Methods and compositions for monitoring the treatment of relapsed and / or refractory multiple myeloma - Patents.com

Abstract

Methods for monitoring the progression of multiple myeloma or plasmacytoma, particularly relapsed or refractory multiple myeloma, are described. Methods for treating multiple myeloma or plasmacytoma in a subject, or determining the response to treatment of multiple myeloma or plasmacytoma, are also described.

Description

[Technical field]

[0001] (CROSS REFERENCE TO RELATED APPLICATIONS) This application claims the benefit of U.S. Provisional Patent Application No. 63 / 187,344, filed May 11, 2021, the entire contents of which are incorporated herein by reference in their entirety.

[0002] (Sequence Listing) This application contains a Sequence Listing that has been submitted electronically in ASCII format, which is incorporated herein by reference in its entirety. The ASCII copy, created on April 13, 2022, is named PRD4142WOPCT1_SL.txt and is 36,649 bytes in size.

[0003] FIELD OF THEINVENTION Methods for monitoring the progression or treatment of multiple myeloma, particularly relapsed or refractory multiple myeloma, are disclosed. [Background technology]

[0004] Multiple myeloma (MM) is the second most common hematological malignancy and accounts for 2% of all cancer deaths. MM is a heterogeneous disease caused mainly by chromosomal rearrangements, especially t(11;14), t(4;14), t(8;14), del(13), and del(17) (Drach et al., Blood. 1998; 92(3):802-809; Gertz et al., Blood. 2005; 106(8).2837-2840; Facon et al., Blood. 2001; 97(6):1566-1571). Patients suffering from MM may develop a variety of disease-related symptoms due to bone marrow infiltration, bone destruction, renal failure, immunodeficiency, and the psychological burden of a cancer diagnosis. Based on people diagnosed with MM between 2009 and 2015, the 5-year relative survival rate for MM was approximately 51%, highlighting that MM is a challenging disease with currently inadequate therapeutic options.

[0005] Relapsed and refractory MM constitute a special unmet medical need. Patients with relapsed and refractory disease are defined as those who achieve a minor or better response and then progress while receiving therapy or experience progression within 60 days of their last therapy. Patients who progress after receiving both an immunomodulatory agent and a proteasome inhibitor have limited options. Intensively pretreated patients often have a compromised immune system, which can result in other disease states such as opportunistic infections and toxicities (e.g., myelosuppression, peripheral neuropathy, deep vein thrombosis) that persist from conventional therapy. Furthermore, patients with advanced MM are often elderly and continue to be exposed to these therapies, making them more susceptible to serious treatment-emergent adverse events (TEAEs). There is no standard of care after standard available therapies (such as proteasome inhibitors, immunomodulatory agents, and monoclonal antibodies) are exhausted. Selinexor and the recently approved BLENREP (belantamab mafodotin-blmf) are approved in the United States for this highly refractory disease setting. The remaining options for these patients are to participate in clinical trials or they can be offered retreatment with the pretreatment regimen (if the toxicity profile for the treatment is acceptable). However, in many cases, palliative therapy is offered only to improve disease-related symptoms when no other treatment options remain. In the elderly population, where stem cell transplantation is often not a viable option, and in patients with refractory disease who have exhausted all available therapies, the median overall survival is only 8-9 months (Kumar et al., Leukemia, 2012, 26:149-157; Usmani et al., Oncolgist, 2016, 21:1355-1361). For patients with disease that is resistant to commonly administered proteasome inhibitors and immunomodulatory drugs, median overall survival decreases to only 5 months (Usmani et al., 2016).

[0006] Currently available methods for monitoring clinical status and response to treatment are not optimal for detecting changes quickly and reliably. For example, monoclonal paraprotein (M protein) concentrations in serum and / or urine are used as indicators of tumor burden, but the slow rate of change can be problematic when the effect of new therapies for MM needs to be evaluated quickly (Udd et al., Clin Adv Hematol Oncol. 2017 Dec;15(12):951-961). Serum free light chain (sFLC) is an option with a shorter half-life, but the percentage of MM patients with sufficiently elevated levels of sFLC is low. Measurement of sFLC is also less reliable in patients with renal dysfunction, a condition that occurs frequently in patients with MM. Bone marrow biopsy is considered the most accurate way to measure plasma cell infiltration, but it is invasive and expensive, often underestimates the extent of plasmacytosis, and can result in severe adverse events (ibid.).

[0007] B-cell maturation antigen (BCMA), also known as CD269 and tumor necrosis factor (TNF) receptor superfamily member 17, is a receptor that plays a key role in the maturation of B lymphocytes (B cells) and their subsequent differentiation into plasma cells. BCMA binds two ligands, namely A proliferation-inducing ligand (APRIL, CD256) and BAFF (CD257). APRIL and BAFF are type II transmembrane proteins that are readily cleaved by furin and secreted as soluble trimers by many cells (B cells [autocrine], monocytes, dendritic cells, T cells, osteoclasts, etc.) and can bind to the BCMA receptor. Unlike other surface markers, BCMA is exclusively expressed on B lineage cells and selectively induced during plasma cell differentiation.

[0008] The human BCMA receptor is a 184 amino acid protein with neither a secretory signal sequence nor a specific protease cleavage site in the N-terminal 54 amino acid extracellular domain. However, the N-terminal fragment is observed as a soluble protein in serum as a result of gamma secretase activity that cleaves the BCMA protein at the transmembrane domain (Laurent et al., Nat Commun. 2015;6:7333). Inhibition of gamma secretase processing leads to a marked increase in BCMA surface protein in human primary B cells (Laurent et al., 2015, supra). High levels of soluble BCMA (sBCMA) have been measured in multiple myeloma patient serum samples (Pillarisetti et al., Blood Adv. 2020 Sep 22;4(18):4538-4549) and correlated with plasma cell counts (Sanchez et al., Br J Haematol. 2012;158(6):727-738).

[0009] BCMA mRNA and protein have been universally detected in MM cell lines and in all malignant plasma cells of patients with multiple myeloma by applicants (Pillarisetti et al., Blood Adv. 2020 Sep 22;4(18):4538-4549) and others (Carpenter et al., Clin Cancer Res. 2013;19(8):2048-2060, Novak et al., Blood. 2004;103(2):689-694). Similarly, in multiple myeloma cell lines and patient samples, BCMA is more stably expressed compared to a major plasma cell marker (CD138) that is also expressed in normal fibroblasts and epithelial cells (Palaiologou et al., Histol Histopathol. 2014;29(2):177-189). BCMA expression was selective for the B cell lineage and was not detected in any major tissues, except in infiltrating plasma cells, as determined by immunohistochemistry (IHC) (Carpenter et al., 2014, supra). In summary, the selective expression of BCMA on the B cell lineage makes it an attractive target for monitoring disease progression and for T cell-mediated therapy to treat plasma cell disorders such as multiple myeloma (Frigyesi et al., Blood. 2014; 123(9): 1336-1340; Tai et al, Immunotherapy. 2015; 7(11): 1187-1199).

[0010] There is a continuing need for improved or alternative methods for monitoring clinical progression and efficacy of therapeutic treatment in MM and plasmacytoma. Summary of the Invention [Means for solving the problem]

[0011] The present application meets this need by providing methods of using sBCMA as a surrogate marker of tumor burden in myeloma and plasmacytoma, and as an informative marker for response to therapy in patients with MM or plasmacytoma.

[0012] In one aspect, provided herein is a method of monitoring the progression of multiple myeloma in a subject, the method comprising: (a) measuring a level of sBCMA in a blood sample obtained from the subject; and (b) comparing the level of sBCMA to a reference sBCMA level, the reference sBCMA level being measured from a control blood sample obtained from the subject prior to obtaining the blood sample of (a) from the subject, wherein an increase in the level of sBCMA compared to the reference sBCMA level is indicative of one or more of an increased tumor burden or disease progression, and a decrease in the level of sBCMA compared to the reference sBCMA level is indicative of one or more of a decreased tumor burden or lack of disease progression.

[0013] The disclosure also provides herein a method of determining response to a therapy for multiple myeloma in a subject, the method comprising: (a) treating the subject with the therapy; (b) measuring a level of sBCMA in a blood sample obtained from the subject following treatment (a); and (c) comparing the level of sBCMA to a reference sBCMA level, the reference sBCMA level measured from a control blood sample obtained from the subject prior to treatment (a), wherein a decrease in the level of sBCMA compared to the reference sBCMA level indicates that the subject is responding to the therapy, and an increase or no change in the level of sBCMA compared to the reference sBCMA level indicates that the subject is not responding to the therapy.

[0014] In certain embodiments, the method further includes treating the subject with a second therapy for multiple myeloma if the level of sBCMA indicates that the subject is not responding to the therapy.

[0015] The disclosure also provides a method of treating multiple myeloma or plasmacytoma in a subject in need thereof, comprising: (a) measuring the level of sBCMA in a blood sample obtained from the subject; (b) comparing the level of sBCMA to a reference sBCMA level to determine the tumor burden in the subject; and (c) administering a therapy to the subject based on the tumor burden determined in (b).

[0016] In certain embodiments, the method further comprises treating the subject with a therapy for multiple myeloma or plasmacytoma before the blood sample is obtained from the subject, wherein the reference sBCMA level is measured from a control blood sample obtained from the subject before the subject is treated with the therapy, and the treatment comprises (a) continuing to treat the subject with the therapy if the level of sBCMA measured in the blood sample obtained from the subject is lower than the reference sBCMA level, or (b) treating the subject with a second therapy for multiple myeloma or plasmacytoma if the level of sBCMA measured in the blood sample obtained from the subject is the same as or higher than the reference sBCMA level.

[0017] The disclosure also provides a method of assessing response to teclistamab or talquetamab in a subject with multiple myeloma or plasmacytoma, the method comprising: (a) treating the subject with teclistamab or talquetamab; (b) measuring a level of sBCMA in a blood sample obtained from the subject after treatment (a); and (c) comparing the level of sBCMA to a reference sBCMA level, the level being measured from a control blood sample obtained from the subject prior to treatment (a), wherein a decrease in the level of sBCMA compared to the reference sBCMA level indicates that the subject is responsive to teclistamab or talquetamab and an increase or no change in the level of sBCMA compared to the reference sBCMA level indicates that the subject is not responsive to teclistamab or talquetamab.

[0018] In certain embodiments, the method further includes treating the subject with a second therapy for multiple myeloma or plasmacytoma if the level of sBCMA indicates that the subject is not responsive to teclistamab or talquetamab.

[0019] In certain embodiments, the blood sample is obtained from the subject about 4-16 weeks, preferably about 4-12 weeks, such as 4, 5, 6, 7, 8, 9, 10, 11 or 12 weeks after the subject has been treated with the therapy.

[0020] In certain embodiments, the therapy comprises a CD3 bispecific antibody. In certain embodiments, the CD3 bispecific antibody is teclistamab or talquetamab. In certain embodiments, the therapy comprises administering intravenously to the subject about 38-720 μg / kg per dose of teclistamab, preferably about 270-720 μg / kg per dose. In other embodiments, the therapy comprises administering subcutaneously to the subject about 80-3000 μg / kg per dose of teclistamab, preferably about 720-3000 μg / kg per dose. In certain embodiments, the therapy comprises administering intravenously to the subject about 0.5-180 μg / kg per dose of talquetamab, preferably about 60-180 μg / kg per dose. In certain embodiments, the therapy comprises administering subcutaneously to the subject about 5-800 μg / kg per dose of talquetamab, preferably about 405-800 μg / kg per dose.

[0021] In certain embodiments, the therapy is administered bi-weekly or weekly.

