferable to buffer the saline solution in order to maintain a pH compatible with normal physiological conditions. In addition, in certain cases, it may be necessary to maintain the pH at a specific level to ensure the stability of gB antigen and HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen, if they are present in the O / W emulsion.

[0147] Any physiologically acceptable buffer may be used herein, but phosphate buffers are preferred. Other acceptable buffers such as acetate, tris, bicarbonate, carbonate, citrate, etc. may be used as alternatives to phosphate buffers. The pH of the aqueous component is preferably between 6.0 and 8.0.

[0148] The O / W emulsion portion of the composition of the present invention may contain supplemental ingredients which may be added at the time the O / W emulsion is made or which may be added once the O / W emulsion has been made.

[0149] By way of example, AF04, a squalene-based oil-in-water (O / W) emulsion containing E6020, obtained according to the process described in WO2007 / 080308, can be mentioned.

[0150] GLA (CAS number 1246298-63-4) TLR-4 agonist has the following chemical formula: [ka] It is a compound having the formula:

[0151] GLA can be purchased, for example, from the Avanti Polar catalogue, reference number 699800 (Avanti Polar Lipids Inc., Alabaster, USA).

[0152] In particular, GLA is combined with a delivery system such as calcium phosphate, liposomes, virosomes, ISCOMs, micro- and nanoparticles, or emulsions. Preferentially, GLA is combined with an oil-in-water emulsion, more particularly a squalene-based oil-in-water emulsion.

[0153] An example can be given: GLA-SQEM, a squalene-based oil-in-water (O / W) emulsion containing GLA.

[0154] Table 1 below lists the amounts of the various raw materials used to obtain 100 mL of GLA-SQEM at a concentration of 10% squalene. The final emulsion contains 4% (v / v) squalene (34 mg / ml) and 100 μg / mL GLA in 22.5 mM ammonium phosphate.

[0155] [Table 1]

[0156] The oil phase is produced by ultrasonication at 55-60 °C in a bath. The water phase is then added (weighed) on top of the oil phase. A pre-emulsion is obtained after homogenization at 9500 r / min with an Ultra Turrax T25 (IKA) for 30 seconds, during two cycles. Microfluidization is then performed during 20 passes with an Emulsiflex C3 at 55 psi air pressure (homogenization pressure between 1450-1600 bar). The emulsion is then diluted 2.5 times in 25 mM ammonium phosphate buffer to obtain the final GLA-SQEM emulsion with 4% squalene. The emulsion is sterile filtered at about 40 °C using a 10 ml syringe and an Acrodisc 0.8-0.2 μm Supor Membrane filter (PALL n° PN4187).

[0157] Other suitable adjuvants which contain a TLR4 agonist are AS01, which contains 3D-MPL and QS21 in a liposomal formulation, or AS02, which contains 3D-MPL and QS21 formulated in an oil-in-water emulsion (Garcon et al., Exp. Rev. of Vaccines, 2007, 6(5):723-739, EP0671948).

[0158] In one embodiment, the Th1-inducing adjuvant is a linear or branched polyacrylic acid polymer salt having a weight average molecular weight Mw in the range of 350-650 kDa.

[0159] The polymer is a linear or branched polyacrylic acid polymer, but is not a cross-linked polymer.

[0160] By "polyacrylic acid polymer" is meant a polymer consisting only of acrylic acid units, such that in salt form, said polyacrylic acid polymer salt consists only of units corresponding to salts of acrylic acid, or only of units corresponding to the free acid form of acrylic acid and units corresponding to salts of acrylic acid.

[0161] Linear or branched polyacrylic acid polymers are produced by polymerization of only acrylic acid as a monomer. The polymerization is most often carried out by radical polymerization using an oxidizing agent as initiator or catalyst. The most used oxidizing agents are persulfates (peroxydisulfates), for example sodium or potassium persulfate. Branched polyacrylic acid polymers are described, for example, in Macromolecules 2011, 44, pp. 5928-5936. When the polymer according to the invention is linear, its Mark Houwink slope is higher than or equal to 0.7 (Yan JK, Pei JJ, Ma HL, Wang ZB 2015. Effects of ultrasound on molecular properties, structure, chain conformation and degradation kinetics of carboxylic curdlan. Carb. Carb. Polymers. 121, pp. 64-70).

[0162] The polyacrylic acid polymer salt may be in solid form (precipitate or powder) or preferably in a liquid formulation. The liquid formulation will comprise the polyacrylic acid polymer salt and an aqueous solution. Preferably, such a formulation will have a pH in the range of 5.5 to 8.0. This pH can be obtained by incorporating a base such as NaOH into the aqueous solution. The aqueous solution may be an aqueous buffer solution obtained using a buffer such as a phosphate buffer, TRIS (2-amino-2-hydroxymethyl-1,3-propanediol), Hepes (4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid), histidine or citrate buffer. The liquid formulation may also comprise one or several additional salts such as NaCl.

[0163] In particular, said linear or branched polyacrylic acid polymer salts consist exclusively of units corresponding to salts of acrylic acid or consist exclusively of units corresponding to the free acid form of acrylic acid and units corresponding to salts of acrylic acid.

[0164] Advantageously, said polyacrylic acid polymer salt comprises less than 0.005%, preferably less than 0.001% (w / w) of an oxidizing agent relative to the total dry weight of said polyacrylic acid polymer salt, and / or less than 0.005%, preferably less than 0.001% (w / w) of a persulfate salt relative to the total dry weight of said polyacrylic acid polymer salt.

[0165] In a more specific embodiment, the polyacrylic acid polymer is a salt with Na+.

[0166] In a specific embodiment, the polyacrylic acid polymer salt has a polydispersity index of about 4 or less, preferably about 2.5 or less.

[0167] In a specific embodiment, the polyacrylic acid polymer salt has a weight average molecular weight Mw in the range of 380-620 kDa and a polydispersity index of 4 or less; or a weight average molecular weight Mw in the range of 400-600 kDa and a polydispersity index of 4 or less; or a weight average molecular weight Mw in the range of 380-620 kDa and a polydispersity index of 2.5 or less; or a weight average molecular weight Mw in the range of 400-600 kDa and a polydispersity index of 2 or less.

[0168] Advantageously, said polyacrylic acid polymer salt contains less than 0.005% w / w of acrylic acid monomer in free acid form or in salt form, based on the total dry weight of said polyacrylic acid polymer salt.

[0169] According to an advantageous embodiment, said polyacrylic acid polymer salt is in a liquid formulation having a pH ranging from 5.5 to 8.0.

[0170] According to an advantageous embodiment, the polyacrylic acid polymer salt is in an aqueous buffer solution, in particular with a phosphate buffer, or with a TRIS, Hepes, histidine or citrate buffer.

[0171] According to an advantageous embodiment, said polyacrylic acid polymer salt is diafiltered and sterilized.

[0172] When a polyacrylic acid polymer salt or a liquid formulation of a polyacrylic acid polymer salt is diafiltered, sterilization occurs after diafiltration.

[0173] According to the present invention, the weight average molecular weight Mw is obtained by size exclusion chromatography. Advantageously, three detectors are used after the size exclusion chromatography column: a right angle light scattering detector, a refractive index detector and a four-capillary differential viscometer. The dn / dc used to determine Mw is preferably determined using a refractive index detector with a panel of polyacrylic acid polymers of known concentration. The content of persulfates and the content of acrylic acid monomers in free acid form or salt form can be determined by high-performance anion exchange chromatography with conductivity detection.

[0174] The process for producing such a polymer may, for example, comprise the following successive steps: a) having a solution of a polyacrylic acid polymer; b) purifying the solution of polyacrylic acid polymer to remove impurities; and c) sterilizing the solution of purified polyacrylic acid polymer. Includes.

[0175] Such processes for storing solutions of polymer salts include, for example, the manufacturing processes described above, followed by storing the resulting polymer in solution.

