Anti-EGFR / anti-4-1BB bispecific antibodies and uses thereof
Anti-EGFR/anti-4-1BB bispecific antibodies address the liver toxicity issue of monospecific anti-4-1BB antibodies by targeting both EGFR on cancer cells and 4-1BB on immune cells, enhancing immune responses and cancer treatment efficacy.
Patent Information
- Application Number
- JP2022504629
- Authority / Receiving Office
- JP · JP
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2019-07-26
- Filing Date
- 2020-07-27
- Publication Date
- 2025-09-12
- Estimated Expiration
- 2040-07-27
AI Technical Summary
Existing anti-4-1BB antibodies used for cancer treatment induce severe liver toxicity, and there is a need for multispecific antibodies that can target both cancer cells and immune cells to enhance immune responses without such toxicity.
Development of anti-EGFR/anti-4-1BB bispecific antibodies that specifically recognize and bind to EGFR on cancer cells and 4-1BB on immune cells, activating 4-1BB signaling only in the presence of EGFR-expressing cells, thereby reducing liver toxicity and enhancing immune responses.
The bispecific antibodies effectively activate immune cells to enhance cancer treatment efficacy while significantly reducing liver toxicity compared to monospecific anti-4-1BB antibodies.
Smart Images

Figure 0007738545000037 
Figure 0007738545000038 
Figure 0007738545000039
Abstract
Description
[Technical Field]
[0001] Anti-4-1BB / anti-EGFR bispecific antibodies and pharmaceutical compositions, and methods of using same for treating and / or preventing cancer, are provided. [Background technology]
[0002] The 4-1BB protein is a member of the TNF receptor superfamily (TNFRSF) and a costimulatory molecule expressed after activation of both innate and adaptive immune cells. 4-1BB plays an important role in modulating the activity of various immune cells. 4-1BB agonists enhance immune cell proliferation and survival, cytokine secretion, and CD8 T cell cytolytic activity. Many other studies have shown that activation of 4-1BB enhances immune responses and eliminates tumors in mice. This suggests that 4-1BB is a promising target molecule in cancer immunology. Despite their antitumor effects, anti-4-1BB antibodies have induced severe liver toxicity in clinical applications.
[0003] The EGFR protein is a transmembrane protein that is a receptor for members of the epidermal growth factor family (EGF family) of extracellular protein ligands and is involved in various tumor-related mechanisms. EGFR is a typical receptor tyrosine kinase (RTK) that is present on the cell surface and thereby induces cancer cell proliferation, invasion, angiogenesis, etc.
[0004] Meanwhile, multispecific antibodies that target two or more antigens have been developed in a variety of types and forms, and are expected to be new drug antibodies with superior therapeutic effects compared to monoclonal antibodies.
[0005] Therefore, for more effective cancer therapy, it is necessary to develop multispecific antibodies that can recognize two different antigens, one present on cancer cells and the other present on other cells, such as immune cells. Summary of the Invention
[0006] technical challenges In one embodiment, (1) an anti-EGFR antibody or antigen-binding fragment thereof as an EGFR targeting moiety, which is capable of specifically recognizing and / or specifically binding to an EGFR protein; and (2) An anti-4-1BB antibody or an antigen-binding fragment thereof as a 4-1BB targeting moiety, which is capable of specifically recognizing and / or specifically binding to the 4-1BB protein. The present invention provides an anti-EGFR / anti-4-1BB bispecific antibody comprising:
[0007] Another embodiment provides a pharmaceutical composition comprising the bispecific antibody. The pharmaceutical composition may further comprise a pharmaceutically acceptable carrier. The pharmaceutical composition may be used to treat and / or prevent cancer and / or enhance immune responses.
[0008] Another embodiment provides a pharmaceutical composition for treating and / or preventing cancer and / or enhancing an immune response, the composition comprising a bispecific antibody.