[0022] In certain embodiments, the second therapy comprises one or more of an autologous stem cell transplant (ASCT), radiation, surgery, a chemotherapy agent, a CAR-T therapy, a cellular therapy, an immunomodulatory agent, a cancer targeted therapy, or a combination thereof.

[0023] In certain embodiments, the subject has relapsed and / or refractory multiple myeloma.

[0024] In certain embodiments, the blood sample is serum, whole blood, or plasma, preferably serum.

[0025] In certain embodiments, the level of sBCMA in a blood sample is measured using an electrochemiluminescence ligand binding assay, enzyme-linked immunosorbent assay (ELISA), or mass spectrometry. [Brief description of the drawings]

[0026] The above summary, as well as the following detailed description of preferred embodiments of the present application, will be better understood when read in conjunction with the appended drawings. It should be understood, however, that the present application is not limited to the precise embodiments shown in the drawings. [Figure 1A] Graphs showing change in sBCMA levels from baseline to C3D1 for teclistamab (FIG. 1A) and talquetamab (FIG. 1B) in responders and non-responders. For three patients (teclistamab) and two patients (talquetamab) without cycle 3 day 1 data, cycle 3 day 8 data were used. [Figure 1B] Graphs showing change in sBCMA levels from baseline to C3D1 for teclistamab (FIG. 1A) and talquetamab (FIG. 1B) in responders and non-responders. For three patients (teclistamab) and two patients (talquetamab) without cycle 3 day 1 data, cycle 3 day 8 data were used. [Figure 2A] Graphs showing change in sBCMA levels from baseline to C3D1 for teclistamab (FIG. 2A) and talquetamab (FIG. 2B) by response to treatment. sCR, stringent complete response; CR, complete response; VGPR, very good partial response; PR, partial response; MR, minimal response; SD, stable disease; PD, progressive disease. [Figure 2B]Graphs showing change in sBCMA levels from baseline to C3D1 for teclistamab (FIG. 2A) and talquetamab (FIG. 2B) by response to treatment. sCR, stringent complete response; CR, complete response; VGPR, very good partial response; PR, partial response; MR, minimal response; SD, stable disease; PD, progressive disease. [Figure 3A] Graphs showing change in sBCMA levels over time for teclistamab (FIG. 3A) and talquetamab (FIG. 3B) in response to treatment are shown. [Figure 3B] Graphs showing change in sBCMA levels over time for teclistamab (FIG. 3A) and talquetamab (FIG. 3B) in response to treatment are shown. [Figure 4A] Graphs showing change in SBCMA levels from baseline to C3D1 for teclistamab (FIG. 4A) and talquetamab (FIG. 4B) by response to treatment are shown. FIG. 4A includes teclistamab iv doses 0.3-720 μg / kg and sc doses 80-3000 μg / kg. Cycle 3 day 8 data was used for three patients without cycle 3 day 1 data, and three patients with sBCMA% change >500%, i.e., 508% (SD), 1201% (SD), and 2620% (SD), are not shown. FIG. 4B includes talquetamab iv doses 1-180 μg / kg and sc doses 5-800 μg / kg. Cycle 3 day 8 data was used for two patients without cycle 3 day 1 data. sBCMA% change was calculated as (Cycle 3 day 1 pre-dose sBCMA baseline / sBCMA baseline)×100. [Figure 4B]Graphs showing change in SBCMA levels from baseline to C3D1 for teclistamab (FIG. 4A) and talquetamab (FIG. 4B) by response to treatment are shown. FIG. 4A includes teclistamab iv doses 0.3-720 μg / kg and sc doses 80-3000 μg / kg. Cycle 3 day 8 data was used for three patients without cycle 3 day 1 data, and three patients with sBCMA% change >500%, i.e., 508% (SD), 1201% (SD), and 2620% (SD), are not shown. FIG. 4B includes talquetamab iv doses 1-180 μg / kg and sc doses 5-800 μg / kg. Cycle 3 day 8 data was used for two patients without cycle 3 day 1 data. sBCMA% change was calculated as (Cycle 3 day 1 pre-dose sBCMA baseline / sBCMA baseline)×100. [Figure 5A] Graphs showing that patients with high tumor burden responded to teclistamab at doses of 270-720 μg / kg iv or 720-3000 μg / kg sc (Figures 5A-5B) and talquetamab at doses of 60-180 μg / kg iv or 405-800 μg / kg sc (Figures 5C-5D). [Figure 5B] Graphs showing that patients with high tumor burden responded to teclistamab at doses of 270-720 μg / kg iv or 720-3000 μg / kg sc (Figures 5A-5B) and talquetamab at doses of 60-180 μg / kg iv or 405-800 μg / kg sc (Figures 5C-5D). [Figure 5C] Graphs showing that patients with high tumor burden responded to teclistamab at doses of 270-720 μg / kg iv or 720-3000 μg / kg sc (Figures 5A-5B) and talquetamab at doses of 60-180 μg / kg iv or 405-800 μg / kg sc (Figures 5C-5D). [Figure 5D]Graphs showing that patients with high tumor burden responded to teclistamab at doses of 270-720 μg / kg iv or 720-3000 μg / kg sc (Figures 5A-5B) and talquetamab at doses of 60-180 μg / kg iv or 405-800 μg / kg sc (Figures 5C-5D). [Figure 6A] Graphs showing patient response by sBCMA levels at baseline for teclistamab (FIG. 6A) and talquetamab (FIG. 6B). [Figure 6B] Graphs showing patient response by sBCMA levels at baseline for teclistamab (FIG. 6A) and talquetamab (FIG. 6B). [Figure 7A] Graphs showing patient response by tumor burden for teclistamab treatment (FIG. 7A) and talquetamab treatment (FIG. 7B) are shown. [Figure 7B] Graphs showing patient response by tumor burden for teclistamab treatment (FIG. 7A) and talquetamab treatment (FIG. 7B) are shown. [Figure 8] Graph showing correlation between baseline sBCMA and % bone marrow tumor plasma cells. Data includes patients with both baseline sBCMA and baseline % bone marrow plasma cells. Patients with extramedullary plasmacytoma were excluded. [Figure 9A] Graphs are shown showing that baseline levels of sBCMA were similar in patients with high-risk and standard-risk cytogenetics, and that teclistamab (FIG. 9A) and talquetamab (FIG. 9B) modulated sBCMA levels in patients with high-risk and standard-risk cytogenetics by day 1 of cycle 3. Active doses of teclistamab were 270-720 μg / kg iv or 720-3000 μg / kg sc, and active doses of talquetamab were 60-180 μg / kg iv or 405-800 μg / kg sc. [Figure 9B]Graphs are shown showing that baseline levels of sBCMA were similar in patients with high-risk and standard-risk cytogenetics, and that teclistamab (FIG. 9A) and talquetamab (FIG. 9B) modulated sBCMA levels in patients with high-risk and standard-risk cytogenetics by day 1 of cycle 3. Active doses of teclistamab were 270-720 μg / kg iv or 720-3000 μg / kg sc, and active doses of talquetamab were 60-180 μg / kg iv or 405-800 μg / kg sc. [Figure 10] Shown is the percent sBCMA change from baseline on Day 1 of Cycle 4 by best response as assessed by an Independent Review Committee (IRC): Pharmacokinetically Evaluable Analytical Set (Pivotal RP2D) within the Analysis Population. List of Abbreviations: RP2D = recommended Phase 2 dose; sCR = stringent complete response; CR = complete response, VGPR = very good partial response; PR = partial response; MR = minimal response; SD = stable disease; PD = progressive disease; sBCMA = soluble B-cell maturation antigen. [Figure 11] Showing percent sBCMA change from baseline on Day 1 of Cycle 4 by investigator-assessed best response; Pharmacokinetic-evaluable analytic population within the analysis population (Phase 1). List of abbreviations: sCR=stringent complete response; CR=complete response, VGPR=very good partial response; PR=partial response; SD=stable disease; PD=progressive disease; sBCMA=soluble B-cell maturation antigen. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0027] The method of the present disclosure can be more readily understood by reference to the following detailed description taken in conjunction with the accompanying drawings, which form a part of this disclosure. It is to be understood that the method of the present disclosure is not limited to the specific methods described and / or illustrated herein, and further, the terminology used herein is for the purpose of describing specific embodiments by way of example only, and is not intended to be limiting to the methods claimed. All patents, published patent applications, and publications cited herein are incorporated by reference as if set forth in their entirety herein.

[0028] As used herein, the singular forms "a," "an," and "the" are intended to include plurals.

[0029] Various terms relating to the embodiments of the present specification are used throughout the specification and claims. Unless otherwise indicated, such terms are to be given their ordinary meaning in the art. Other specifically defined terms are to be interpreted in a manner consistent with the definitions provided herein.

[0030] The term "about," when used in reference to a numerical range, cutoff, or specific value, means within an acceptable range of error for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. Unless expressly stated otherwise in the examples or elsewhere in the specification in the context of an assay, result, or embodiment, "about" means within one standard deviation or up to 10%, whichever is greater, according to practice in the art.

[0031] As used herein, the connective term "and / or" between multiple listed elements is understood to encompass both individual and combined options. For example, when two elements are connected by "and / or", the first option refers to the first element being applicable without the second element. The second option refers to the second element being applicable without the first element. The third option refers to the first and second elements being applicable together. Any one of these options is understood to be included within the meaning and thus meets the requirements of the term "and / or" as used herein. The simultaneous applicability of two or more of the options is also understood to be included within the meaning and thus meets the requirements of the term "and / or".

[0032] The term "antibody" has a broad meaning and includes immunoglobulin molecules including monoclonal antibodies (including murine, human, humanized, and chimeric monoclonal antibodies), antigen-binding fragments, multispecific antibodies such as bispecific, trispecific, tetraspecific, dimeric, tetrameric, or multimeric antibodies, single-chain antibodies, domain antibodies, and any other modified form of immunoglobulin molecule that contains an antigen-binding site of the required specificity. A "full-length antibody" is composed of two heavy chains (HC) and two light chains (LC), and multimers thereof (e.g., IgM), interconnected by disulfide bonds. Each heavy chain is composed of a heavy chain variable region (VH) and a heavy chain constant region (consisting of domains CH1, hinge, CH2, and CH3). Each light chain is composed of a light chain variable region (VL) and a light chain constant region (CL). The VH and VL regions can be further divided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with framework regions (FRs). Each VH and VL is composed of three CDR and four FR segments, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. Immunoglobulins can be assigned to five major classes, IgA, IgD, IgE, IgG, and IgM, depending on the amino acid sequence of the heavy chain constant domain. IgA and IgG are further subdivided into isotypes IgA1, IgA2, IgG1, IgG2, IgG3, and IgG4. Antibody light chains of any vertebrate species can be assigned to one of two clearly distinct types, kappa (κ) and lambda (λ), based on the amino acid sequence of their constant domains.

[0033] The term "antigen-binding fragment" or "antigen-binding domain" refers to a portion of an immunoglobulin molecule that binds to an antigen. Antigen-binding fragments can be synthetic, enzymatically obtainable, or recombinantly produced polypeptides, and include VH, VL, VH and VL, Fab, F(ab')2, Fd and Fv fragments, domain antibodies (dAbs) consisting of one VH domain or one VL domain, shark variable IgNAR domains, camelized VH domains, the smallest recognition unit consisting of amino acid residues reproducing the CDRs of an antibody, such as the FR3-CDR3-FR4 portion, HCDR1, HCDR2, and / or HCDR3, and LCDR1, LCDR2, and / or LCDR3. The VH and VL domains can be linked to each other via synthetic linkers to form various types of single chain antibody designs, and when the VH and VL domains are expressed as separate single chain antibody constructs, the VH / VL domains can pair intramolecularly or intermolecularly to form monovalent antigen binding sites, such as single chain Fvs (scFvs) or diabodies, as described, for example, in WO 1998 / 44001, WO 1988 / 01649, WO 1994 / 13804, and WO 1992 / 01047.