[0176] In particular, said linear or branched polyacrylic acid polymer salt having a weight average molecular weight Mw in the range of 350-650 kDa is PAA225000.

[0177] The product named PAA225000 (reference number 18613, sodium salt) can be obtained in the form of a concentrated solution from Polysciences Europe (Eppelheim, Germany). It is diluted with water to obtain a concentration of 20 mg / ml and maintained under stirring at room temperature for 12 hours. The pH is adjusted to 7.55 with HCl and the solution is dialyzed (3 consecutive tanks) at room temperature against a 150 mM aqueous NaCl solution using 2 kDa cut-off dialysis cassettes (Thermo Fischer Scientific, Court-Avouf, France). The solution is then filtered through a 0.22 μm PVDF membrane for sterilization. The molecular weight of the polymer salt is then measured and can be 488550 Da. The Mn of the polymer salt can be 129070 Da and its IP can be 3.8.

[0178] The polymer is then stored at +4° C. as a solution containing 20 mg / ml of polymer in 150 mM NaCl aqueous solution. This solution is then mixed with PBS 1C concentrated 10 times with sterile water to obtain a saline solution containing 2 mg / ml of polymer salt.

[0179] Any other Th1-inducing adjuvant can be used in the compositions of the invention. Examples of adjuvants known to predominantly induce Th1-type immune responses include: saponins, such as those described in WO8809336 or US5057540, in particular QS21 and its synthetic or semi-synthetic analogues, TLR3 agonists, such as poly I:C and derivatives thereof, TLR5 agonists, such as flagellin and derivatives thereof, TLR7 agonists or TLR7 / 8 agonists, such as imidazoquinolines and derivatives thereof, such as those described in EP1318835, TLR8 agonists, such as motolimod, also known as VTX-2337 (described in Lu et al., Clin Cancer Res, 2012, 18(2):499-509) and derivatives thereof or TLR8 agonists developed by Dynavax, TLR9 agonists, such as CpG oligodeoxynucleotides and derivatives thereof (described in, for example, Vollmer et al., Expert Opin. Biol. Ther. 2005, 5(5):673-682), in particular ISS1018 or CpG7909, RIG-I-like receptor (RLR) agonists, such as RIG-I agonists, in particular 5' triphosphate RNA or small molecular weight agonists from Kineta, or stimulator of interferon genes (STING) agonists, in particular cyclic dinucleotides (e.g. c-di-AMP, c-di-GMP, c-di-GAMP), poly[di(carboxylatophenoxy)phosphazene] (PCPP), as described in Payne et al., Dev Biol Stand. 1998, 92:79-87, Dar A et al., Vet Immunol Immunopathol., 2012, 146(3-4):289-95, or an adjuvant or combination of adjuvants comprising poly[di(sodium carboxylatoethylphenoxy)]phosphazene (PECP), or carbopol.

[0180] These Th1 inducing adjuvants can be combined with delivery systems such as aqueous nanosuspensions, calcium phosphate, liposomes, virosomes, ISCOMs, micro- and nanoparticles, emulsions, and the like.

[0181] The adjuvant and antigen of the immunogenic composition according to the present invention can be formulated with any pharma- ceutically acceptable vehicle. In the context of the present invention, the expression "pharma-ceutically acceptable vehicle" refers to a vehicle that is physiologically acceptable for administration to humans while retaining the physiological activity of the immunogenic composition according to the present invention, i.e., its ability to induce an immune response. One exemplary pharma-ceutically acceptable vehicle is saline buffer. Other physiologically acceptable vehicles are known to those skilled in the art and are described, for example, in Remington's Pharmaceutical Sciences (18th ed.), edited by A. Gennaro, 1990, Mack Publishing Company, Easton, Pa. The immunogenic compositions described herein may optionally contain pharma- ceutically acceptable auxiliary substances required to approximate physiological conditions such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, etc., e.g., sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, human serum albumin, essential amino acids, non-essential amino acids, L-arginine hydrochloride, sucrose, D-trehalose anhydrous, sorbitol, tris(hydroxymethyl)aminomethane, and / or urea. In addition, the vaccine compositions may optionally contain pharma- ceutically acceptable additives including, for example, diluents, binders, stabilizers, and preservatives.

[0182] The pH of the immunogenic composition is usually between 5.5 and 8, more preferably between 6.5 and 7.5 (e.g., about 7). A stable pH can be maintained by the use of a buffer, such as a Tris buffer, a citrate buffer, a phosphate buffer, a Hepes buffer, or a histidine buffer. Thus, the immunogenic composition generally includes a buffer. The immunogenic composition may be isotonic with respect to humans. The immunogenic composition may also include one or several additional salts, such as NaCl.

[0183] The immunogenic compositions are sterilized by conventional sterilization techniques or sterile filtered. The resulting aqueous solutions may be packaged and stored in liquid form or may be lyophilized. Lyophilized products may be and reconstituted with a sterile aqueous carrier prior to administration. In a preferred embodiment, the immunogenic composition is packaged and stored as a micropellet via a prilling process described in WO2009109550. Each micropellet may contain gB antigen, gH / gL / UL128 / UL130 / UL131 pentameric complex antigen and Th1-inducing adjuvant, optionally with an oil-in-water emulsion. Alternatively, gB antigen, gH / gL / UL128 / UL130 / UL131 pentameric complex antigen and Th1-inducing adjuvant, optionally with an oil-in-water emulsion, are contained alone or in any combination in different micropellets that are mixed before or after aqueous reconstitution to obtain the composition of the invention.

[0184] The adjuvant and antigen portions of the immunogenic composition according to the invention are typically mixed together unless there are incompatibilities between the products, or alternatively the adjuvant can be added extemporaneously immediately prior to administration to a subject.

[0185] In one embodiment, the immunogenic composition of the invention comprises an HCMV gB antigen, HCMV It is produced as a ready-made mixture of gH / gL / UL128 / UL130 / UL131 pentamer complex antigen and a Th1-inducing adjuvant.

[0186] In another embodiment, the immunogenic composition of the invention is manufactured ex situ immediately prior to administration to a human subject. Thus, the invention provides a kit comprising the various ready-to-mix components, such that the HCMV gB antigen, the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen, the Th1-inducing adjuvant and optionally the oil-in-water emulsion are kept separate until the time of use.

[0187] These components are physically separated from each other in the kit, and this separation can be achieved in various ways. For example, the components may be in separate containers, such as vials. In some configurations, all components are kept separate until the time of use. Preferably, the gB antigen and the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen are in the same container, and the Th1-inducing adjuvant and optionally the oil-in-water emulsion are in another container. The contents of the vials can then be mixed, for example, by removing the contents of one vial and adding it to another vial, or by removing the contents of all the vials separately and mixing them in a new container. In one example, one or more kit components are in a syringe and the other is in a container, such as a vial. The syringe is used to insert its contents into another container for mixing (e.g., with a needle), and the mixture is then drawn into the syringe. The mixed contents of the syringe are then typically administered to a patient via a new sterile needle. In another configuration, the kit components are kept together in the same syringe but kept separately. When the syringe is actuated (e.g., during administration to a patient), the contents of the chambers are mixed. This configuration avoids the need for a separate mixing step at the time of use. The kit components are generally in aqueous form. In some configurations, one or more components are in dry form (e.g., in lyophilized form or as micropellets) and other components are in aqueous form. The components are mixed to reactivate the dry components and obtain an aqueous composition for administration to a patient. One or more lyophilized components may be in a vial or in a syringe. The dry components may include stabilizers such as mannitol, sucrose, or dodecyl maltoside, and mixtures thereof, such as lactose / sucrose mixtures, sucrose / mannitol mixtures, etc. In some configurations, all components are in dry form (e.g., in lyophilized form or as micropellets) kept separately in the same receptacle or in several receptacles, and the kit contains another receptacle containing an aqueous solution for reconstitution of the vaccine.