[0009] Another embodiment provides a method for treating and / or preventing cancer in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of a bispecific antibody or pharmaceutical composition. The method may further comprise the step of identifying the subject in need of cancer treatment and / or prevention prior to the administering step.
[0010] Another embodiment provides a method of enhancing an immune response in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of a bispecific antibody or pharmaceutical composition. The method may further comprise the step of identifying the subject in need of an enhanced immune response prior to the administering step.
[0011] Another embodiment provides the use of a bispecific antibody or pharmaceutical composition in the treatment and / or prevention of cancer.Another embodiment provides the use of a bispecific antibody in the preparation of a medicament for treating and / or preventing cancer.
[0012] Another embodiment provides the use of a bispecific antibody or pharmaceutical composition in enhancing an immune response.Another embodiment provides the use of a bispecific antibody in the preparation of a medicament for enhancing an immune response.
[0013] Certain embodiments provide polynucleotides encoding bispecific antibodies.
[0014] Certain embodiments provide a recombinant vector comprising the polynucleotide. The recombinant vector can be used as an expression vector for the polynucleotide encoding the bispecific antibody.
[0015] Another embodiment provides a cell comprising a polynucleotide encoding the bispecific antibody. The cell may be a recombinant cell transfected with a recombinant vector comprising the polynucleotide.
[0016] Another embodiment provides a method of preparing a bispecific antibody, the method comprising expressing a polynucleotide in a cell. The step of expressing the polynucleotide may be carried out by culturing a cell containing the polynucleotide (e.g., in a recombinant vector) under conditions that allow for expression of the polynucleotide.
[0017] technical solution The present disclosure relates to bispecific antibodies, each of which comprises an antibody specific for a tumor-associated antigen (TAA; EGFR) and an antibody specific for 4-1BB, and uses thereof. These bispecific antibodies activate 4-1BB signaling and boost potent immune cells only in the presence of EGFR-expressing cells. Due to the specific EGFR-mediated immune response, the use of bispecific antibodies is expected to significantly reduce liver toxicity compared to the 4-1BB monoclonal antibody.
[0018] The present disclosure provides anti-EGFR / anti-4-1BB bispecific antibodies and uses thereof, wherein the anti-EGFR / anti-4-1BB bispecific antibodies are (1) an anti-EGFR antibody or antigen-binding fragment thereof as an EGFR targeting moiety, which is capable of specifically recognizing and / or specifically binding to the EGFR protein; and (2) An anti-4-1BB antibody or an antigen-binding fragment thereof as a 4-1BB targeting moiety, which is capable of specifically recognizing and / or specifically binding to the 4-1BB protein. may include: DETAILED DESCRIPTION OF THE INVENTION
[0019] Hereinafter, the present invention will be described in more detail.
[0020] definition As used herein, "consisting of a sequence," "consisting essentially of a sequence," or "comprising a sequence" may refer to any case in which the sequence is included, but may not be intended to exclude cases in which additional sequences other than the sequence are included.
[0021] As used herein, the terms "a protein or polypeptide comprising or consisting of an amino acid sequence identified by a SEQ ID NO" and "a gene or polynucleotide comprising or consisting of a nucleic acid sequence identified by a SEQ ID NO" may refer to a protein (or polypeptide) or gene (or polynucleotide) consisting essentially of an amino acid sequence or nucleic acid sequence having at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the amino acid sequence or nucleic acid sequence that maintains its inherent activity and / or function.
[0022] As used herein, the term "antibody" encompasses a wide variety of biochemically distinguishable polypeptide classes. Those skilled in the art will recognize that heavy chains are classified as gamma, mu, alpha, delta, or epsilon (γ, μ, α, δ, ε), with some subclasses (e.g., γ1-γ4) between them, and light chains are classified as kappa (κ) or lambda (λ). It is the nature of this chain that determines the "class" of an antibody: IgG, IgM, IgA IgG, or IgE, respectively. Immunoglobulin subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgG5, etc., have been well characterized and are known to confer functional specialization.