[0034] Unless otherwise indicated, the term "at least" preceding a series of elements should be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.

[0035] "BCMA" refers to human B cell maturation antigen, which is also known as CD269 or TNFRSF17 (UniProt Q02223). The extracellular domain of BCMA encompasses residues 1-54 of Q02223. Human BCMA comprises the amino acid sequence of SEQ ID NO:1.

[0036] SEQ ID NO:1 MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR

[0037] "sBCMA," "soluble BCMA," and "serum BCMA" refer to the extracellular domain of BCMA (residues 1-57 of SEQ ID NO:1), which is cleaved from its membrane-bound form on plasma cells by gamma-secretase, released into the blood, and solubilized in serum.

[0038] The term "bispecific" refers to an antibody that specifically binds to two different antigens or to two different epitopes within the same antigen. Bispecific antibodies may be cross-reactive to other related antigens, e.g., the same antigen (homologs) from other species, such as humans or monkeys, e.g., cynomolgus monkeys (Macaca cynomolgus, cyno) or chimpanzees (Pan troglodytes), or may bind to an epitope shared between two or more different antigens.

[0039] "BCMAxCD3 bispecific antibody" refers to a bispecific antibody that specifically binds to BCMA and CD3.

[0040] When used in the context of an antibody or antibody fragment, "specifically binds" or "binds specifically" or variations thereof refer to binding to one or more epitopes of a protein of interest through a domain encoded by an immunoglobulin gene or a fragment of an immunoglobulin gene, without preferentially binding to other molecules in a sample containing a mixed population of molecules. Typically, an antibody binds to about 1×10 6 epitopes of the protein of interest, as measured by surface plasmon resonance assays or cell binding assays. -6It binds to its cognate antigen with a Kd of less than M. Phrases such as "[antigen]-specific" antibody (e.g., a GPRC5D-specific antibody) are meant to convey that the recited antibody specifically binds to the recited antigen.

[0041] The term "biological marker" or "biomarker" refers to a substance whose change and / or detection is indicative of a particular biological state. A "biomarker" may indicate a change in the level of polypeptide or protein expression that may correlate with risk of disease, susceptibility to treatment, or progression. In some embodiments, a biomarker may be a polypeptide or protein, or a fragment thereof. The relative level of a particular protein may be determined by methods known in the art. For example, antibody-based methods such as immunoblot, enzyme-linked immunosorbent assay (ELISA), or other methods may be used. In some embodiments, what is indicated is the responsiveness of a disease, e.g., cancer (e.g., MM or plasmacytoma), to a given treatment (e.g., an antibody such as teclistamab or talquetamab).

[0042] As used herein, the term "cancer" refers to a broad group of various diseases characterized by the uncontrolled growth of abnormal cells in the body. Uncontrolled cell division and growth can lead to the formation of malignant tumors that invade adjacent tissues and can also metastasize to distant parts of the body via the lymphatic system or bloodstream. "Cancer" or "cancerous tissue" can include tumors.

[0043] The term "CD3" refers to a human antigen expressed on T cells as part of the multi-molecular T cell receptor (TCR) complex and consisting of a homodimer or heterodimer formed from the association of two or four receptor chains, CD3 epsilon, CD3 delta, CD3 zeta, and CD3 gamma. The term "CD3" includes any CD3 variants, isoforms, and interspecies homologs that may be expressed naturally by cells (including T cells) or on cells transfected with genes or cDNAs encoding these polypeptides, unless otherwise indicated. Human CD3 epsilon comprises the amino acid sequence of SEQ ID NO: 2. SEQ ID NO: 3 shows the extracellular domain of human CD3 epsilon.

[0044] SEQ ID NO:2 MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGS KPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

[0045] SEQ ID NO:3 DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

[0046] The term "CH3 region" or "CH3 domain" refers to a region of the CH3 of an immunoglobulin. The CH3 region of a human IgG1 antibody corresponds to amino acid residues 341 to 446. However, the CH3 region can also be of any of the other antibody isotypes described herein.

[0047] As used herein, the term "combination" means that two or more therapeutic agents are administered to a subject together in a mixture, simultaneously as single agents, or sequentially in any order as single agents.

[0048] As used herein, the term "complementarity determining region" (CDR) refers to the region of an antibody that binds an antigen. CDRs can be defined using various descriptive methods, such as Kabat (Wu et al. J Exp Med 132:211-50, 1970) (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991), Chothia (Chothia et al. J Mol Biol 196:901-17, 1987), IMGT (Lefranc et al. Dev Comp Immunol 27:55-77, 2003) and AbM (Martin and Thornton J Bmol Biol 263:800-15, 1996). Various descriptions and their correspondence with the numbering of variable regions have been described (see, for example, Lefranc et al. Dev Comp Immunol 27:55-77, 2003; Honegger and Pluckthun, J Mol Biol 309:657-70, 2001; International ImMunoGeneTics (IMGT) database, web resource, http: / / www_imgt_org). Available programs such as abYsis by UCL Business PLC can be used to describe CDRs. As used herein, the terms "CDR", "HCDR1", "HCDR2", "HCDR3", "LCDR1", "LCDR2" and "LCDR3" include CDRs defined by any of the methods of Kabat, Chothia, IMGT or AbM as described above, unless otherwise expressly stated herein.

[0049] As used herein, the term "comprising" is intended to include examples encompassed by the terms "consisting essentially of" and "consisting of." Similarly, the term "consisting essentially of" is intended to include examples encompassed by the term "consisting of." Unless the context clearly indicates otherwise, throughout the specification and claims, words such as "comprise," "comprising," "having," and the like, are to be construed in an inclusive sense, i.e., "including, but not limited to," as opposed to an exclusive or exclusive sense.

[0050] As used herein, a "control sample" or "control blood sample" refers to a baseline sample or blood sample from a subject who has not been exposed to or treated with a particular therapy (e.g., teclistamab or talquetamab).

[0051] The term "improve" or "improved" as used herein refers to an increase in the measured level of sBCMA compared to a control or reference level. "Improved" can be about a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% or more increase, or a statistically significant increase.

[0052] As used herein, the term "Fc gamma receptor" (FcγR) refers to the well-known FcγRI, FcγRIIa, FcγRIIb, or FcγRIII. Activating FcγR includes FcγRI, FcγRIIa, and FcγRIII.

[0053] As used herein, the terms "G protein-coupled receptor family C group 5 member D" and "GPRC5D" specifically encompass the human GPRC5D protein as set forth in, for example, SEQ ID NO: 4 or GenBank Accession No. BC069341, NCBI Reference Sequence: NP_061124.1.1 and UniProtKB / Swiss-Prot Accession No. Q9NZD1 (see also Brauner-Osborne, H. et al. 2001, Biochim. Biophys. Acta 1518, 237-248).

[0054] SEQ ID NO:4 MYKDCIESTGDYFLLCDAEGPWGIILESLAILGIVVTILLLLAFLFLMRKIQDCSQWNVLPTQLLFLLSVLGLFGLAFAFIIELNQQTAPVRYFLFGVLFALCFSCLLAHASNLVKLVRGCVSFSWTTILCIAIGCSLLQIIIATEYVTLIMTRGMMFVNMTPCQLNVDFVV LLVYVLFLMALTFFVSKATFCGPCENWKQHGRLIFITVLFSIIIWVVWISMLLRGNPQFQRQPQWDDPVVCIALVTNAWVFLLLYIVPELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV

[0055] As used herein, a "GPRC5DxCD3 antibody" is a multispecific antibody, optionally a bispecific antibody, which comprises two different antigen-binding regions, one of which specifically binds to the antigen GPRC5D and the other of which specifically binds to CD3.

[0056] As used herein, the term "human antibody" refers to an antibody that is optimized to have a minimal immune response when administered to a human subject. The variable regions of a human antibody are derived from human immunoglobulin sequences. If the human antibody contains a constant region or a portion of a constant region, the constant region is also derived from a human immunoglobulin sequence. A human antibody contains heavy and light chain variable regions that are "derived" from sequences of human origin when the variable regions of the human antibody are derived from a system that uses human germline immunoglobulin or rearranged immunoglobulin genes. Exemplary such systems are phage-displayed human immunoglobulin gene libraries and transgenic non-human animals, such as mice or rats, carrying human immunoglobulin loci. A "human antibody" typically contains amino acid differences when compared to immunoglobulins expressed in humans, due to differences in the system used to obtain the human antibodies and human immunoglobulin loci, the intentional introduction of somatic mutations or substitutions into the framework or CDRs, or both. Typically, a "human antibody" is at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical in amino acid sequence to the amino acid sequence encoded by a human germline immunoglobulin or rearranged immunoglobulin gene. Optionally, a "human antibody" can comprise a consensus framework sequence obtained from human framework sequence analysis as described, for example, in Knappik et al., (2000) J Mol Biol 296:57-86, or a synthetic HCDR3 incorporated into a library of human immunoglobulin genes displayed on phage as described, for example, in Shi et al., (2010) J Mol Biol 397:385-96 and WO 2009 / 085462. Antibodies in which at least one CDR is derived from a non-human species are not included in the definition of "human antibody."

[0057] As used herein, the term "humanized antibody" refers to an antibody in which at least one CDR is derived from a non-human species and at least one framework is derived from a human immunoglobulin sequence. Humanized antibodies can contain substitutions in the framework, such that the framework may not be an exact copy of an expressed human immunoglobulin or human immunoglobulin germline gene sequence.

[0058] As used herein, the term "isolated" refers to a homogenous population of molecules (e.g., proteins such as synthetic polynucleotides or antibodies) that have been substantially separated and / or purified from other components associated with the system in which the molecule is produced, such as a recombinant cell, as well as to a protein that has been subjected to at least one purification or isolation step. An "isolated antibody" refers to an antibody that is substantially free of other cellular material and / or chemicals, and encompasses antibodies that have been isolated to greater degrees of purity, e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% purity.

[0059] As used herein, the term "monoclonal antibody" refers to an antibody obtained from a substantially homogeneous population of antibody molecules (i.e., the individual antibodies comprising the population are identical except for possible well-known alterations such as removal of the C-terminal lysine from the antibody heavy chain, or post-translational modifications such as amino acid isomerization or deamidation, methionine oxidation, or asparagine or glutamine deamidation). Monoclonal antibodies typically bind to one antigenic epitope. Bispecific monoclonal antibodies bind to two different antigenic epitopes. Monoclonal antibodies can have heterogeneous glycosylation within the antibody population. Monoclonal antibodies can be monospecific or multispecific, such as bispecific, and can be monovalent, bivalent, or multivalent.

[0060] As used herein, the term "mutation" refers to an engineered or naturally occurring change in a polypeptide or polynucleotide sequence compared to a reference sequence. The change can be one or more amino acid or polynucleotide substitutions, insertions, or deletions.

[0061] As used herein, the term "multispecific" refers to an antibody that specifically binds to at least two different antigens or at least two different epitopes within the same antigen. A multispecific antibody can, for example, bind to two, three, four, or five different antigens, or different epitopes within the same antigen.

[0062] Current IMWG (International Myeloma Working Group) guidelines define "negative minimal residual disease status" or "negative MRD status" or "MRD-negative" as less than 1 tumor cell per 100,000 bone marrow cells (10 -5 Negative minimal residual disease status can be determined using next generation sequencing (NGS).

[0063] As used herein, the term "pharmaceutical composition" refers to a composition comprising an active ingredient and a pharma- ceutically acceptable carrier.

[0064] As used herein, the term "pharmaceutical acceptable carrier" or "excipient" refers to an ingredient in a pharmaceutical composition, other than an active ingredient, that is not toxic to a subject.