[0188] Accordingly, the present invention provides a kit comprising: (i) a first kit component comprising an HCMV gB antigen and an HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen; and (ii) ) a kit comprising a Th1 inducing adjuvant and optionally a second kit component comprising an oil-in-water emulsion; and the use of such a kit for preventing HCMV infection.

[0189] In a preferred embodiment, the immunogenic composition of the invention is available as a ready-made mixture of HCMV gB antigen, HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen and a Th1 inducing adjuvant in one vial / syringe.

[0190] Immunogenic compositions according to the invention can be administered by any suitable route, such as mucosal administration (e.g., intranasal or sublingual), parenteral administration (e.g., intramuscular, subcutaneous, transdermal, or intradermal routes), or oral administration. As will be appreciated by those skilled in the art, vaccines of the invention will be suitably formulated to be compatible with the intended route of administration.

[0191] The immunogenic compositions according to the invention may be administered alone or with a suitable pharmaceutical carrier and may be in solid or liquid form, such as tablets, capsules, powders, solutions, suspensions, or emulsions.

[0192] For use as an aerosol, the immunogenic compositions according to the invention in solution or suspension can be packaged in a pressurized aerosol container with a suitable propellant, e.g., a hydrocarbon propellant such as propane, butane, or isobutane, containing a conventional adjuvant. The materials of the invention can also be administered in a non-pressurized form, such as in a nebulizer or atomizer.

[0193] use As previously mentioned, the present invention also relates to the immunogenic compositions described herein for use as HCMV vaccines.

[0194] In particular, the HCMV vaccine according to the invention is a subunit vaccine.

[0195] The present invention further relates to a method for the prevention of HCMV infection in a patient in need thereof comprising the administration of an immunologically effective amount of an immunogenic composition according to the invention.

[0196] "HCMV" is used as previously described, and HCMV infection may particularly refer to maternal HCMV infection during pregnancy or congenital infection.

[0197] In particular, said vaccine / immunogenic composition enhances neutralizing antibody levels and / or persistence, more specifically, said vaccine / immunogenic composition comprising HCMV gB antigen, HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen and a Th1 inducing adjuvant induces higher neutralizing antibody levels and / or persistence than a vaccine / immunogenic composition comprising the same HCMV gB antigen, the same HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen and a MF59 adjuvant.

[0198] As used herein, "vaccine" refers to an immunogenic composition administered to induce an immune response that protects or treats a subject against disease, particularly by the agent. The vaccine of the present invention is intended for use as a preventive (prophylactic) vaccine administered to a subject prior to infection to prevent initial (and / or repeat) infection. In the specific case of congenital HCMV infection, the present invention is intended for use as a preventive vaccine for adolescent girls and women of childbearing age prior to pregnancy to prevent vertical HCMV transmission from mother to fetus or infant.

[0199] The immunogenic composition according to the invention comprises an immunologically effective amount of the antigen and adjuvant described herein. An "immunologically effective amount" is an amount effective to induce an immune response to the antigen used when administered to a subject. This amount may vary depending on the health and physical condition of the subject being treated, the age of the subject, the capacity of the subject's immune system to produce antibodies, the degree of protection desired, the vaccine formulation, and the treating physician's evaluation of the medical situation. This amount can be determined by those skilled in the art using routine methods.

[0200] "Subject," as referred to herein, is used interchangeably with "patient" and refers to humans, particularly women of childbearing age (16-45 years) and adolescent girls (11-15 years) whatever their CMV serostatus, as well as men, children, or potential patients for solid organ or stem cell transplantation. In particular, said patients or subjects are susceptible to HCMV infection.

[0201] "Neutralizing antibody" as used herein has the meaning known to those skilled in the art and is intended to cover antibodies that directly neutralize a target, for example by blocking virus entry into host cells and blocking virus dissemination from cell to cell. Neutralizing antibodies are functional antibodies that can protect against a target. Some examples of methods that can be used to determine the increase in neutralizing antibody levels and / or persistence are provided in the experimental section of this application.

[0202] The vaccine according to the present invention can be administered by any route commonly used for administering vaccines. Any regimen that results in the induction of the expected immune response can be used. Usually, the immunization schedule includes several administrations. The amount of the immunogenic composition to be administered is sufficient to produce the desired immune response and can be determined by those skilled in the art.

[0203] The vaccine according to the present invention can be administered in multiple doses. For example, the vaccine according to the present invention can be administered in one, two or three doses. When the vaccine according to the present invention is administered in three doses, the first and third doses are preferably administered about 12 months apart. For example, the vaccine according to the present invention is administered in a first, second and third dose, the second dose being administered about 1-3 months after the first dose, and the third dose being administered about 6-12 months after the first dose. Alternatively, the three doses can be administered at 0 months, about 1-2 months (e.g., about 1.5 months) and about 6 months.

[0204] The vaccine according to the invention may be administered in two doses, preferably the first and second doses are administered about 1, 3, 6, 8 or 9 months apart.

[0205] The vaccine according to the invention may be administered in a single dose.

[0206] Optionally, a booster dose of the vaccine according to the invention can be used after the initial immunization (i.e. after administration of the final dose planned in the initial immunization regimen), for example between 6 months and 10 years, for example 6 months, 1 year, 3 years, 5 years or 10 years.

[0207] All references cited herein, including journal articles or abstracts, published patent applications, issued patents, or any other references, are hereby incorporated by reference in their entirety, including all data, tables, figures, and text presented in the cited references.

[0208] It is understood that within the scope of the present invention, "immunogenic composition for use" is equivalent to "use of an immunogenic composition", and in particular "immunogenic composition for use as a vaccine" is equivalent to "use of an immunogenic composition as a vaccine" and "use of an immunogenic composition for the manufacture of a medicinal product intended for use as a vaccine". Must be.

[0209] The invention is further illustrated by the following figures and examples. EXAMPLES

[0210] [Table 2] EXAMPLES

[0211] material and method material Products tested in the examples The products are listed in Table 3. Female 7-week-old C57BL / 6J mice were immunized by the intramuscular (IM) route (hind leg, quadriceps) in a volume of 50 μl on DO, D20 and D227.

[0212] [Table 3]

[0213] method Definition of a group The study groups are described in Table 4 below. Mice were randomly assigned to one of the following seven groups. Each group was differentiated into three subgroups, A=>A1, A2 and A3, depending on the time point analysis that required euthanasia of the mice to harvest the spleens (days 34, 208 and 257), as summarized in the study schedule in Figure 1. Thirty-five mice / group were included as follows: 10 mice / subgroup for subgroups 1 and 2, and 15 mice in subgroup 3 to compensate for possible intercurrent deaths that may have occurred over the 8 month period. For the control group, only 5 mice / subgroup were included in subgroups A1, A2 and A3, and for group B, only 5 mice / subgroups B1 and B2, with 10 mice in subgroup B3.

[0214] [Table 4] [Table 5]

[0215] Biological Extraction and Analytical Testing biological extraction Blood samples were collected from all animals under anesthesia. Anesthesia was achieved by Imalgene® (ketamine 1.6 mg) and Rompun (xylazine 0.32 mg) administered in a volume of 200 μl via the intraperitoneal route. Approximately 1 mL of blood was collected in a vial (BD Vacutainer SST reference number 367783) containing a coagulation activator and serum separator. After overnight at +4° C., blood was centrifuged at 3000 rpm for 20 minutes and serum was collected and stored at −20° C. until analysis.

[0216] For cellular response assays, spleens were harvested under sterile conditions and splenocytes were isolated as soon as possible after spleen harvest.

[0217] Analytical Testing Serum neutralization assay This technique is used to titrate functional neutralizing antibodies present in CMV-gB+pentamer+adjuvant immunized animal sera. Based on the ability of cytomegalovirus to infect MRC5 fibroblasts and ARPE-19 cells (human epithelial cells), sera containing specific functional antibodies against CMV-gB and / or CMV-pentamer can inhibit viral infection of cells.