[0023] An intact antibody contains two full-length light chains and two full-length heavy chains, each light chain linked to a heavy chain by a disulfide bond. Antibodies have heavy chain and light chain constant regions. The heavy chain constant region is of gamma (γ), mu (μ), alpha (α), delta (δ), or epsilon (ε) type, which may be further classified as gamma 1 (γ1), gamma 2 (γ2), gamma 3 (γ3), gamma 4 (γ4), alpha 1 (α1), or alpha 2 (α2). The light chain constant region is of kappa (κ) or lambda (λ) type.
[0024] The term "heavy chain" refers to the V of the variable region that contains sufficient amino acid sequence to confer specificity for an antigen. H and three constant regions, C H1 , C H2 , and C H3 The term "light chain" refers to a full-length heavy chain or a fragment thereof, including the V region of the variable region, which contains sufficient amino acid sequence to confer specificity for an antigen. L and the constant region C L and a full-length light chain or a fragment thereof.
[0025] The term "complementarity determining region (CDR)" refers to an amino acid sequence found within the hypervariable region of an immunoglobulin heavy or light chain. The heavy and light chains may each contain three CDRs (CDRH1, CDRH2, and CDRH3; and CDRL1, CDRL2, and CDRL3). CDRs may provide residues that play an important role in antibody binding to an antigen or epitope. Those skilled in the art are familiar with the terms "specifically binding to" or "specifically recognized," which refer to an antibody and antigen that interact specifically with each other to result in immunological activity.
[0026] In the present disclosure, antibodies may include, but are not limited to, polyclonal or monoclonal antibodies; and / or human antibodies, humanized antibodies, animal (e.g., mouse, rabbit, etc.) derived antibodies, or chimeric antibodies (e.g., mouse-human chimeric antibodies).
[0027] Animal-derived antibodies produced by immunizing animals with a desired antigen generally can induce immune rejection when administered to humans for therapeutic purposes. To prevent this, chimeric antibodies have been developed. Chimeric antibodies are formed by replacing the constant region of an animal-derived antibody, which is responsible for anti-isotype reactions, with the constant region of a human antibody using genetic engineering techniques. Although chimeric antibodies have significantly improved anti-isotype reactions compared to animal-derived antibodies, they still contain animal-derived amino acids in their variable regions, and therefore still contain potential side effects resulting from anti-idiotype reactions. Thus, humanized antibodies have been developed to address these side effects. Humanized antibodies are produced by grafting the CDRs (complementarity-determining regions), which play an important role in antigen binding, from the variable regions of a chimeric antibody onto a human antibody framework.
[0028] As used herein, the term "antigen-binding fragment" refers to a fragment derived from an intact immunoglobulin structure and including a portion capable of binding to an antigen, such as a CDR. For example, an antigen-binding fragment may be, but is not limited to, an scFv, (scFv)2, Fab, Fab', or F(ab')2. In the present disclosure, an antigen-binding fragment may be, for example, a fragment derived from an antibody including at least one complementarity-determining region selected from the group consisting of scFv, (scFv)2, scFv-Fc, Fab, Fab', and F(ab')2.
[0029] Among the antigen-binding fragments, Fab contains the variable regions of the light and heavy chains, the constant region of the light chain, and the first constant region of the heavy chain (C H1 ) and has one antigen-binding site.
[0030] Fab' is the heavy chain C H1 F(ab')2 antibodies differ from Fab in that they have a hinge region containing one or more cysteine residues at the C-terminus of the domain. F(ab')2 antibodies are formed via disulfide bonds between the cysteine residues in the hinge region of Fab'.