[0065] The term "recombinant" as used herein refers to nucleic acids, antibodies and other proteins or peptides that are prepared, expressed, produced or isolated by recombinant methods. For example, segments from different sources can be joined to produce recombinant DNA, RNA, antibodies or proteins.

[0066] As used herein, the term "reduce" or "reduced" refers to a decrease in the measured level of sBCMA compared to a control or reference level. "Reduced" can be about a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% or more decrease, or a statistically significant decrease.

[0067] As used herein, the term "reference level" refers to a level of sBCMA that is an absolute level; a relative level; a level with upper and / or lower limits; a range of levels; an average level; a median level, a mean level, or a level compared to a particular control, baseline, or test level. A reference level of sBCMA can be based on an individual sample level, such as a level obtained from a sample from a subject with MM or plasmacytoma but at an earlier time point, or a level obtained from a sample from a subject with MM or plasmacytoma other than the individual being tested, or a level obtained from a sample from a "normal" subject, which is an individual not diagnosed with MM or plasmacytoma. A reference level can be based on multiple samples, such as from MM or plasmacytoma patients or healthy individuals, or based on a pool of samples that may or may not include the sample being tested.

[0068] As used herein, the term "refractory" refers to cancer that is not modifiable to surgical intervention and does not initially respond to therapy.

[0069] As used herein, the term "recurrent" refers to cancer that has responded to treatment but then recurs.

[0070] The terms "response," "responsiveness," or "responsive," when used in reference to a treatment or therapy, refer to the degree of effectiveness of the treatment or therapy in alleviating or reducing the symptoms of the disease being treated. The disease can be, for example, MM or plasmacytoma. For example, when used in reference to the treatment of a cell or subject, the term "increased responsiveness" refers to an increased effectiveness in alleviating or reducing the symptoms of the disease, as measured using any method known in the art. In certain embodiments, the increased effectiveness is at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, or at least about 50%.

[0071] As used herein, a "sample" is intended to include any sampling of cells, tissues, or bodily fluids in which expression of a gene, protein, or biomarker can be detected. Examples of such samples include, but are not limited to, biopsies, smears, blood, lymph, urine, saliva, or any other bodily secretion or derivative thereof. Blood may include, for example, whole blood, plasma, serum, or any derivative of blood. Samples may be treated, for example with an anticoagulant, or may be untreated. Samples may be obtained from a subject by a variety of techniques known to those of skill in the art.

[0072] As used herein, the term "subject" includes any human or non-human animal. "Non-human animals" include all vertebrates, such as mammals and non-mammals, e.g., non-human primates, sheep, dogs, cats, horses, cows, chickens, amphibians, reptiles, etc. Except where noted, the terms "patient" and "subject" are used interchangeably.

[0073] As used herein, the term "T cell redirected therapeutic" refers to a molecule that contains two or more binding regions, one of which specifically binds to a cell surface antigen on a target cell or tissue, and a second binding region of the molecule specifically binds to a T cell antigen. Examples of cell surface antigens include tumor-associated antigens such as BCMA or GPRC5D. Examples of T cell antigens include, for example, CD3. This dual / multiple target binding ability recruits T cells to the target cell or tissue, resulting in eradication of the target cell or tissue.

[0074] As used herein, the term "therapeutically effective amount" refers to an amount effective, at the dosage and for the period of time necessary, to obtain the desired therapeutic result. The therapeutically effective amount may vary depending on factors such as the individual's condition, age, sex, and weight, as well as the ability of the therapeutic agent or combination of therapeutic agents to elicit a desired response in the individual. Exemplary indicators of an effective therapeutic agent or combination of therapeutic agents include, for example, improved health of the patient.

[0075] As used herein, the term "treat" or "treatment" refers to both therapeutic treatment and prophylactic or preventative measures, the purpose being to prevent or slow down (reduce) an undesirable physiological change or disorder. Beneficial or desired clinical results include alleviation of symptoms, reduction in the extent of disease, a stable (i.e., not worsening) disease state, a delay or slowing of disease progression, an improvement or alleviation of a disease state, and remission (whether partial or total), whether detectable or undetectable. "Treatment" can also mean prolonging the survival of a subject compared to the expected survival if the subject were not receiving treatment. Those in need of treatment include those already with a condition or disease, as well as those susceptible to having a condition or disease, or those in whom a condition or disease is to be prevented.

[0076] The term "tumor burden" or "tumor cell burden" as used herein refers to the number of tumor cells, the size of the tumor, the total mass of tumor tissue, or the amount of cancer in a subject's body.

[0077] As used herein, the term "tumor cell" or "cancer cell" refers to a cancerous, precancerous, or transformed cell, either in vivo, ex vivo, or in tissue culture, that has a naturally occurring or induced phenotypic change. These changes do not necessarily involve the incorporation of new genetic material. Transformation may occur by infection with a transforming virus and incorporation of new genomic nucleic acid, incorporation of exogenous nucleic acid, or may occur spontaneously or after exposure to a carcinogen, thereby mutating endogenous genes. Transformation / cancer is exemplified by morphological changes, cellular immortalization, aberrant growth control, formation of foci, proliferation, malignant lesions, modulation of tumor-specific marker levels, invasiveness, tumor growth in suitable animal hosts such as nude mice, and the like, in vitro, in vivo, and ex vivo.

[0078] To aid the reader of this application, the description of the specification is divided into various paragraphs or sections or directed to various embodiments of the application. These separations should not be considered as separating a paragraph or section or embodiment substance from another paragraph or section or embodiment substance. On the contrary, a person skilled in the art will understand that the description of this specification has broad application and encompasses all combinations of the various paragraphs, paragraphs, and sentences that may be conceived. Discussion of any embodiment is meant to be merely exemplary and is not intended to suggest that the scope of the present disclosure, including the claims, is limited to these examples. This application contemplates the use of any of the applicable components and / or steps in any combination that may be used in this application, regardless of whether a particular combination is explicitly described.

[0079] sBCMA and its uses The methods provided herein are based, in part, on the discovery that a detectable decrease or increase in serum BCMA (sBCMA) levels is observed in subjects with multiple myeloma or plasmacytoma that are responsive and non-responsive, respectively, to a given treatment (e.g., an antibody such as teclistamab or talquetamab), and the level of sBCMA can be used as a biomarker to predict or monitor a subject's responsiveness to treatment and / or the progression of cancer in a subject.

[0080] Thus, in one general aspect, the disclosure relates to a method of monitoring the progression of cancer in a subject, comprising: (a) measuring a level of sBCMA in a blood sample obtained from the subject; and (b) comparing the level of sBCMA to a reference sBCMA level, the reference sBCMA level being measured from a control blood sample obtained from the subject prior to obtaining the blood sample of (a) from the subject, wherein an increase in the level of sBCMA compared to the reference sBCMA level indicates one or more of an increase in tumor burden or disease progression, and a decrease in the level of sBCMA compared to the reference sBCMA level indicates one or more of a decrease in tumor burden or lack of disease progression. Additionally, sBCMA can be descriptive of plasmacytoma, e.g., a patient with plasmacytoma may have a low tumor burden as measured by bone marrow plasma cell (BMPC) %, but high sBCMA levels. Preferably, the cancer is multiple myeloma (MM) or plasmacytoma, and more preferably, the cancer is relapsed and / or refractory multiple myeloma.

[0081] In some embodiments, the level of sBCMA can be measured a period of time after the measurement of the reference sBCMA level in the control blood sample, for example, about 4-16 weeks, about 2-6 months, about 4-12 months, or more after the measurement of the reference sBCMA level. In some embodiments, the level of sBCMA is measured more than once after the measurement of the reference sBCMA level in the control blood sample to determine the progression of cancer in the subject. In some embodiments, the level of sBCMA can be measured at multiple time points to determine the progression of cancer in the subject over time. For example, the level of sBCMA can be measured daily, weekly, monthly, every 6 months, yearly, or any length of time in between to determine the progression of cancer in the subject.

[0082] In another general aspect, the disclosure relates to a method of determining response to a therapy for multiple myeloma in a subject, the method comprising: (a) treating the subject with the therapy; (b) measuring a level of sBCMA in a blood sample obtained from the subject following treatment (a); and (c) comparing the level of sBCMA to a reference sBCMA level, the level being measured from a control blood sample obtained from the subject prior to treatment (a); wherein a decrease in the level of sBCMA compared to the reference sBCMA level indicates that the subject is responding to the therapy, and an increase or no change in the level of sBCMA compared to the reference sBCMA level indicates that the subject is not responding to the therapy.

[0083] In some embodiments, the multiple myeloma is relapsed or refractory multiple myeloma.

[0084] In some embodiments, the blood sample is obtained from the subject 4-16 weeks, preferably 4-12 weeks, e.g., 4, 5, 6, 7, 8, 9, 10, 11 or 12 weeks after the subject has been treated with the therapy. In some embodiments, the blood sample is obtained from the subject about 2-6 months, about 4-12 months, or more after the subject has been treated with the therapy. In some embodiments, the level of sBCMA is measured more than once after measuring a reference sBCMA level in a control blood sample. In some embodiments, the level of sBCMA can be measured at multiple time points to determine response to therapy over time. For example, the level of sBCMA can be measured daily, weekly, monthly, once every six months, yearly, or any length of time in between to determine response to therapy over time.

[0085] In some embodiments, the blood sample is whole blood, serum, or plasma, preferably serum. The blood sample may be treated, for example with an anticoagulant, or may be untreated.

[0086] In some embodiments, the therapy is a CD3 bispecific antibody. In some embodiments, the therapy is teclistamab or talquetamab. In some embodiments, the therapy is a CAR-T therapy. In some embodiments, the method includes treating the subject with a second therapy for multiple myeloma if the level of sBCMA is increased or unchanged compared to a reference sBCMA level. In some embodiments, the second therapy is a CD3 bispecific antibody. In some embodiments, the second therapy is teclistamab or talquetamab. In some embodiments, the second therapy is one or more of autologous stem cell transplant (ASCT), radiation, surgery, a chemotherapy agent, a CAR-T therapy, a cell therapy, an immunomodulatory agent, a cancer targeted therapy, or a combination thereof.

[0087] In another general aspect, the disclosure relates to a method of treating multiple myeloma or plasmacytoma in a subject in need thereof, comprising: (a) measuring a level of sBCMA in a blood sample obtained from the subject; (b) comparing the level of sBCMA to a reference sBCMA level to measure the subject's tumor burden; and (c) administering a therapy to the subject based on the tumor burden measured in (b). In some embodiments, the method further comprises treating the subject with a therapy for multiple myeloma or plasmacytoma before the blood sample is obtained from the subject, the reference sBCMA level being measured from a control blood sample obtained from the subject before the subject is treated with the therapy, and the treatment comprises: (a) continuing to treat the subject with the therapy if the level of sBCMA measured in the blood sample obtained from the subject is lower than the reference sBCMA level, or (b) treating the subject with a second therapy for multiple myeloma or plasmacytoma if the level of sBCMA is the same as or higher than the reference sBCMA level.

[0088] In some embodiments, the multiple myeloma or plasmacytoma is relapsed and / or refractory.

[0089] In some embodiments, the blood sample is obtained from the subject 4-16 weeks, preferably 4-12 weeks, e.g., 4, 5, 6, 7, 8, 9, 10, 11, or 12 weeks after the subject has been treated with the therapy. In some embodiments, the blood sample is whole blood, serum, or plasma, preferably serum. The blood sample may be treated, for example, with an anticoagulant, or may be untreated.