[0218] Briefly, the day before the microneutralization (MN) assay, 2.5 × 10 4MRC5 fibroblasts or ARPE-19 cells were dispensed into 96-well black plates. On day D0, serum was heat inactivated at 56°C for 30 min. Serum samples were serially diluted 2-fold in DMEM / F12 1% FBS starting from 1 / 10 to 1 / 10240 in 96 deep-well plates and incubated with 4.2 logFFU / ml of BADrUL131-Y4 CMV virus strain (provided by Thomas Shenk, described in Wang et al., J. Virol., 2005, 79(16):10330-10338) for 60 min at 37°C in a 5% CO2 cell culture incubator. The serum / virus mixture was then transferred onto MRC5 or ARPE-19 cells and incubated at 37°C in a 5% CO2 cell culture incubator. Incubation was for 3 days for MRC-5 cells and 4 days for ARPE cells.

[0219] After removal of the culture supernatant, on D3 or D4, the cells were fixed with 100 μl of 1% formalin in PBS for 1 h at room temperature. The plates were then washed three times with PBS and air-dried at room temperature before analysis with a Microvision fluorescent plate reader to count the infected cells in each well.

[0220] As controls, there were two wells of cell control (no virus) and six wells containing cells infected with half the virus dilution containing 4.2 logFFU / mL on each plate. The average of these six wells defined the serum neutralization threshold determined as 50% of the specific signal value. The neutralization endpoint titer was defined as the reciprocal of the last dilution below the calculated 50% specific signal value. The neutralization titer (μPRNT50) was defined for each individual serum as the last dilution that induced a 50% reduction in infected cells, i.e., the last dilution that resulted in infected cells below the calculated 50% specific signal value. The geometric mean neutralizing antibody titer was calculated for each group.

[0221] ELISA assay Serum IgG1 and IgG2c antibodies against CMV-gB antigen or CMV-pentamer antigen were titrated by robotic ELISA assay according to the following procedure.

[0222] Dynex 96-well microplates were coated overnight at 4° C. with 1 μg / well of CMV-gB or CMV-pentamer in 0.05 M carbonate / bicarbonate buffer, pH 9.6 (Sigma). Plates were then blocked with 150 μL / well of PBS Tween milk (PBS pH 7.1, 0.05% Tween 20, 1% (w / v) powdered skim milk (DIFCO)) for at least 1 h at 37° C. All subsequent incubations were performed in a final volume of 100 μL, followed by three washes with PBS pH 7.1, 0.05% Tween 20. Serial two-fold dilutions of serum samples were made in PBS-Tween-milk (starting at 1 / 1000 or 1 / 10000) and added to the wells. Plates were incubated for 90 min at 37° C. After washing, goat anti-mouse IgG1 or IgG2c peroxidase-conjugated antibodies (Southern Biotech) diluted 1 / 2000 in PBS-Tween-milk were added to the wells and the plates were incubated for 90 min at 37° C. The plates were further washed and incubated with 100 μL / well of ready-made Tetra Methyl Benzidine (TMB) substrate solution (TEBU) for 30 min at 20° C. in the dark. The reaction was stopped with 100 μL / well of HCl 1M (Prolabo).

[0223] The optical density (OD) was measured at 450 nm to 650 nm using a plate reader (VersaMax-Molecular Devices). For an OD value range of 0.2 to 3.0 from the titration curve, the IgG1 or IgG2c antibody titer was calculated using CodUnit software (reference mouse hyperimmune serum on each plate). The IgG1 or IgG2c titer of this reference, expressed in arbitrary ELISA units (EU), was calculated using the inverse ELISA unit that indicates an OD of 1.0. The number corresponds to the log10 of the dilution. The threshold for antibody detection was 10 ELISA units (1.0 log10). All final titers were expressed in log10 (Log).

[0224] IgG1 / IgG2c ratios were calculated using the individual arithmetic values ​​and the geometric mean of the individual IgG1 / IgG2c ratios was calculated for each group.

[0225] FLUOROSPOT Fluorescent-linked immunospot (FLUOROSPOT) was used to detect and enumerate individual cells secreting IFN-γ and IL-5 cytokines.

[0226] On D0, the membranes of 96-well IPFL bottom microplates (Multiscreen) were pre-wetted with 25 μL of 35% ethanol for 1 min. The ethanol was then removed and each well was washed twice with 200 μL of PBS 1×. The microplates were then coated with rat anti-mouse IFN-γ or rat anti-mouse IL-5 antibodies (10 μg / ml, Pharmingen) diluted 1 / 100 and 1 / 50, respectively, and incubated overnight at 4° C.

[0227] On D1, the plates were washed with PBS and then blocked with RPMI 10% FBS at 37° C. for at least 2 hours. After washing the plates, 5×10 5 Spleen cells / well were incubated overnight with CMV-gB antigen (0.1 μg / ml), CMV-pentamer (0.1 μg / ml) or concanavalin A (Con A, 2.5 μg / mL) as a positive control in the presence of mouse IL-2 (10 U / ml).

[0228] On D2, the plates were washed six times with PBS 1x-BSA 0.1% (200 μL / well). After the washing steps, 100 μL / well of biotinylated anti-mouse IFN-γ or anti-mouse IL5 antibodies were added at 1 μg / mL in PBS 1x-BSA 0.1% for 2 h at room temperature in the dark. The plates were washed three more times with PBS 1x-BSA 0.1% (200 μL / well). Then, 100 μL / well of streptavidin-PE at 1 μg / mL in PBS 1x-BSA 0.1% was incubated for 1 h at room temperature in the dark.

[0229] Plates were further washed six times with PBS 1x-BSA 0.1% (200 μL / well). Plates were stored at 5°C ± 3°C in the dark until reading.

[0230] The individual spots corresponding to IFN-γ or IL5 secreting cells (IFN-γ SC or IL5 SC) were counted using an automated FLUOROSPOT plate reader (Microvision). 6 It was expressed as the number of IFN-γ or IL-5 secreting cells per spleen cell.

[0231] IgG, IgG1 and IgG2c FLUOROSPOT Assays Fluorescence-conjugated immunospots (FLUOROSPOT) were used to detect and enumerate individual B cell secreting antibodies (IgG1, IgG2c or total IgG) regardless of antigen specificity.

[0232] On D0, membranes of 96-well IPFL bottom microplates (Multiscreen) were pre-wetted with 25 μL 35% ethanol for 1 min. The ethanol was then removed and each well was washed twice with 200 μL PBS 1×. The microplates were then coated with CMV-gB antigen (10 μg / ml, Sanofi), CMV-pentamer (10 μg / ml, NAC) or total IgG antibody (10 μg / ml, KPL) diluted at 1 / 68, 1 / 100 and 1 / 100, respectively, and incubated overnight at 4° C.

[0233] On D1, plates were washed with PBS and then blocked with RPMI 10% FBS at 37° C. for at least 2 hours.

[0234] After washing the plate, 5 × 10 freshly isolated CMV-gB antigen or CMV-pentamer were 5 2.5 x 10 freshly isolated splenocytes / well for total IgG antibodies 5 Spleen cells / well were incubated for 5 hours.

[0235] After 5 hours, plates were washed 3 times with PBS 1× and stored at 4° C. overnight.

[0236] On D2, the plates were washed six times with PBS 1x-BSA 0.1% (200 μL / well). After the washing steps, 100 μL / well of anti-mouse IgG1 PE or anti-mouse IgG2c FITC or anti-mouse total IgG antibodies were added at 4, 2 or 0.5 μg / mL, respectively, in PBS 1x-BSA 0.1% for 2 h at room temperature in the dark. The plates were washed another six times with PBS 1x-BSA 0.1% (200 μL / well). The plates were stored at 5°C ± 3°C in the dark until reading.