[0031] An Fv is a minimal antibody fragment containing only the heavy-chain variable region and the light-chain variable region, and recombinant methods for producing Fv fragments are well known in the related art. A two-chain Fv may have a structure in which the heavy-chain variable region is linked to the light-chain variable region by a non-covalent bond, and a single-chain Fv (scFv) may generally have a dimeric structure, as in a two-chain Fv, in which the heavy-chain variable region and the light-chain variable region are covalently linked via a peptide linker or directly linked to each other at their C-termini.
[0032] Antigen-binding fragments may be obtained using proteases (for example, whole antibodies may be digested with papain to obtain Fab fragments or with pepsin to obtain F(ab')2 fragments) or may be prepared by recombinant methods.
[0033] Immunoglobulin (e.g., human immunoglobulin) or antibody molecules of the present disclosure can be of any type (e.g., IgG, IgE, IgM, IgD, IgA, IgY, etc.), class (e.g., IgG1, IgG2, IgG3, IgG4, IgG5, IgA1, IgA2, etc.), or subclass of immunoglobulin molecule.
[0034] Within an antibody or antibody fragment, portions excluding the CDRs or variable regions (e.g., constant regions) may be derived from a human antibody, and in particular, portions excluding the CDRs or variable regions may be derived from IgG, IgA, IgD, IgE, IgM, or IgY, e.g., IgG1, IgG2, IgG3, or IgG4.
[0035] The antibody or antigen-binding fragment may be chemically or recombinantly synthesized (non-naturally occurring).
[0036] 4-1BB targeting part The anti-EGFR / anti-4-1BB bispecific antibody may comprise an anti-4-1BB antibody or an antigen-binding fragment thereof as the 4-1BB targeting moiety.
[0037] The term "4-1BB," also referred to as CD137 or TNFRSF9 (TNF receptor superfamily member 9), is a member of the TNF receptor superfamily (TNFRSF) and a costimulatory molecule expressed after activation of immune cells, both innate and adaptive. 4-1BB plays an important role in modulating the activity of various immune cells. As used herein, 4-1BB may be derived from a mammal, for example, a human (Homo sapiens) (NCBI accession number: NP_001552.2). For example, the human 4-1BB protein (NP_001552.2) has the following amino acid sequence (SEQ ID NO: 89): 1 mgnscyniva tlllvlnfer trslqdpcsn cpagtfcdnn rnqicspcpp nsfssaggqr 61 tcdicrqckg vfrtrkecss tsnaecdctp gfhclgagcs mceqdckqgq eltkkgckdc 121 cfgtfndqkr gicrpwtncs ldgksvlvng tkerdvvcgp spadlspgas svtppapare 181 pghspqiisf flaltstall fllffltlrf svvkrgrkkl lyifkqpfmr pvqttqeedg 241 cscrfpeeee ggcel It can be expressed as follows:
[0038] In one embodiment, the anti-4-1BB antibody or antigen-binding fragment thereof CDR (complementarity determining region)-H1 (H-CDR1) comprising the amino acid sequence of SEQ ID NO: 1, 2, or 3; H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, 5, or 6; H-CDR3 comprising the amino acid sequence of SEQ ID NO: 7, 8, 9, 10, or 11; L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12 or 13; L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14 or 15; and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16 or 17 may include:
[0039] The amino acid sequences of the CDRs of anti-4-1BB antibodies or antigen-binding fragments are exemplified in Table 1. TIFF0007738545000001.tif87170
[0040] For example, the anti-4-1BB antibody or antigen-binding fragment thereof may be H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 7, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16; H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 8, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16; H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 9, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16; H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 7, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 13, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 15, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 17; H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 8, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 13, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 15, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 17; H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 9, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 13, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 15, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 17; H-CDR1 comprising the amino acid sequence of SEQ ID NO: 2, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 5, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 10, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16; H-CDR1 comprising the amino acid sequence of SEQ ID NO: 2, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 5, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 10, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 13, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 15, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 17; H-CDR1 comprising the amino acid sequence of SEQ ID NO: 3, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 6, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 11, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16; or H-CDR1 comprising the amino acid sequence of SEQ ID NO: 3, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 6, H-CDR3 comprising the amino acid sequence of SEQ ID NO: 11, L-CDR1 comprising the amino acid sequence of SEQ ID NO: 13, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 15, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 17 may include:
[0041] In another embodiment, the anti-4-1BB antibody or antigen-binding fragment thereof may comprise a heavy chain variable region comprising an H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, 2, or 3, an H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, 5, or 6, and an H-CDR3 comprising the amino acid sequence of SEQ ID NO: 7, 8, 9, 10, or 11; and a light chain variable region comprising an L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12 or 13, an L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14 or 15, and an L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16 or 17.