[0090] In some embodiments, the therapy is a CD3 bispecific antibody. In some embodiments, the therapy is teclistamab or talquetamab. In some embodiments, the therapy is a CAR-T therapy. In some embodiments, the second therapy is a CD3 bispecific antibody. In some embodiments, the second therapy is teclistamab or talquetamab. In some embodiments, the second therapy is one or more of autologous stem cell transplant (ASCT), radiation, surgery, a chemotherapy agent, a CAR-T therapy, a cell therapy, an immunomodulatory agent, a cancer targeted therapy, or a combination thereof.

[0091] In some embodiments, the reference sBCMA level is a predetermined level of sBCMA, and the treatment comprises treating the subject with a therapy for multiple myeloma or plasmacytoma if the level of sBCMA is lower than the predetermined level. The predetermined level of sBCMA may vary depending on the therapy used. The predetermined level for the therapy may be determined based on an individual's responsiveness to the therapy and may be stored as part of the individual's medical record. The predetermined level for the therapy may be determined based on an average responsiveness of multiple individuals to the therapy. In some embodiments, the predetermined level of sBCMA is preferably about 400-1000 ng / mL, e.g., about 400 ng / mL, about 500 ng / mL, about 600 ng / mL, about 700 ng / mL, about 800 ng / mL, about 900 ng / mL, or about 1000 ng / mL for CD3 bispecific antibodies. Preferably, the predetermined level of sBCMA for teclistamab or talquetamab is about 400-800 ng / mL, more preferably about 400-600 ng / mL, for example about 400, about 450, about 500, about 550 or about 600 ng / mL.

[0092] In another general aspect, the disclosure relates to a method of assessing response to teclistamab or talquetamab in a subject having multiple myeloma or plasmacytoma, the method comprising: (a) treating the subject with teclistamab or talquetamab; (b) measuring a level of sBCMA in a blood sample obtained from the subject after treatment (a); and (c) comparing the level of sBCMA to a reference sBCMA level, the level being measured from a control blood sample obtained from the subject prior to treatment (a); wherein a decrease in the level of sBCMA compared to the reference sBCMA level indicates that the subject is responsive to teclistamab or talquetamab, and an increase or no change in the level of sBCMA compared to the reference sBCMA level indicates that the subject is not responsive to teclistamab or talquetamab. In some embodiments, the methods further include treating the subject with a second therapy for multiple myeloma or plasmacytoma if the level of sBCMA indicates that the subject is not responsive to teclistamab or talquetamab.

[0093] In some embodiments, the multiple myeloma or plasmacytoma is relapsed and / or refractory.

[0094] In some embodiments, the blood sample is obtained from the subject 4-16 weeks, preferably 4-12 weeks, e.g., 4, 5, 6, 7, 8, 9, 10, 11, or 12 weeks after the subject has been treated with the therapy. In some embodiments, the blood sample is whole blood, serum, or plasma, preferably serum. The blood sample may be treated, for example, with an anticoagulant, or may be untreated.

[0095] The methods of the present application can be used to assess response to any cancer therapy in light of the present disclosure. In some embodiments, the therapy is a CD3 bispecific antibody. In some embodiments, the therapy is teclistamab or talquetamab. In some embodiments, the therapy is a CAR-T therapy. In some embodiments, the second therapy is a CD3 bispecific antibody. In some embodiments, the second therapy is teclistamab or talquetamab. In some embodiments, the therapy or second therapy is one or more of autologous stem cell transplantation (ASCT), radiation, surgery, chemotherapy, CAR-T therapy, cell therapy, immunomodulatory drugs, cancer targeted therapy, or combinations thereof, with the proviso that the second therapy is different from the therapy.

[0096] In view of the present disclosure, any suitable method can be used to measure the level of BCMA. In some embodiments of the various methods provided herein, the level (e.g., expression) of sBCMA is determined by measuring protein levels in a sample.

[0097] In some embodiments, the sample is obtained from a biopsy, smear, blood, lymph, urine, saliva, or any other bodily secretion or derivative thereof from a subject. In a preferred embodiment, the sample is a blood sample. The blood sample may include, for example, whole blood, plasma, serum, or any derivative of blood. Preferably, the blood sample is serum. The sample may be untreated or may be treated or processed according to methods known in the art (e.g., with anticoagulants). Preferably, the sample is untreated.

[0098] In certain embodiments, the level (e.g., expression) of the biomarker is measured by electrochemiluminescence ligand binding assay or other similar methods known in the art. In certain embodiments, the level (e.g., expression) of the biomarker is measured by enzyme-linked immunosorbent assay-based methodology (ELISA) or other similar methods known in the art. The ELISA can use one or several different anti-BCMA antibodies. Non-limiting examples of commercially available antibodies that can be used in the ELISA are MAB193 (R&D Systems), Vicky-1 (Novus Biologicals; Catalog No. NBP1-97637), LS-B2728 (LifeSpan Biosciences), or BCMA / 2366 (NSJ Bioreagents; Catalog No. V3814). In certain embodiments, the level (e.g., expression) of the biomarker is measured by exposing the sample to a mass spectrometry technique (e.g., mass spectrometry) or other similar methods known in the art.

[0099] In certain embodiments, reagents are provided for detection and / or quantification of biomarker proteins. The reagents may include, but are not limited to, a primary antibody that binds to a protein biomarker, a secondary antibody that binds to the primary antibody, an affibody that binds to a protein biomarker, an aptamer (e.g., SOMAmer) that binds to a protein or nucleic acid biomarker (e.g., RNA or DNA), and / or a nucleic acid that binds to a nucleic acid biomarker (e.g., RNA or DNA). The detection reagents may be labeled (e.g., fluorescently) or unlabeled. Additionally, the detection reagents may be free in solution or immobilized.

[0100] In certain embodiments, the levels of one or more additional biomarkers are monitored simultaneously or sequentially. Multiple biomarkers can be monitored simultaneously or sequentially.

[0101] In certain embodiments, when quantifying the level of a biomarker present in a sample, the level can be determined on an absolute or relative basis. When determined on a relative basis, a comparison can be made to a control, which can include, but is not limited to, previous samples from the same patient (e.g., a series of samples over a particular period of time), levels found in subjects or subject populations without a disease or disorder (e.g., MM), thresholds, and acceptable ranges.

[0102] Another aspect of the present application relates to a kit or combination of reagents useful for the methods of the present invention, comprising one or more agents for measuring the level of sBCMA in a blood sample. The reagents may include, but are not limited to, a primary antibody that binds to a protein biomarker, a secondary antibody that binds to the primary antibody, an affibody that binds to a protein biomarker, an aptamer (e.g., SOMAmer) that binds to a protein or nucleic acid biomarker (e.g., RNA or DNA), and / or a nucleic acid that binds to a nucleic acid biomarker (e.g., RNA or DNA). The detection reagent may be labeled (e.g., fluorescently) or unlabeled. Additionally, the detection reagent may be free in solution or immobilized.

[0103] The kit may contain all components necessary or sufficient for the assay, which may include, but are not limited to, detection reagents (e.g., probes), buffers, control reagents (e.g., positive and negative controls), amplification reagents, solid supports, labels, instructions, etc. In certain embodiments, the kit includes a set of probes for detecting sBCMA (optionally in combination with one or more additional biomarkers), and a solid support for immobilizing the set of probes. In certain embodiments, the kit includes a set of probes for BCMA (optionally in combination with one or more additional biomarkers), a solid support, and reagents for processing the sample to be tested (e.g., reagents for isolating protein or nucleic acid from the sample).

[0104] cancer The methods of the present application can be used to treat or monitor cancer, preferably a hematological malignancy or plasma cell proliferative disorder, more preferably a relapsed or refractory hematological malignancy or plasma cell proliferative disorder.

[0105] In some embodiments, the hematological malignancy is selected from the group consisting of multiple myeloma, smoldering multiple myeloma, monoclonal gammopathy of undetermined significance (MGUS), acute lymphoblastic leukemia (ALL), diffuse large B-cell lymphoma (DLBCL), Burkitt's lymphoma (BL), follicular lymphoma (FL), mantle-cell lymphoma (MCL), Waldenstrom's hypergammaglobulinemia, plasma cell leukemia, light chain amyloidosis (AL), precursor B-cell lymphoblastic leukemia, precursor B-cell lymphoblastic leukemia, acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), myelodysplastic leukemia, myelodysplastic syndrome (MS ... and malignant lymphomas such as myeloid leukemia (CML), erythroblastic lymphoid tumors (ALT), leukemia, myelogenous leukemia (MDS), chronic lymphocytic leukemia (CLL), B-cell malignancies, chronic myeloid leukemia (CML), hairy cell leukemia (HCL), blastic plasmacytoid dendritic cell neoplasms, Hodgkin's lymphoma, non-Hodgkin's lymphoma, marginal zone B-cell lymphoma (MZL), mucosa-associated lymphatic tissue (MALT), plasma cell leukemia, anaplastic large-cell lymphoma (ALCL), leukemia, or lymphoma.

[0106] In some embodiments, the plasma cell proliferative disorder is asymptomatic myeloma (smoldering multiple myeloma or indolent myeloma), plasmacytoma (e.g., dysplasmocytosis, solitary myeloma, solitary plasmacytoma, extramedullary plasmacytoma, and multiple plasmacytoma), monoclonal gammapathy of undetermined significance (MGUS), Waldenstrom's macroglobulinemia, systemic amyloid light chain amyloidosis, and POEMS syndrome (also known as Crow-Fukase syndrome, Takatsuki disease, and PEP syndrome).

[0107] In preferred embodiments, the hematological malignancy or plasma cell proliferative disorder is multiple myeloma or plasmacytoma. In some embodiments, the subject has newly diagnosed multiple myeloma or plasmacytoma. In some embodiments, the subject is relapsed or refractory to treatment with a previous anti-cancer therapy, such as a therapeutic agent used to treat multiple myeloma or other hematological malignancies or plasmacytomas.

[0108] In some embodiments, the subject is refractory or relapsed to one or more prior anti-cancer treatments or therapies. Exemplary prior anti-cancer treatments or therapies include, but are not limited to, THALOMID® (thalidomide), REVLIMID® (lenalidomide), POMALYST® (pomalidomide), VELCADE® (bortezomib), NINLARO (ixazomib), KYPROLIS® (carfilzomib), FARADYK® (panobinostat), AREDIA® (pomalide), or combination chemotherapy. lonate), ZOMETA® (zoledronic acid), DARZALEX® (daratumumab), EMPLICITI® (elotuzumab), melphalan, Xpovio® (selinexor), BLENREP (belantamab mafodotin-blmf), Venclexta® (venetoclax), CAR-T therapy, other BCMA directed therapy, other CD38 directed therapy, or any combination thereof.

[0109] A variety of qualitative and / or quantitative methods can be used to determine disease relapse or refractory. According to the NCCN guidelines, "clinical relapse" is defined as the occurrence of one or more of the following: direct signs of cancer growth, signs of organ damage, an increase in the size and number of plasmacytomas or bone lesions (at least a 50% increase), an increase in calcium levels, an increase in blood creatinine levels, or a decrease in red blood cell count. "Relapse from complete response" is defined as the occurrence of one or more of the following in patients who have achieved a complete response: the return of M protein in the blood or urine, or other signs of myeloma (but do not meet the criteria for clinical relapse progressive disease). ("Progressive disease" is defined as the occurrence of one or more of the following: at least a 25% increase in the amount of M protein in the blood or urine, a 25% increase in the number of plasma cells in the bone marrow, an increase in the size or number of bone lesions, or an increase in calcium levels not explained by other conditions).

[0110] In some embodiments, the multiple myeloma or plasmacytoma is relapsed or refractory to treatment with selinexor, venetoclax, anti-CD38 antibodies, lenalinomide, bortezomib, pomalidomide, carfilzomib, elotozumab, ixazomib, melphalan, or thalidomide, or any combination thereof.