[0237] Each spot, corresponding to an antibody-secreting cell (ASC) (IgG1 ASC, IgG2c ASC or total IgG ACS), was counted using an automated FLUOROSPOT plate reader (Microvision). 6 It was expressed as the number of antibody secreting cells per spleen cell.

[0238] result Humoral response Longitudinal analysis of neutralizing antibody responses in ARPE-19 epithelial cells between days 20 and 257 Neutralizing activity against the BADrUL131-Y4 CMV virus strain in epithelial cells (ARPE-19) was monitored by serum neutralization assays on individual interim serum samples collected monthly from all animals from subgroup 3 on days 20-257 (i.e., at days 20, 34, 62, 90, 118, 153, 187, 226 and 257). The serum neutralization method is detailed in the Materials and Methods section and the raw data are presented in Table 5a-b.

[0239] [Table 6]

[0240] The geometric mean titers (GMTs) and individual neutralization titers are shown in FIG. M1=D34, M2=D62, M3=D90, M4=D118, M5=D153, M6= D187, M7=D226, M8=D257.

[0241] Similar kinetic neutralizing antibody titer profiles were detected in the epithelial-based neutralization assay in the presence and absence of complement, as shown in Figure 2 panels A and B, respectively.

[0242] For groups receiving non-adjuvanted CMV-gB and pentamers, low neutralizing antibody responses were detected at day 20 (GMTs = 33 and 32 with or without complement, respectively) and then increased and plateaued until day 62. GMTs ranged from 90 to 212 or 65 to 170 with or without complement between days 62 and 226. A third injection on day 226 boosted neutralizing antibody titers as detected at day 257 with GMTs = 1026 or 815 with or without complement, respectively.

[0243] For all adjuvant groups (MF59, PAA, AF04 and GLA-SQEM), neutralizing antibody titers were detected in the presence or absence of complement on day 20 (i.e., 20 days after the first injection). For group C3, which received CMV-gB and pentamers adjuvanted with MF59, the GMT was 220 or 74, respectively, and for groups D3-F3, which received the other adjuvant formulations, the GMT was ≥ 383 and ≥ 83. At day 34 (i.e., 14 days after the second injection), all adjuvant groups showed a peak in the response after two injections, with GMTs ranging from 3625 to 30755 or 2020 to 8048, respectively, in the presence or absence of complement.

[0244] Over the course of 6 months (between days 34 and 226), epithelial-based neutralizing antibody titers declined slightly to titers ranging from 1058 to 8505 or 655 to 2883 in the presence or absence of complement, respectively. Similarly, a third injection on day 226 boosted neutralizing antibody titers as detected at day 257 with GMTs ranging from 6792 (i.e., MF59-) to 37166 (i.e., PAA-) or 5449 (i.e., MF59-) to 28657 (i.e., PAA-adjuvanted group) in the presence or absence of complement, respectively.

[0245] To compare the different adjuvant groups, i.e. SPA09, AF04 and GLA-SQEM, with the MF59 reference, a statistical mixed model with two fixed coefficients (group and time) was performed on repeated neutralizing antibody titers between days 34 and 226.

[0246] For the group comparisons shown in Table 6, in the presence of complement, neutralizing antibody titers obtained in mice receiving CMV-gB and pentamer adjuvanted with MF59 were not significantly superior to those obtained in mice receiving non-adjuvanted CMV-gB and pentamer, whereas all other adjuvanted groups (i.e., PAA, AF04 and GLA-SQEM) were significantly superior to neutralizing antibody titers obtained in mice receiving CMV-gB and pentamer adjuvanted with MF59 (all p values ​​<0.001).

[0247] In the absence of complement, neutralizing antibody titers obtained in mice receiving CMV-gB and pentamers adjuvanted with MF59 were not significantly superior to those obtained in mice receiving non-adjuvanted CMV-gB and pentamers. Neutralizing antibody titers obtained in mice receiving CMV-gB and pentamers adjuvanted with AF04 were not significantly superior to those obtained in mice receiving CMV-gB and pentamers adjuvanted with MF59, whereas all other adjuvant groups (i.e., PAA and GLA-SQEM) were significantly superior to those obtained in mice receiving CMV-gB and pentamers adjuvanted with MF59 (all p values ​​≦0.009). Neutralizing antibody titers obtained in mice receiving AF04-adjuvanted CMV-gB and pentamers were significantly superior to those obtained in mice receiving non-adjuvanted CMV-gB and pentamers (all p values ​​<0.001). ).

[0248] [Table 7]

[0249] Detailed analysis of neutralizing antibody responses in epithelial cells (ARPE-19) and fibroblasts (MRC-5) at days 34 (M1), 208 (M7), and 257 (M8). Neutralizing activity against the BADrUL131-Y4 CMV virus strain in epithelial cells (ARPE-19) and fibroblasts (MRC-5) was monitored by serum neutralization assays on individual serum samples collected at days 34 (2 weeks after the second immunization), 208 (7 months after the first vaccination series) and 257 (1 month after the booster injection with M7), respectively, from all animals from subgroups 1, 2 and 3. The serum neutralization method is detailed in the Materials and Methods section and the raw data are presented in Tables 7a-f.

[0250] [Table 8] [Table 9] [Table 10]

[0251] The geometric mean titers (GMT) and individual neutralization titers are shown in FIGS.

[0252] Similar neutralizing antibody profiles were observed in both epithelial and fibroblast-based neutralization assays: higher neutralizing titers were monitored in the epithelial-based neutralization assay, with GMTs at least 5-fold or 11-fold higher in the presence or absence of complement, respectively.

[0253] At day 34, i.e., 14 days after the second injection, no or low neutralizing antibody titers were detected in mice immunized with non-adjuvanted CMV-gB and pentamer (GMT ≦8 for MRC-5 cells and GMT ≦46 for ARPE-19 cells, respectively). A significant adjuvant effect was observed for all CMV-gB and pentamer adjuvant groups, with a significantly higher neutralizing antibody titer in the MR group compared to the non-adjuvanted group, regardless of the presence or absence of complement. We observed a 14- to up to 337-fold increase in SN titers in C-5 and a 44- to 319-fold increase in ARPE-19 cells.

[0254] With regard to neutralizing antibody titers in ARPE-19 epithelial cells in the presence of complement (Figure 3, panel A), an adjuvant effect was observed with PAA and GLA-SQEM, with neutralizing antibody titers significantly higher than MF59 (at least 3-4.2-fold higher, tests of superiority, one-sided Dunnett's correction, all p-values ​​<0.001), but not with AF04 (only 1.7-fold higher, p-value = 0.08).

[0255] Conversely, with regard to neutralizing antibody titers in ARPE-19 cells in the absence of complement (Figure 3, panel B), PAA, AF04, and GLA-SQEM adjuvants slightly increased neutralizing antibody titers compared to MF59 (1.5- to 2-fold increase in neutralizing antibody titers compared to those induced by MF59), although the observed differences were not statistically significant (all p values ​​>0.091).

[0256] With regard to neutralizing antibody titers in MRC-5 fibroblasts in the presence of complement (Figure 3, panel C), an adjuvant effect was observed for all tested adjuvants PAA, AF04, and GLA-SQEM, with neutralizing antibody titers significantly higher than MF59 (at least 2.3- to 6-fold higher, tests of significance, one-sided Dunnett's correction, all p values ​​≤ 0.002).