[0042] In another embodiment, the anti-4-1BB antibody or antigen-binding fragment thereof may comprise a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29; and a light chain variable region comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 30, 31, 32, 33, 34, or 88.
[0043] The amino acid sequences of the variable regions of anti-4-1BB antibodies or antigen-binding fragments are exemplified in Table 2. TIFF0007738545000002.tif236170
[0044] For example, the anti-4-1BB antibody or antigen-binding fragment thereof may be a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30; a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 31; a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 32; a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 33; a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 34; or A heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 88. may include:
[0045] The framework amino acid sequences of the variable regions of anti-4-1BB antibodies or antigen-binding fragments are exemplified in Table 3. TIFF0007738545000003.tif227170
[0046] In another embodiment, the anti-4-1BB antibody or antigen-binding fragment thereof may comprise a heavy chain comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 56, 57, 58, 59, 60, or 61; and a light chain comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 62, 63, or 64.
[0047] For example, the anti-4-1BB antibody or antigen-binding fragment thereof may be a heavy chain comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 56, 57, 58, 59, 60, or 61; and a light chain comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 62; a heavy chain comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 56, 57, 58, 59, 60, or 61; and a light chain comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 63; or a heavy chain comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 56, 57, 58, 59, 60, or 61; and a light chain comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 64. may include:
[0048] In another embodiment, the anti-4-1BB antibody or antigen-binding fragment thereof is a heavy chain variable region comprising an H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, 2, or 3, an H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, 5, or 6, and an H-CDR3 comprising the amino acid sequence of SEQ ID NO: 7, 8, 9, 10, or 11; and a light chain variable region comprising L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12 or 13, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14 or 15, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16 or 17; Including, The heavy chain variable region and the light chain variable region can be linked to each other in any order, either directly (i.e., without a linker) or via a peptide linker. It may be an scFv (single chain variable fragment).
[0049] For example, the anti-4-1BB scFv is a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29; and a light chain variable region comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 30, 31, 32, 33, 34, or 88; and In this case, the heavy chain variable region and the light chain variable region may be linked to each other in any order, either directly or via a peptide linker.
[0050] For example, the anti-4-1BB scFv is a heavy chain variable region comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 24, 25, 26, 27, 28, or 29; and a light chain variable region comprising, or consisting essentially of, SEQ ID NO: 33; a heavy chain variable region comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 24, 25, 26, 27, 28, or 29; and a light chain variable region comprising, or consisting essentially of, SEQ ID NO: 34; or A heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 24, 25, 26, 27, 28, or 29, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 88. and In this case, the heavy chain variable region and the light chain variable region may be linked to each other in any order, either directly or via a peptide linker.
[0051] In the present disclosure, an anti-4-1BB scFv comprises a heavy chain variable region and a light chain variable region in any order. For example, an anti-4-1BB scFv may comprise a light chain variable region and a heavy chain variable region in the N- to C-terminal direction. Alternatively, an anti-4-1BB scFv may comprise a heavy chain variable region and a light chain variable region in the N- to C-terminal direction.
[0052] EGFR targeting moiety The anti-EGFR / anti-4-1BB bispecific antibody may comprise an anti-EGFR antibody or an antigen-binding fragment thereof as the EGFR targeting moiety.