[0111] In some embodiments, the multiple myeloma is high-risk multiple myeloma. Subjects with high-risk multiple myeloma are known to relapse early and have poor prognosis and outcome. Subjects can be classified as having high-risk multiple myeloma if they have one or more of the following cytogenetic abnormalities: t(4;14)(p16;q32), t(14;16)(q32;q23), del17p, 1qAmp, t(4;14)(p16;q32) and t(14;16)(q32;q23), t(4;14)(p16;q32) and del17p, t(14;16)(q32;q23) and del17p, or t(4;14)(p16;q32), t(14;16)(q32;q23) and del17p. In some embodiments, subjects with high-risk multiple myeloma may have one or more chromosomal abnormalities including t(4;14)(p16;q32), t(14;16)(q32;q23), del17p, 1qAmp, t(4;14)(p16;q32) and t(14;16)(q32;q23), t(4;14)(p16;q32) and del17p, t(14;16)(q32;q23) and del17p; or t(4;14)(p16;q32), t(14;16)(q32;q23) and del17p, or any combination thereof.

[0112] Cytogenetic abnormalities can be detected, for example, by fluorescent in situ hybridization (FISH). In chromosomal translocations, oncogenes are translocated to the IgH region on chromosome 14q32, leading to dysregulation of these genes. t(4;14)(p16;q32) involves translocation of fibroblast growth factor receptor 3 (FGFR3) and multiple myeloma SET domain-containing protein (MMSET) (also known as WHSC1 / NSD2), and t(14;16)(q32;q23) involves translocation of MAF transcription factor C-MAF. 17p deletion (del17p) involves loss of the p53 locus.

[0113] Chromosomal rearrangements can be identified using well-known methods, such as fluorescent in situ hybridization, karyotyping, pulsed-field gel electrophoresis, or sequencing.

[0114] treatment The use of anti-BCMA antibodies for the treatment of lymphoma and multiple myeloma is mentioned in WO2002066516 and WO2010104949. Antibodies against BCMA are described, for example, in Gras MP.et al.Int Immunol.1997;7:1093-1106, WO200124811 and WO200124812. Bispecific antibodies against BCMA and CD3 are described, for example, in WO2017 / 031104. Teclistamab and talquetamab are anti-BCMA antibodies, respectively. + or GPRC5D + CD3 on multiple myeloma (MM) cells + It is a CD3 bispecific antibody developed to mobilize T cells.

[0115] The anti-BCMA / anti-CD3 antibody teclistamab (also referred to as JNJ-64007957, JNJ-957, or JNJ-7957) (described in WO 2017031104(A1), the contents of which are incorporated by reference in their entirety) was made by Janssen Pharmaceuticals. Teclistamab contains the BCMA binding arm BCMB69 and the CD3 binding arm CD3B219, the amino acid sequences of which are shown in Tables 1 and 2, respectively.

[0116] Overexpression of GPRC5D in bone marrow is associated with poor prognosis in patients with multiple myeloma (see, e.g., Atamaniuk et al., Eur. J. Clin. Invest. 42:953-960 (2012)). This exclusive expression of GPRC5D in the plasma cell lineage makes it an ideal target for anti-myeloma antibodies. Anti-GPRC5D antibodies and bispecific antibodies against GPRC5D and CD3 are described, for example, in U.S. Pat. No. 10,562,968, the contents of which are incorporated herein by reference in their entirety.

[0117] The fully humanized IgG4 anti-GPRC5D / anti-CD3 bispecific antibody talquetamab (described in U.S. Pat. No. 10,562,968, the contents of which are incorporated herein by reference in their entirety) was made by Janssen Pharmaceuticals. It was produced by recombinant Chinese hamster ovary cell culture, followed by isolation, chromatographic purification, and formulation. Talcetamab contains the GPRC5D binding arm GC5B596 and the CD3 binding arm CD3B219, whose amino acid sequences are shown in Table 3 and Table 2, respectively.

[0118] [Table 1]

[0119] [Table 2]

[0120] [Table 3]

[0121] CD3 bispecific antibodies useful in the present invention may be formulated as a pharmaceutical composition comprising about 1 mg / mL to about 200 mg / mL of the antibody, for example, about 1 mg / mL, about 5 mg / mL, about 10 mg / mL, about 15 mg / mL, about 20 mg / mL, about 25 mg / mL, about 30 mg / mL, about 35 mg / mL, about 40 mg / mL, about 45 mg / mL, about 50 mg / mL, about 60 mg / mL, about 70 mg / mL, about 80 mg / mL, about 90 mg / mL, about 100 mg / mL, about 110 mg / mL, about 120 mg / mL, or any value therebetween.

[0122] The pharmaceutical composition may include one or more excipients. In some embodiments, the one or more excipients include, but are not limited to, a buffer, a sugar, a surfactant, a chelating agent, a metal ion scavenger, or any combination thereof.

[0123] In some embodiments, the CD3 bispecific antibody is administered by intravenous injection. In some embodiments, the CD3 bispecific antibody is administered by subcutaneous injection.

[0124] The dose of CD3 bispecific antibody given to a subject with cancer, such as multiple myeloma or plasmacytoma, is an amount sufficient to alleviate or at least partially prevent the disease being treated (therapeutically effective amount), and may be from about 0.1 μg / kg to about 6000 μg / kg, for example, from about 0.3 μg / kg to about 5000 μg / kg, from about 0.1 μg / kg to about 3000 μg / kg, from about 0.2 μg / kg to about 3000 μg / kg, from about 0.3 μg / kg to about 3000 μg / kg, from about 0.6 μg / kg to about 3000 μg / kg, from about 1.2 μg / kg to about 3 000μg / kg, about 19.2μg / kg to about 3000μg / kg, about 35μg / kg to about 3000μg / kg, about 80μg / kg to about 3000μg / kg, about 100μg / kg to about 3000μg / kg, about 270μg / kg to about 3000μg / kg, about 72 0μg / kg to about 3000μg / kg, about 0.1μg / kg to about 1800μg / kg, about 0.2μg / kg to about 1800μg / kg, about 0.3μg / kg to about 1800μg / kg, about 0.6μg / kg to about 1800μg / kg, about 1.2μg / kg to about 1800 μg / kg, approximately 19.2μg / kg to approximately 1800μg / kg, approximately 35μg / kg to approximately 1800μg / kg, approximately 80μg / kg to approximately 1800μg / kg, approximately 100μg / kg to approximately 1800μg / kg, approximately 270μg / kg to approximately 1800μg / kg, approximately 720μg / kg~about 1800μg / kg, about 0.1μg / kg~about 1500μg / kg, about 0.2μg / kg~about 1500μg / kg, about 0.3μg / kg~about 1500μg / kg, about 0.6μg / kg~about 1500μg / kg, about 1.2μg / kg~about 1500μg / kg, about 19.2μg / kg to about 1500μg / kg, about 35μg / kg to about 1500μg / kg, about 80μg / kg to about 1500μg / kg, about 100μg / kg to about 1500μg / kg, about 270μg / kg to about 1500μg / kg, about 720μg / k g ~ approx. 1500 μg / kg, approx. 0.1 μg / kg ~ approx. 850 μg / kg, approx. 0.2 μg / kg ~ approx. 850 μg / kg, approx. 0.3 μg / kg ~ approx. 850 μg / kg, approx. 0.6 μg / kg ~ approx. 850 μg / kg, approx. 1.2 μg / kg ~ approx. 850 μg / kg, approx. 19.2μg / kg to about 850μg / kg, about 35μg / kg to about 850μg / kg, about 80μg / kg to about 850μg / kg, about 100μg / kg to about 850μg / kg, about 270μg / kg to about 850μg / kg, about 7 20μg / kg to about 850μg / kg, about 0.1μg / kg to about 720μg / kg, about 0.2μg / kg to about 720μg / kg, about 0.3μg / kg to about 720μg / kg, about 0.6μg / kg to about 720μg / kg, Approximately 1.2μg / kg to approximately 720μg / kg, approximately 19.2μg / kg to approximately 720μg / kg, approximately 35μg / kg to approximately 720μg / kg, approximately 80μg / kg to approximately 720μg / kg, approximately 100μg / kg to approximately 720μg / k g, about 270μg / kg to about 720μg / kg, about 720μg / kg to about 720μg / kg, about 0.1μg / kg to about 270μg / kg, about 0.2μg / kg to about 270μg / kg, about 0.3μg / kg to about 270μg / kg, about 0.6μg / kg to about 270μg / kg, about 1.2μg / kg to about 270μg / kg, about 19.2μg / kg to about 270μg / kg, about 35μg / kg to about 270μg / kg, about 80μg / kg to about 270 μg / kg, approximately 100 μg / kg to approximately 270 μg / kg, approximately 270 μg / kg to approximately 270 μg / kg, approximately 720 μg / kg to approximately 270 μg / kg, approximately 0.1 μg / kg to approximately 100 μg / kg, approximately 0.2 μg / kg to approximately 1 00 μg / kg, about 0.3 μg / kg to about 100 μg / kg, about 0.6 μg / kg to about 100 μg / kg, about 1.2 μg / kg to about 100 μg / kg, about 19.2 μg / kg to about 100 μg / kg, about 35 μg / kg to about 100 μg / kg, about 80 μg / kg to about 100 μg / kg, about 100 μg / kg to about 100 μg / kg, about 270 μg / kg to about 100 μg / kg, and about 720 μg / kg to about 100 μg / kg of antibodies. Suitable doses include, for example, about 0.1 μg / kg, about 0.2 μg / kg, about 0.3 μg / kg, about 0.6 μg / kg, about 1.2 μg / kg, about 2.4 μg / kg, about 4.8 μg / kg, about 9.6 μg / kg, about 19.2 μg / kg, about 20 μg / kg, about 35 μg / kg, about 38.4 μg / kg, about 40 μg / kg, about 50 μg / kg, about 57.6μg / kg, approximately 60μg / kg, approximately 80μg / kg, approximately 100μg / kg, approximately 120μg / kg, approximately 180μg / kg, approximately 240μg / kg, approximately 270μg / kg, approximately 300μ g / kg, approximately 720μg / kg, approximately 850μg / kg, approximately 1000μg / kg, approximately 1100μg / kg, approximately 1200μg / kg, approximately 1300μg / kg, approximately 1400μg / kg, approximately 1500 μg / kg, about 1600 μg / kg, about 1700 μg / kg, about 1800 μg / kg, about 2000 μg / kg, about 2500 μg / kg, about 3000 μg / kg, about 3500 μg / kg, about 4000 μg / kg, about 4500 μg / kg, about 5000 μg / kg, about 5500 μg / kg, about 6000 μg / kg, or any dose therebetween.

[0125] A fixed unit dose of the CD3 bispecific antibody can also be administered, e.g., at 50, 100, 200, 500, or 1000 mg, or the dose can be based on the patient's body surface area, e.g., 500, 400, 300, 250, 200, or 100 mg / m 2 Typically, 1 to 8 doses (e.g., 1, 2, 3, 4, 5, 6, 7, or 8) can be administered to treat a cancer, such as MM or plasmacytoma, although 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more doses can be given.

[0126] Administration of the CD3 bispecific antibody can be repeated after 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 5 weeks, 6 weeks, 7 weeks, 2 months, 3 months, 4 months, 5 months, 6 months, or more. Repeated courses of treatment are also possible as is administration over time. Repeated administrations ("cycles") can be with the same or different doses. For example, the CD3 bispecific antibody can be administered at a first dose at an interval of a certain number of weeks, followed by a second dose every two weeks (i.e., every other week) for a certain number of additional weeks, followed by a third dose once a week for a certain number of additional weeks.