[0257] Finally, with regard to neutralizing antibody titers in MRC-5 fibroblasts in the absence of complement (Figure 3, panel D), the neutralizing antibody titers induced by PAA, AF04 and GLA-SQEM were not shown to be significantly higher than those obtained with MF59 (p-values ​​> 0.093). At day 208 (Figure 4), i.e. 7 months after the second injection, no or low neutralizing antibody titers were detected in mice immunized with non-adjuvanted CMV-gB and pentamers (GMT ≤ 5 for MRC-5 cells and GMT ≤ 50 for ARPE-19 cells, respectively). In adjuvant subgroup 2, compared with the titers detected at day 34 (in mice from subgroup 1), no significant reduction in neutralizing titers was demonstrated in ARPE-19 epithelial cells, regardless of the presence or absence of complement, whereas a significant reduction in neutralizing antibody titers was demonstrated in MRC-5 fibroblasts (2.3- to 5.4-fold reduction in the presence of complement, all p-values ​​≤ 0.016; 3- to 10-fold reduction in the absence of complement, all p-values ​​< 0.001).

[0258] With regard to neutralizing antibody titers in ARPE-19 epithelial cells in the presence or absence of complement (Figure 4, panels A and B), no significant differences were detected between the test adjuvants and the MF59 benchmark. With regard to neutralizing antibody titers in MRC-5 fibroblasts in the presence of complement (Figure 4, panel C), neutralizing antibody titers induced by PAA and GLA-SQEM were significantly higher than those induced by MF59 (at least 3.4-11.9-fold higher, tests of significance, one-sided Dunnett's correction, all p-values ​​≤ 0.015).

[0259] Finally, with regard to neutralizing antibody titers in MRC-5 fibroblasts in the absence of complement (Fig. 4 , panel D), neutralizing antibody titers induced by PAA and AF04 were significantly higher than those induced by MF59 (2- to 4.4-fold increase, tests of significance, one-sided Dunnett's correction, all p values ​​≤ 0.019).

[0260] At day 257 (Figure 5), i.e., 30 days after the third injection, mice immunized with non-adjuvanted CMV-gB and pentamer had significantly increased neutralizing antibody titers compared to those detected in ARPE-19 cells at day 34 (GMTs of 1062 and 815 in ARPE-19 cells with and without complement, respectively). In contrast, in mice immunized with non-adjuvanted CMV-gB and pentamer, neutralizing antibody titers remained low in MRC-5 fibroblasts (GMTs of 1062 and 815 in MRC-5 fibroblasts with and without complement, respectively). =29 or 15).

[0261] In all adjuvant subgroups 3 except MF59, neutralizing antibody titers detected at 257 days after the third injection were significantly higher than those detected at 34 days after the second injection, regardless of cell type and the presence or absence of complement (all p values ​​≦0.002).

[0262] Regarding adjuvant comparisons with the MF59 reference at day 257, all adjuvants except GLA-SQEM (i.e., PAA and AF04) induced higher neutralizing antibody titers than MF59, whatever the cell type and the presence or absence of complement (tests of superiority, one-sided Dunnett's correction, all p-values ​​≦0.05). For GLA-SQEM, the complement-dependent neutralizing antibody titers induced were significantly higher than those induced by MF59 (5.3- or 8.9-fold higher in ARPE-19 or MRC-5 cells, respectively, tests of superiority, one-sided Dunnett's correction, all p-values ​​<0.001), whereas in the absence of complement, the neutralization induced was not significantly different for any cell type.

[0263] At D208, i.e. up to 7 months after the second injection, compositions comprising gB+pentamer+AF04 or PAA or GLA-SQEM showed higher neutralizing antibody levels than compositions comprising gB+pentamer+MF59, indicating better persistence of antibody functionality. At D257, the increase in measured neutralizing antibodies 1 month after the boost reflects a memory response and indicates higher titers of compositions comprising gB+pentamer+AF04 or PAA or GLA-SQEM than compositions comprising gB+pentamer+MF59.

[0264] All these results indicate that immunogenic compositions comprising gB + pentamers + AF04 or PAA or GLA-SQEM exhibit higher neutralizing antibody levels and persistence than compositions comprising gB + pentamers + MF59.

[0265] IgG1 and IgG2c antibody responses CMV gB-specific and pentamer-specific IgG1 and IgG2c antibody responses elicited by CMV gB and pentamer antigens administered with or without various adjuvants were measured by ELISA in individual serum samples collected at 34 days (2 weeks after the second immunization), 208 days (7 months after the first vaccination series) and 257 days (1 month after the booster injection with M7) from all animals from subgroups 1, 2 and 3, respectively. Mean ELISA antibody titers (log10 EU) are shown in Figure 6. The ELISA method is detailed in the Materials and Methods section.

[0266] Regarding IgG1 and IgG2c antibody responses, similar profiles were obtained regardless of CMV antigen specificity, gB or pentamer, at any time point analyzed.

[0267] Regarding IgG1 antibody titers, all tested adjuvants significantly increased IgG1 antibody titers compared to the non-adjuvanted group. No significant differences were shown for AF04 compared to MF59 for any antigen and time point. An adjuvant effect of significantly lower IgG1 titers than MF59 was observed for PAA at 34 and 208 days (at least 2.4-fold reduction, all p-values ​​≦0.045, test of difference, one-sided Dunnett correction), but not at 257 days after the third booster injection. Compared to the MF59 reference, GLA-SQEM induced significantly lower anti-gB IgG1 titers at all tested time points (at least 2.5-fold reduction, all p-values ​​≦0.033, test of difference, one-sided Dunnett correction) and lower anti-pentamer IgG1 titers at 208 and 257 days (at least 2.7-fold reduction, all p-values ​​≦0.005, test of difference, one-sided Dunnett correction). With regard to IgG2c antibody titers, all test adjuvants significantly increased IgG2c antibody titers compared to the non-adjuvanted group. For either gB or pentamer-specific IgG2c, IgG2c titers were higher than those of MF59 at all time points. Significantly higher adjuvant effects were observed for all tested adjuvants, namely PAA, AF04 and GLA-SQEM (at least 11-fold higher; all p-values ​​<0.001, tests of difference, one-sided Dunnett's correction).

[0268] ELISA IgG1 / IgG2c ratio To assess Th2 / Th1 orientation, IgG1 / IgG2c ratios were calculated for all adjuvant groups and are detailed in Figure 7.

[0269] As shown in Figure 7, the calculated IgG1 / IgG2c ratios for CMV-pentamer were lower than those for CMV-gB and tended to be more constant at any time point. Squalene emulsion MF59 showed a Th2-biased response profile, with IgG1 / IgG2 ratios for CMV-gB ≧85 and CMV-pentamer ≧18 at any time point. For all other tested adjuvants, lower IgG1 / IgG2c ratios were obtained than MF59, with IgG1 / IgG2c ratios ≧7.1 specific for gB and ≧2.1 specific for pentamer for AF04, and below or equal to 2.4 or 0.8 (specific for gB and pentamer, respectively). This indicates a more Th1-biased response profile than MF59, and that AF04, PAA and GLA-SQEM are Th1-inducing adjuvants.

[0270] Cellular Response IL5 and IFN-γ cytokine secreting cells monitored by FLUOROSPOT IL5 and IFN-γ secreting cell frequencies were measured by FLUOROSPOT on spleen cells harvested at days 34 (2 weeks after the second immunization), 208 (7 months after the first vaccination series) and 257 (1 month after the booster injection with M7) from all animals from subgroups 1, 2 and 3. During the FLUOROSPOT assay, each spleen cell suspension was stimulated ex vivo overnight with either recombinant CMV-gB or CMV-pentamer at 0.1 μg / ml.

[0271] The FLUOROSPOT method is detailed in the Materials and Methods section.

[0272] As shown in FIG. 8, at 34 days, upon CMV-gB stimulation (Panel A), the MF59-adjuvanted CMV-gB and pentamer groups (geometric mean of 60 IL-5-secreting cells / 10 6 Except for spleen cells, no or very low IL-5-secreting cell (SC) frequencies were detected in all groups (geometric mean <22 IL-5-secreting cells / 10 6 Similarly, all groups had no or minimal frequencies of IFN-γ-secreting cells (geometric mean <20 IFN-γ-secreting cells / 10 6 spleen cells).