[0053] "EGFR (epidermal growth factor receptor; also called ErbB-1, or in humans, HER1)" is a transmembrane protein that is a receptor for members of the epidermal growth factor family (EGF family) of extracellular protein ligands. Epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2 / neu (ErbB-2), Her3 (ErbB-3), and Her4 (ErbB-4). In many cancer types, mutations that can affect EGFR expression or activity could result in cancer. For example, the EGFR protein can be the polypeptide deposited under GenBank Accession Nos. NP_001333826.1, NP_001333827.1, etc., encoded by the nucleotide sequence (mRNA) deposited under GenBank Accession Nos. NM_001346897.2, NM_001346898.2, etc., respectively.
[0054] In one embodiment, the anti-EGFR antibody may be cetuximab. The antigen-binding region of the anti-EGFR antibody that recognizes EGFR as an antigen may be scFv, (scFv)2, Fab, Fab', or F(ab')2 of the anti-EGFR antibody cetuximab.
[0055] The anti-EGFR antibody or antigen-binding fragment thereof can be an anti-EGFR antibody or antigen-binding fragment thereof comprising the six CDRs of cetuximab.
[0056] In certain embodiments, the anti-EGFR antibody or antigen-binding fragment of the anti-EGFR antibody (e.g., scFv, (scFv)2, Fab, Fab', or F(ab')2) can be cetuximab or an antigen-binding fragment thereof, or a variant thereof.
[0057] For example, the anti-EGFR antibody or antigen-binding fragment thereof may be H-CDR1 comprising the amino acid sequence of SEQ ID NO: 65; H-CDR2 comprising the amino acid sequence of SEQ ID NO: 66; H-CDR3 comprising the amino acid sequence of SEQ ID NO: 67; L-CDR1 comprising the amino acid sequence of SEQ ID NO: 68; L-CDR2 comprising the amino acid sequence of SEQ ID NO: 69; and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 70 may include:
[0058] The amino acid sequences of the CDRs of anti-EGFR antibodies or antigen-binding fragments are exemplified in Table 4. TIFF0007738545000004.tif45170
[0059] In another embodiment, the anti-EGFR antibody or antigen-binding fragment thereof may comprise a heavy chain variable region comprising an H-CDR1 comprising the amino acid sequence of SEQ ID NO: 65, an H-CDR2 comprising the amino acid sequence of SEQ ID NO: 66, and an H-CDR3 comprising the amino acid sequence of SEQ ID NO: 67; and a light chain variable region comprising an L-CDR1 comprising the amino acid sequence of SEQ ID NO: 68, an L-CDR2 comprising the amino acid sequence of SEQ ID NO: 69, and an L-CDR3 comprising the amino acid sequence of SEQ ID NO: 70.
[0060] In another embodiment, the anti-EGFR antibody or antigen-binding fragment thereof may comprise a heavy chain variable region comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 71 and a light chain variable region comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 72.
[0061] The amino acid sequences of the variable regions of anti-EGFR antibodies or antigen-binding fragments are exemplified in Table 5. TIFF0007738545000005.tif73170
[0062] In another embodiment, the anti-EGFR antibody or antigen-binding fragment thereof may comprise a heavy chain comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 73 or 74; and a light chain comprising, or consisting essentially of, the amino acid sequence of SEQ ID NO: 75.
[0063] In another embodiment, the anti-EGFR antibody or antigen-binding fragment thereof a heavy chain variable region comprising an H-CDR1 comprising the amino acid sequence of SEQ ID NO: 65, an H-CDR2 comprising the amino acid sequence of SEQ ID NO: 66, and an H-CDR3 comprising the amino acid sequence of SEQ ID NO: 67; and A light chain variable region comprising L-CDR1 comprising the amino acid sequence of SEQ ID NO: 68, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 69, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 70. Including, The heavy chain variable region and the light chain variable region can be linked to each other in any order, either directly (i.e., without a linker) or via a peptide linker. It may be an scFv (single chain variable fragment).