[0127] The CD3 bispecific antibody can be administered by maintenance therapy, such as, for example, once a week for a period of six months or more. For example, the CD3 bispecific antibody can be administered at a dose of about 0.1 μg / kg to about 6000 μg / kg, e.g., about 0.2 μg / kg to about 3000 μg / kg, about 0.2 μg / kg to about 2000 μg / kg, about 0.2 μg / kg to about 1500 μg / kg, about 0.3 μg / kg to about 1500 μg / kg, about 0.6 μg / kg to about 720 μg / kg, about 1.2 μg / kg to about 270 μg / kg, about 19.2 μg / kg to about 720 μg / kg, about 35 μg / kg to about 850 μg / kg, using a single or divided dose every 24, 12, 8, 6, 4, or 2 hours, or using a combination thereof. g, or about 270 μg / kg to about 720 μg / kg of antibody, on at least one of the 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 days, or at least one of the 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 weeks, or a combination thereof, after the start of treatment.

[0128] In one embodiment, the CD3 bispecific antibody is administered intravenously in a single dose once a week. For example, the CD3 bispecific antibody is administered at a dose of about 0.1 μg / kg, about 0.2 μg / kg, about 0.3 μg / kg, about 0.6 μg / kg, about 1.2 μg / kg, about 2.4 μg / kg, about 4.8 μg / kg, about 9.6 μg / kg, about 19.2 μg / kg, about 20 μg / kg, about 35 μg / kg, about 38.4 μg / kg, about 40 μg / kg, about 50 μg / kg, about 57.6 μg / kg, about 60 μg / kg, about 80 μg / kg, about 100 μg / kg, about 120 μg / kg , about 180 μg / kg, about 240 μg / kg, about 270 μg / kg, about 300 μg / kg, about 720 μg / kg, about 850 μg / kg, about 1000 μg / kg, about 1100 μg / kg, about 1200 μg / kg, about 1300 μg / kg, about 1400 μg / kg, about 1500 μg / kg, about 1500 μg / kg, about 1600 μg / kg, about 1700 μg / kg, about 1800 μg / kg, or any dose therebetween, administered intravenously once a week.

[0129] In one embodiment, the CD3 bispecific antibody is administered intravenously in a single dose twice a week. For example, the CD3 bispecific antibody is administered at a dose of 0.1 μg / kg, about 0.2 μg / kg, about 0.3 μg / kg, about 0.6 μg / kg, about 1.2 μg / kg, about 2.4 μg / kg, about 4.8 μg / kg, about 9.6 μg / kg, about 19.2 μg / kg, about 20 μg / kg, about 35 μg / kg, about 38.4 μg / kg, about 40 μg / kg, about 50 μg / kg, about 57.6 μg / kg, about 60 μg / kg, about 80 μg / kg, about 100 μg / kg, about 120 μg / kg, The compound can be administered intravenously twice weekly at about 180 μg / kg, about 240 μg / kg, about 270 μg / kg, about 300 μg / kg, about 720 μg / kg, about 850 μg / kg, about 1000 μg / kg, about 1100 μg / kg, about 1200 μg / kg, about 1300 μg / kg, about 1400 μg / kg, about 1500 μg / kg, about 1500 μg / kg, about 1600 μg / kg, about 1700 μg / kg, about 1800 μg / kg, or any dose therebetween.

[0130] In one embodiment, the CD3 bispecific antibody is administered intravenously at a step-up (or "priming") dose, followed by a higher dose once a week. For example, the CD3 bispecific antibody can be administered intravenously at a step-up dose of about 0.1 μg / kg, about 0.2 μg / kg, about 0.3 μg / kg, about 0.6 μg / kg, about 1.2 μg / kg, about 2.4 μg / kg, about 4.8 μg / kg, about 9.6 μg / kg, about 10 μg / kg, about 19.2 μg / kg, about 20 μg / kg, or any dose therebetween, followed by a weekly intravenous dose of about 35 μg / kg, about 38.4 μg / kg, about 40 μg / kg, about 50 μg / kg, about 57.6 μg / kg, about 60 μg / kg, about 80 μg / kg, or any dose therebetween.

[0131] In one embodiment, the CD3 bispecific antibody is administered intravenously at a step-up dose, followed by a higher step-up dose, followed by a third higher dose once a week. For example, the CD3 bispecific antibody is administered intravenously at a step-up dose of about 0.1 μg / kg, about 0.2 μg / kg, about 0.3 μg / kg, about 0.6 μg / kg, about 1.2 μg / kg, about 2.4 μg / kg, about 4.8 μg / kg, about 9.6 μg / kg, about 10 μg / kg, about 19.2 μg / kg, about 20 μg / kg, or any dose therebetween, followed by a step-up dose of about 35 μg / kg, about 38.4 μg / kg, or any dose therebetween. g, about 40 μg / kg, about 50 μg / kg, about 57.6 μg / kg, about 60 μg / kg, about 80 μg / kg, or any dose therebetween, followed by weekly intravenous administration at a dose of about 80 μg / kg, about 100 μg / kg, about 120 μg / kg, about 180 μg / kg, about 240 μg / kg, about 270 μg / kg, or any dose therebetween.

[0132] In one embodiment, the CD3 bispecific antibody is administered intravenously in a step-up dose, followed by a higher step-up dose, followed by a third higher step-up dose, followed by a fourth higher dose once weekly. For example, the CD3 bispecific antibody may be administered intravenously at a step-up dose of about 0.1 μg / kg, about 0.2 μg / kg, about 0.3 μg / kg, about 0.6 μg / kg, about 1.2 μg / kg, about 2.4 μg / kg, about 4.8 μg / kg, about 9.6 μg / kg, about 10 μg / kg, about 19.2 μg / kg, about 20 μg / kg, or any dose therebetween, followed by a step-up dose of about 35 μg / kg, about 38.4 μg / kg, about 40 μg / kg, about 50 μg / kg, about 57.6 μg / kg, about 60 μg / kg, about 8 ... In some embodiments, the compound may be administered intravenously at a step-up dose of about 80 μg / kg, about 100 μg / kg, about 120 μg / kg, about 180 μg / kg, about 240 μg / kg, about 270 μg / kg, or any dose therebetween, followed by weekly intravenous administration at a dose of about 300 μg / kg, about 720 μg / kg, about 850 μg / kg, about 1000 μg / kg, about 1100 μg / kg, about 1200 μg / kg, about 1300 μg / kg, about 1400 μg / kg, about 1500 μg / kg, about 1600 μg / kg, about 1700 μg / kg, about 1800 μg / kg, or any dose therebetween.

[0133] In one embodiment, the CD3 bispecific antibody is administered subcutaneously in a single dose once a week. For example, the CD3 bispecific antibody is administered at a dose of about 0.1 μg / kg, about 0.2 μg / kg, about 0.3 μg / kg, about 0.6 μg / kg, about 1.2 μg / kg, about 2.4 μg / kg, about 4.8 μg / kg, about 9.6 μg / kg, about 19.2 μg / kg, about 20 μg / kg, about 35 μg / kg, about 38.4 μg / kg, about 40 μg / kg, about 50 μg / kg, about 57.6 μg / kg, about 60 μg / kg, about 80 μg / kg, about 100 μg / kg, about 120 μg / kg, about 180 μg / kg, about 240 μg / kg, about 270 μg / kg, about 300 μg / kg, about 4 ... The compound may be administered subcutaneously once weekly in an amount of about 720 μg / kg, about 850 μg / kg, about 1000 μg / kg, about 1100 μg / kg, about 1200 μg / kg, about 1300 μg / kg, about 1400 μg / kg, about 1500 μg / kg, about 1500 μg / kg, about 1600 μg / kg, about 1700 μg / kg, about 1800 μg / kg, about 2000 μg / kg, about 2500 μg / kg, about 3000 μg / kg, about 3500 μg / kg, about 4000 μg / kg, about 4500 μg / kg, about 5000 μg / kg, or any dose therebetween.

[0134] In one embodiment, the CD3 bispecific antibody is administered subcutaneously in a step-up dose followed by a higher dose once a week. For example, the CD3 bispecific antibody may be administered subcutaneously in a step-up dose of about 10 μg / kg, about 20 μg / kg, about 35 μg / kg, about 40 μg / kg, about 50 μg / kg, about 60 μg / kg, or any dose therebetween, followed by a dose of about 80 μg / kg, about 100 μg / kg, about 240 μg / kg, about 300 μg / kg, or any dose therebetween, subcutaneously once a week.

[0135] In one embodiment, the CD3 bispecific antibody is administered subcutaneously in a step-up dose, followed by a higher step-up dose, followed by a third higher dose once a week. For example, the CD3 bispecific antibody is administered subcutaneously in a step-up dose of about 10 μg / kg, about 20 μg / kg, about 35 μg / kg, about 40 μg / kg, about 50 μg / kg, about 60 μg / kg, or any dose therebetween, followed by a step-up dose of about 80 μg / kg, about 100 μg / kg, about 240 μg / kg, about 300 μg / kg, or any dose therebetween; This may then be administered subcutaneously once weekly at a dose of about 240 μg / kg, about 720 μg / kg, about 1100 μg / kg, about 1200 μg / kg, about 1300 μg / kg, about 1400 μg / kg, about 1500 μg / kg, about 1600 μg / kg, about 1700 μg / kg, about 1800 μg / kg, about 2000 μg / kg, about 2500 μg / kg, about 3000 μg / kg, or any dose therebetween.

[0136] In some embodiments, the CD3 bispecific antibody may be administered for a sufficient time to achieve a complete response, a stringent complete response, a very good partial response, a partial response, a minimal response, or a stable disease state, and may continue until disease progression or lack of patient benefit. Disease state may be determined by any suitable method known to one of skill in the art in light of the present disclosure, such as, for example, analysis of serum and urinary monoclonal protein concentrations, M-protein levels, sBCMA levels, BCMA levels, GPRC5D levels.

[0137] In some embodiments, the CD3 bispecific antibody is administered for a time sufficient to achieve a complete response characterized by a negative minimal residual disease (MRD) status. Negative MRD status can be determined by any suitable method known to one of skill in the art in view of the present disclosure. In some embodiments, negative MRD status is determined using next generation sequencing (NGS). In some embodiments, negative MRD status is determined within 10 -4 cells, 10 -5 cells, or 10-6 It is determined by cells.

[0138] The CD3 bispecific antibodies can also be administered prophylactically to reduce the risk of developing cancers such as multiple myeloma or plasmacytoma, delay the onset of events in the progression of the cancer, and / or reduce the risk of recurrence when the cancer goes into remission.

[0139] In some embodiments, the therapy is chimeric antigen receptor (CAR) or CAR-T therapy. Exemplary CARs that can be used in the methods of the present application are described in WO 2017 / 025038 and WO 2018 / 028647, the contents of which are incorporated herein by reference in their entireties.

[0140] In certain embodiments, the methods of the present application further comprise administering to the subject one or more anti-cancer therapies.

[0141] The one or more other anti-cancer therapies include, but are not limited to, autologous stem cell transplants (ASCT), radiation, surgery, chemotherapy drugs, CAR-T therapy, cell therapy, immunomodulatory drugs, targeted cancer therapy, and any combination thereof.

[0142] The one or more anti-cancer therapies include, but are not limited to, selinexor, belantamab mafodotin-blmf, isatuximab, venetoclax, lenalidomide, thalidomide, pomalidomide, bortezomib, carfilzomib, elotuzumab, ixazomib, melphalan, dexamethasone, vincristine, cyclophosphamide, hydroxydaunorubicin, prednisone, rituximab, imatinib, dasatinib, nilotinib, bosutiba, These may include nib, ponatinib, bafetinib, saracatinib, tozasertib, danusertib, cytarabine, daunorubicin, idarubicin, mitoxantrone, hydroxyurea, decitabine, cladribine, fludarabine, topotecan, etoposide 6-thioguanine, corticosteroids, methotrexate, 6-mercaptopurine, azacitidine, arsenic trioxide, and all-trans retinoic acid, and any combination thereof.