[0273] In contrast, upon CMV-pentamer stimulation, a high frequency of cytokine-secreting cells was detected (Figure 8, Panel B). With regard to IL-5-secreting cells, a high frequency of IL-5 SC was detected in mice treated with MF59 (444 IL-5 SC / 10 6 IL-5 secretion detected in the groups treated with PAA and GLA-SQEM was significantly lower than that obtained with MF59 (p-value ≤ 0.002, test of difference, one-sided Dunnett's correction), whereas no significant differences were recorded with AF04.

[0274] IFN-γ secreting cell frequency, for all tested adjuvants, i.e. PAA, AF04 and GLA-SQEM, a significant 8- to up to 29-fold increase in IFN-γ production was recorded compared to MF59 (all p values ​​≤ 0.001, test of difference, one-sided Dunnett's correction).

[0275] As shown in FIG. 8, at day 208, the frequencies of both IL-5 and IFN-γ secreting cells were low regardless of the stimulating antigen.

[0276] At day 257, both IL-5 and IFN-γ responses upon CMV-gB and CMV-pentamer stimulation were increased compared to day 34, whereas the Th1 / Th2 profile was preserved. Regarding IL-5-secreting cells, a high frequency of IL-5 SC was detected in mice treated with MF59 (268 and 2284 upon CMV-gB or pentamer stimulation, respectively). IL-5 SC / 10 6 spleen cells).

[0277] IL-5 secretion detected in the groups treated with PAA, AF04 and GLA-SQEM was significantly lower than that obtained with MF59 (p-value ≤ 0.003, test of difference, one-sided Dunnett's correction).

[0278] IFN-γ secreting cell frequency, for all tested adjuvants, namely PAA, AF04 and GLA-SQEM, a significant increase in IFN-γ SC frequency was recorded compared to MF59 (all p values ​​≦0.001, test of difference, one-sided Dunnett's correction).

[0279] Taken together, all test adjuvants induced a more Th-1 biased overall response profile than MF59, consistent with the trend indicated by the IgG1 / IgG2c ratio.

[0280] Consistent with the trends indicated by the IgG1 / IgG2c ratios, collectively, all test adjuvants induced a Th-1 biased overall cellular response profile, whereas MF59 induced a Th2 biased overall cellular response profile.

[0281] IgG1 and IgG2c antibody-secreting plasmablasts monitored by ELISPOT IgG1 and IgG2c antibody secreting plasmablast frequencies were measured by ex vivo FLUOROSPOT on spleen cells harvested from all animals from subgroups 1, 2 and 3 at days 34 (2 weeks after the second immunization), 208 (7 months after the first vaccination series) and 257 (1 month after the booster injection with M7), respectively. During the ELISPOT assay, each spleen cell suspension was deposited on wells coated with either recombinant CMV-gB or CMV-pentamer to capture either IgG1 or IgG2c specific antibodies presented on the plasmablast surface. IgG1 and IgG2c CMV-gB and pentamer specific antibody secreting cells were counted and reported in relation to total IgG secreting cells; the percentage of either IgG1 or IgG2c relative to total IgG was calculated. The FLUOROSPOT method is detailed in the Materials and Methods section.

[0282] As presented in Figure 9, the mean IgG1 antibody-secreting cell (ASC) frequency at day 34 ranged between 3.8% and 20.12%, with no significant differences between all adjuvants tested. Regarding IgG2c ASC frequency, a lower percentage was detected when mice were administered CMV-gB and pentamer adjuvanted with MF59. In contrast, CMV-gB and pentamer adjuvanted with PAA, AF04, and GLA-SQEM induced a significantly higher percentage of IgG2c ASC than MF59, regardless of the antigen specificity of either CMV-gB or CMV-pentamer (all p values ​​< 0.001, tests of difference, one-sided Dunnett's correction).

[0283] As expected, the response was low in terms of detected ASCs at day 208, indicating that a low percentage of circulating plasmablasts was detected in mouse spleens 6 months after the first vaccination series.

[0284] Thirty days after the third injection (day 257), ASC frequency (either IgG1 or IgG2c specific for CMV-gB or CMV-pentamer) increased compared to day 208. Again, the mean IgG1 ASC frequency at 257 days ranged from 3.1% to 9%, with no significant differences between all adjuvants tested. A lower percentage of IgG2c ASC frequency was detected when mice were administered CMV-gB and pentamers adjuvanted with MF59. In contrast, CMV-gB and pentamers adjuvanted with PAA, AF04, and GLA-SQEM induced a significantly higher percentage of IgG2c ASC than MF59, regardless of the antigen specificity of either CMV-gB or CMV-pentamer (all p values ​​< 0.001, tests of difference, one-sided Dunnett's correction).

[0285] IgG1 and IgG2c antibody-secreting memory B cells monitored by FLUOROSPOT IgG1 and IgG2c antibody secreting cell frequencies were measured by FLUOSPOT in activated and enriched B cell spleen cells cultured for 4 days upon in vitro stimulation with IL-2 and R848 at days 34, 208 and 257. The FLUOROSPOT methodology is detailed in the Materials and Methods section.

[0286] As presented in Figure 10, the mean IgG1 antibody-secreting cell (ASC) frequency at day 34 ranged between 1.24% and 4.68%, with no significant differences between all tested adjuvants, and similar profiles for either CMV-gB or CMV-pentamer antigen specificity. Regarding IgG2c ASC frequency, a lower percentage was detected when mice were administered CMV-gB and pentamer adjuvanted with MF59. In contrast, CMV-gB and pentamer adjuvanted with PAA, AF04, and GLA-SQEM induced a significantly higher percentage of IgG2c ASC than MF59, regardless of either CMV-gB or CMV-pentamer antigen specificity (all p values ​​< 0.001, tests of difference, one-sided Dunnett's correction).

[0287] Regarding the detected ASCs at 208 days, memory B cells were mainly IgG1 ASCs specific for CMV-pentamer, with the percentage ranging from 1.6% to 3.24%, independent of the adjuvant tested. Regarding IgG2c ASC frequency, a lower percentage was detected when mice were administered CMV-gB and pentamers adjuvanted with MF59. In contrast, CMV-gB and pentamers adjuvanted with PAA, AF04 and GLA-SQEM induced a significantly higher percentage of IgG2c ASCs than MF59 (all p values ​​< 0.001, tests of difference, one-sided Dunnett's correction).

[0288] Thirty days after the third injection (at day 257), the mean IgG1 ASC frequency ranged between 1.1% and 3.75%, with no significant differences among all adjuvants tested.

[0289] Regarding IgG2c ASC frequency, a low percentage was detected when mice were administered CMV-gB and pentamers adjuvanted with MF59. In contrast, CMV-gB and pentamers adjuvanted with PAA and GLA-SQEM induced a significantly higher percentage of IgG2c ASCs than MF59, regardless of the antigen specificity of either CMV-gB or CMV-pentamer. ASC was induced (all p values ​​<0.001, tests of difference, one-sided Dunnett's correction).

[0290] These results indicate a higher level of memory response with compositions containing gB+pentamer+PAA or AF04 or GLA-SQEM than with compositions containing gB+pentamer+MF59. It is also evident that this higher frequency of memory cells, known to be a mediator of sustained protection, maintains a predominantly Th1-type response profile. EXAMPLES

[0291] Complementary effect of two antigens In designing the experimental study, the inventors performed a complex of two antigens in the presence of PAA adjuvant. A combined dose range effect was studied. For that purpose, 11 groups of 10 female C57 / Bl6J mice received CMV-gH / gL / UL128 / UL130 / UL131 pentamers at doses ranging from 0 to 5 μg, with or without CMV-gB at doses ranging from 1.2 to 5 μg, by the intramuscular route on days 0 and 22 in the presence of PAA adjuvant. Antibody responses were evaluated by ELISAs (IgG1 / IgG2c subclasses) specific for gB and gH / gL / UL128 / UL130 / UL131 pentamers, as well as neutralization assays at D22 (with complement in ARPE-19 epithelial cells) and D35 (with and without complement in MRC5 fibroblasts and ARPE-19 epithelial cells). Cellular responses were assessed at D35 by IFN-γ ELISPOT upon in vitro stimulation with gB and pentameric recombinant proteins and pentameric peptide pools.