[0143] Thus, provided herein is a combination of an effective amount of a CD3 bispecific antibody, and an effective amount of another anti-cancer therapeutic agent, for use in treating a hematological malignancy or plasma cell proliferative disorder, e.g., MM or plasmacytoma, preferably MM or plasmacytoma that is relapsed or refractory to previous anti-cancer therapy.

[0144] As used herein, the terms and phrases "in combination," "in conjunction with," "co-delivery," and "administered together" in the context of administration of two or more therapies or components to a subject refer to simultaneous, overlapping, or subsequent administration of two or more therapies or components. "Concurrent administration" or "administered simultaneously" refers to administration of two or more therapies or components within the same treatment period. When two components are administered "within the same treatment period," they can be administered in separate compositions according to their own administration schedules, so long as the administration period of the two components ends on about the same day, or within a short period, such as within a day, a week, or a month. "Overlapping administration" refers to administration of two or more therapies or components not within the same overall treatment period, but with at least one overlapping treatment period. "Subsequent administration" refers to administration of two or more therapies or components one after the other during different treatment periods. The use of the term "in combination" does not limit the order in which the therapies or components are administered to a subject. For example, a first therapy or component may be administered prior to, concomitantly with, or simultaneously with, or following administration of a second therapy or component.

[0145] Having described the invention in general terms, embodiments of the invention are further disclosed in the following examples, which should not be construed as limiting the scope of the claims. EXAMPLES

[0146] The following examples are provided to further illustrate some of the embodiments disclosed herein and are intended to be illustrative and not limiting of the embodiments of the present disclosure.

[0147] Example 1 The objective of this study was to evaluate sBCMA in patients with relapsed and / or refractory MM who responded to teclistamab or talquetamab treatment. Serum samples for sBCMA from patients with relapsed and / or refractory MM in teclistamab and talquetamab phase 1 trials (64007957MMY1001 and 64407564MMY1001) were collected at various time points between baseline and cycle 4 or end of treatment and analyzed by electrochemiluminescence ligand binding assay. Teclistamab was administered IV once every 2 weeks (therapeutic doses ranging from 0.3 to 19.2 μg / kg) or once weekly (therapeutic doses ranging from 19.2 to 720 μg / kg) or SC once weekly (therapeutic doses ranging from 19.2 to 3000 μg / kg) for 21-day cycles. Talcetamab was administered IV once every 2 weeks (therapeutic doses ranging from 0.5 to 3.38 μg / kg) or weekly (therapeutic doses ranging from 1 to 180 μg / kg) or SC weekly (therapeutic doses ranging from 5 to 800 μg / kg) for 21-day cycles. Ninety-six patients treated with teclistamab and 99 patients treated with talquetamab had evaluable data at baseline and day 1 of cycle 3. One hundred and forty-seven patients in the teclistamab trials and 153 patients in the talquetamab trials had evaluable baseline data.

[0148] sBCMA data were quantitatively analyzed with reference to patient response, tumor burden, and cytogenetic risk, as well as PK data. Cytogenetic risk was determined by fluorescent in situ hybridization. P values ​​between patients with high and standard cytogenetic risk were calculated using an unpaired two-sample Wilcoxon test.

[0149] Response criteria are shown in Table 4 below.

[0150] [Table 4-1]

[0151] [Table 4-2]

[0152] Patients with sCR, CR, VGPR and PR were classified as responders, whereas patients with MR, SD and PD were considered as non-responders.

[0153] Results showed that teclistamab and talquetamab modulated levels of sBCMA in patients with high and low frequencies of tumor plasma cells (TPC), as well as in high- and low-risk cytogenetic groups (Figure 9). At cycle 3, the majority of responders had a decrease in sBCMA compared to baseline, 88% (50 of 57) for teclistamab and 98% (49 of 50) for talquetamab. In contrast, non-responders (progressive disease, stable disease or minimal response) showed an increase in sBCMA from baseline, 80% (33 of 41) for teclistamab and 49% (24 of 49) for talquetamab (Figures 1-3). Patients with deep responses tended to have a greater magnitude of sBCMA decrease compared to other patients (Figure 4). Soluble BCMA at baseline correlated with % bone marrow TPC (Figure 8). The majority of patients with plasmacytoma (limited data) appeared to have high sBCMA, suggesting that sBCMA may be a comprehensive marker of tumor burden (Figures 5-7). Preliminary teclistamab population pharmacokinetic analysis showed that sBCMA did not appear to affect teclistamab exposure, suggesting that sBCMA does not act as a sink for teclistamab. In conclusion, teclizumab and talquetamab induced changes in the levels of sBCMA that correlated with clinical activity, further supporting that sBCMA is a surrogate marker of myeloma tumor burden and a useful marker for response in MM patients.

[0154] Following teclistamab at RP2D, a rapid decrease in sBCMA was observed in the majority of responders (PR or better) within the first month of treatment. Compared to baseline values, the majority of responders had a decrease in sBCMA on Day 1 of Cycle 2 (40 of 59 subjects [67.8%]), and the majority of non-responders had an increase in sBCMA on Day 1 of Cycle 2 (27 of 28 subjects [96.4%]). Responders to teclistamab also showed a trend toward a decrease in sBCMA over time. On Day 1 of Cycle 4, the majority of responders had a decrease in sBCMA (63 of 72 subjects [87.5%]), and all non-responders had an increase in sBCMA (9 of 9 subjects [100%], with fewer non-responders providing data on Day 1 of Cycle 4 due to early treatment interruption. In addition, a greater decrease in sBCMA was observed in subjects with a deeper response to teclistamab (Figure 10).

[0155] Following IV or SC administration of teclistamab in Phase 1, compared to baseline values, the majority of responders had a decrease in sBCMA on Cycle 4 Day 1 (54 of 69 subjects [78.3%]) and the majority of non-responders had an increase in sBCMA on Cycle 4 Day 1 (10 of 16 subjects [62.5%]). Additionally, greater decreases in sBCMA were observed in subjects with deeper responses to teclistamab (Figure 11).

[0156] The possible effect of baseline sBCMA on teclistamab PK was investigated in a population PK analysis. Results suggested that baseline sBCMA did not affect teclistamab serum concentrations and was not a significant covariate for teclistamab PK.

[0157] Those skilled in the art will appreciate that numerous changes and modifications may be made to the preferred embodiments of the present invention, and that such changes and modifications may be made without departing from the spirit of the present invention. It is therefore intended in the appended claims to cover all such equivalent variations that fall within the true spirit and scope of the present invention.

Claims

1. 1. A method for monitoring the progression of multiple myeloma in a subject, comprising: (a) measuring the level of sBCMA in a blood sample obtained from the subject; (b) comparing the level of sBCMA to a reference sBCMA level, the reference sBCMA level being measured from a control blood sample obtained from the subject prior to the blood sample of (a) being obtained from the subject; An increase in the level of sBCMA compared to the reference sBCMA level indicates one or more of an increased tumor burden or disease progression, and a decrease in the level of sBCMA compared to the reference sBCMA level indicates one or more of a decreased tumor burden or lack of disease progression.

2. 1. A method for determining a response to a therapy for multiple myeloma in a subject, comprising: (a) measuring the level of sBCMA in a blood sample obtained from the subject following treatment with the therapy; (b) comparing the level of sBCMA to a reference sBCMA level, the reference sBCMA level being measured from a control blood sample obtained from the subject prior to treatment with the therapy; A decrease in the level of sBCMA compared to the reference sBCMA level indicates that the subject is responding to the therapy, and an increase or no change in the level of sBCMA compared to the reference sBCMA level indicates that the subject is not responding to the therapy.

3. 3. The method of claim 2, further comprising determining to treat the subject with a second therapy for multiple myeloma if the level of sBCMA indicates that the subject is not responsive to the therapy.

4. 1. A method to aid in the treatment of multiple myeloma or plasmacytoma in a subject in need thereof, comprising: (a) measuring the level of sBCMA in a blood sample obtained from the subject; (b) comparing the level of sBCMA to a reference sBCMA level to determine tumor burden in the subject; and (c) determining to administer a therapy to the subject based on the tumor burden measured in (b).

5. The subject has been treated with a therapy for multiple myeloma or plasmacytoma before the blood sample is obtained from the subject; The reference sBCMA level is measured from a control blood sample obtained from the subject before the subject is treated with the therapy, and is: (a) continuing to treat the subject with the therapy if the level of sBCMA measured in (a) of claim 4 is lower than the reference sBCMA level; or (b) if the level of sBCMA is the same as or higher than the reference sBCMA level, treating the subject with a second therapy for multiple myeloma or plasmacytoma; The method of claim 4 , further comprising determining:

6. 1. A method for assessing response to teclistamab or talquetamab in a subject with multiple myeloma or plasmacytoma, comprising: (a) measuring the level of sBCMA in a blood sample obtained from the subject following treatment with teclistamab or talquetamab; (b) comparing the level of sBCMA to a reference sBCMA level, the reference sBCMA level being measured from a control blood sample obtained from the subject prior to treatment with teclistamab or talquetamab; A decrease in the level of sBCMA compared to the reference sBCMA level indicates that the subject will respond to teclistamab or talquetamab, and an increase or no change in the level of sBCMA compared to the reference sBCMA level indicates that the subject will not respond to teclistamab or talquetamab.

7. 7. The method of claim 6, further comprising determining to treat the subject with a second therapy for multiple myeloma or plasmacytoma if the level of sBCMA indicates that the subject is not responsive to teclistamab or talquetamab.

8. 7. The method of claim 2 or 6, wherein the blood sample is obtained from the subject about 4 to 16 weeks, preferably about 4 to 12 weeks, such as 4, 5, 6, 7, 8, 9, 10, 11 or 12 weeks, after the subject has been treated with the therapy.

9. 10. The method of any one of claims 2, 4 and 6, wherein the therapy comprises a CD3 bispecific antibody.

10. 10. The method of claim 9, wherein the CD3 bispecific antibody is teclistamab or talquetamab.

11. 11. The method of claim 10, wherein the therapy comprises administering about 38-720 μg / kg per dose of teclistamab to the subject intravenously, preferably about 270-720 μg / kg per dose.

12. 11. The method of claim 10, wherein the therapy comprises administering about 80-3000 μg / kg per dose of teclistamab subcutaneously to the subject, preferably about 720-3000 μg / kg per dose.

13. 11. The method of claim 10, wherein the therapy comprises administering about 0.5-180 μg / kg per dose of talquetamab to the subject intravenously, preferably about 60-180 μg / kg per dose.

14. 11. The method of claim 10, wherein the therapy comprises administering about 5-800 μg / kg per dose of talquetamab subcutaneously to the subject, preferably about 405-800 μg / kg per dose.

15. 10. The method of claim 9, wherein the therapy is administered biweekly or weekly.

16. 8. The method of any one of claims 3, 5, and 7, wherein the second therapy comprises one or more of autologous stem cell transplant (ASCT), radiation, surgery, a chemotherapy agent, a CAR-T therapy, a cell therapy, an immunomodulatory agent, a cancer targeted therapy, or a combination thereof.

17. 10. The method of any one of claims 1, 2, 4 and 6, wherein the subject has relapsed and / or refractory multiple myeloma.

18. 7. The method according to any one of claims 1, 2, 4 and 6, wherein the blood sample is serum, whole blood or plasma, preferably serum.

19. 7. The method of any one of claims 1, 2, 4 and 6, wherein the level of sBCMA in the blood sample is measured using an electrochemiluminescence ligand binding assay, an enzyme-linked immunosorbent assay (ELISA), or mass spectrometry.

Images