[0292] Neutralizing activity monitored in either epithelial cells ARPE-19 or fibroblasts MRC-5 showed a similar profile, with higher neutralizing titers recorded in epithelial cells than in fibroblasts (2- to 5-fold higher titers in ARPE-19 than in MRC-5 cells).

[0293] On day 20 (FIG. 11), i.e., 20 days after the first dose, in the presence of baby rabbit complement, neutralizing antibody titers that inhibited both epithelial and fibroblast cell infections increased as a function of the dose of gB and gH / gL / UL128 / UL130 / UL131 pentamers administered. A higher increase in neutralizing titers was demonstrated when gB concentrations were increased. As shown in FIG. 11, the radar plot was oriented by gB dose rather than pentamer dose. Thus, a significant linear effect of adding gB on top of gH / gL / UL128 / UL130 / UL131 pentamers was observed for neutralizing activity monitored in epithelial and fibroblast cells (p=0.014 for epithelial cells and p=0.006 for fibroblast cells).

[0294] In conclusion, addition of gB onto the pentamer in the presence of complement increases SN titers in both epithelial and fibroblast cells.

[0295] On day 35, 14 days after the second dose, high neutralizing antibody titers were detected in the presence of baby rabbit complement that inhibited both epithelial cell and fibroblast infection, whatever the dose of either gB or gH / gL / UL128 / UL130 / UL131 pentamers administered. The detected neutralizing activity plateaued, with no significant dose effect of either pentamers or gB (all p-values ​​> 0.240) (Figure 12A).

[0296] On day 35, complement-dependent neutralizing activity, which inhibits both epithelial cell and fibroblast infection in the absence of baby rabbit complement, was also monitored.

[0297] As shown in Figure 12B, in the absence of complement, the radar plot was driven by pentamer dose rather than gB dose, and therefore, complement-dependent neutralizing antibody titers increased strongly with increasing gH / gL / UL128 / UL130 / UL131 pentamer dose. No significant dose effect of gB was demonstrated, whereas significant linear and squared effects were demonstrated for increasing doses of gH / gL / UL128 / UL130 / UL131 pentamer (neutralization titers in ARPE-19 and MRC-5 cells, both p < 0.009).

[0298] In conclusion, in the absence of complement, addition of pentamers onto gB increases SN titers in both epithelial and fibroblast cells.

[0299] Thus, the complementary effect of the two antigens was demonstrated by their respective effects on the quality of the neutralizing antibody response. With regard to the analysis of the functional humoral response, i.e. complement-dependent and -independent neutralizing antibodies, it was shown that the combination of the two antigens results in an extension of the mechanism of action of virus neutralization. CMV-gB increases neutralizing antibody titers in epithelial cells and fibroblasts in the presence of complement. and the CMV-gH / gL / UL128 / UL130 / UL131 pentamer achieves complement-independent neutralizing antibodies in epithelial cells and fibroblasts.

[0300] Furthermore, this expansion property of the CMV-gB and CMV-gH / gL / UL128 / UL130 / UL131 pentamer combination was also noted for the induction of cellular responses. As shown in Figure 13 panel A, specific IFN-γ cellular responses were detected in spleen cells from mice administered CMV-gB and CMV-gH / gL / UL128 / UL130 / UL131 pentamers formulated with PAA adjuvant. When stimulated ex vivo with CMV-gH / gL / UL128 / UL130 / UL131 recombinant pentamers, a higher specific IFN-γ cellular response was detected than with the CMV-gB recombinant protein. To define cellular epitopes within the CMV-gH / gL / UL128 / UL130 / UL131 pentamer, spleen cells from mice administered CMV-gB and CMV-gH / gL / UL128 / UL130 / UL131 pentamers formulated with PAA adjuvant were also stimulated ex vivo with 15-mer peptide pools covering the sequences of each individual protein that composes the pentamer, i.e., gH, gL, UL128, UL130, and UL131. As shown in Figure 13 panel B, sustained specific IFN-γ cellular responses were detected for all peptide pools covering the sequences of each individual protein that composes the pentamer, except for UL128, where the detected IFN-γ cellular response was low in most mice tested.

[0301] In conclusion, the addition of a pentamer onto gB makes it possible to expand the number of cellular epitopes and increase the IFN-γ cellular response.

Claims

1. - HCMV gB antigen; - HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex antigen; and - a Th1-inducing adjuvant comprising a polyacrylic acid polymer salt having a weight average molecular weight Mw in the range of 350 to 650 kDa. An immunogenic composition comprising:

2. 2. The immunogenic composition of claim 1, wherein the Th1-inducing adjuvant comprises a linear or branched polyacrylic acid polymer salt having a weight-average molecular weight Mw in the range of 350 to 650 kDa.

3. 3. The immunogenic composition of claim 1, wherein the linear or branched polyacrylic acid polymer salt has a polydispersity index of about 4 or less.

4. The immunogenic composition of any one of claims 1 to 3, wherein the linear or branched polyacrylic acid polymer salt has a polydispersity index of about 2 or less and a weight average molecular weight in the range of 400 to 600 kDa.

5. The immunogenic composition of any one of claims 1 to 4, wherein the linear or branched polyacrylic acid polymer salt is PAA225000.

6. The immunogenic composition of any one of claims 1 to 5, wherein the HCMV gB antigen comprises one or several mutations in the intracellular proteolytic cleavage site.

7. The HCMV gB antigen may be a full-length gB polypeptide, a full-length gB polypeptide lacking at least a portion of the transmembrane domain, a full-length gB polypeptide lacking substantially all of the transmembrane domain, a full-length gB polypeptide lacking at least a portion of the intracellular domain, a full-length gB polypeptide lacking substantially all of the intracellular domain, or a full-length gB polypeptide lacking both the transmembrane domain and the intracellular domain. The immunogenic composition of any one of claims 1 to 6, which is a full-length gB polypeptide lacking substantially both of the domains.

8. The immunogenic composition of any one of claims 1 to 7, wherein the amino acid sequence of the HCMV gB antigen is at least 95% identical to SEQ ID NO:

1.

9. The immunogenic composition of any one of claims 1 to 8, wherein the HCMV gB antigen is gBdTm.

10. The immunogenic composition according to any one of claims 1 to 9, wherein in the HCMV gH / gL / UL128 / UL130 / UL131 pentameric composite antigen, the gH antigen lacks at least a portion of the transmembrane domain, preferably the gH antigen lacks substantially all of the transmembrane domain.

11. The immunogenic composition of any one of claims 1 to 10, wherein the gH comprises the ectodomain of a full-length gH encoded by the UL75 gene.

12. The immunogenic composition of any one of claims 1 to 11, wherein gH comprises the amino acid sequence of SEQ ID NO: 2; gL comprises the amino acid sequence of SEQ ID NO: 3; UL128 comprises the amino acid sequence of SEQ ID NO: 4; UL130 comprises the amino acid sequence of SEQ ID NO: 5; and UL131 comprises the amino acid sequence of SEQ ID NO:

6.

13. The immunogenic composition of any one of claims 1 to 12, wherein HCMV gB and the HCMV gH / gL / UL128 / UL130 / UL131 pentameric complex are the only HCMV antigens.

14. The immunogenic composition of any one of claims 1 to 13 for use as an HCMV vaccine.

15. 15. The immunogenic composition for use according to claim 14, wherein the vaccine enhances neutralizing antibody levels and / or persistence.

16. A subunit vaccine comprising the immunogenic composition of any one of claims 1 to 13.