[0064] In another embodiment, the anti-EGFR antibody or antigen-binding fragment thereof a heavy chain variable region comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 71; and a light chain variable region comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 72 Including, The heavy chain variable region and the light chain variable region can be linked to each other in any order, either directly or via a peptide linker. It may be an scFv (single chain variable fragment).
[0065] In the present disclosure, an anti-EGFR scFv comprises a heavy chain variable region and a light chain variable region in any order. For example, an anti-EGFR scFv may comprise a light chain variable region and a heavy chain variable region in the N- to C-terminal direction. Alternatively, an anti-EGFR scFv may comprise a heavy chain variable region and a light chain variable region in the N- to C-terminal direction.
[0066] bispecific antibody The present disclosure provides: (1) an anti-EGFR antibody or antigen-binding fragment thereof as an EGFR targeting moiety, which is capable of specifically recognizing and / or specifically binding to the EGFR protein; and (2) An anti-4-1BB antibody or an antigen-binding fragment thereof as a 4-1BB targeting moiety, which is capable of specifically recognizing and / or specifically binding to the 4-1BB protein. The present invention provides an anti-EGFR / anti-4-1BB bispecific antibody comprising:
[0067] Anti-EGFR / anti-4-1BB bispecific antibodies may activate 4-1BB signaling only when crosslinked by EGFR-expressing tumor cells. In addition, the anti-4-1BB antibody or antigen-binding fragment thereof contained within the bispecific antibody may be characterized by localizing and / or activating only within the tumor microenvironment (TME) and / or exhibiting significantly reduced liver toxicity compared to existing anti-4-1BB antibodies, while maintaining immune response enhancement and / or tumor therapeutic efficacy.
[0068] In certain embodiments, a bispecific antibody may comprise a full-length anti-EGFR antibody and an antigen-binding fragment (e.g., scFv) of an anti-4-1BB antibody, in which case the antigen-binding fragment of the anti-4-1BB antibody may be linked to the N-terminus, C-terminus, or both of the full-length anti-EGFR antibody, either directly or via a peptide linker. In another embodiment, a bispecific antibody may comprise a full-length anti-4-1BB antibody and an antigen-binding fragment (e.g., scFv) of an anti-EGFR antibody, in which case the antigen-binding fragment of the anti-EGFR antibody may be linked to the N-terminus, C-terminus, or both of the full-length anti-4-1BB antibody, either directly or via a peptide linker.
[0069] In certain embodiments, the scFv contained in the bispecific antibody can comprise a heavy chain variable region and a light chain variable region in any order. For example, the scFv contained in the bispecific antibody can comprise a light chain variable region and a heavy chain variable region in N- to C-terminal order, optionally with a peptide linker between them; alternatively, the scFv contained in the bispecific antibody can comprise a heavy chain variable region and a light chain variable region in N- to C-terminal order, optionally with a peptide linker between them.
[0070] When a bispecific antibody comprises a full-length anti-EGFR antibody and an anti-4-1BB scFv, the bispecific antibody is (i) in the N-terminal to C-terminal direction, heavy chain of an anti-EGFR antibody, Optionally, a peptide linker (first peptide linker), and Anti-4-1BB scFv a first polypeptide comprising: (ii) a second polypeptide comprising the light chain of an anti-EGFR antibody; and In this case, the anti-4-1BB scFv is composed of the following in the N-terminal to C-terminal direction: the light chain variable region of an anti-4-1BB antibody; Optionally, a peptide linker (second peptide linker), and Heavy chain variable region of anti-4-1BB antibody may include:
[0071] Alternatively, the bispecific antibody may comprise: (i) in the N-terminal to C-terminal direction, anti-4-1BB scFv, Optionally, a peptide linker (first peptide linker), and Anti-EGFR antibody heavy chain a first polypeptide comprising: (ii) a second polypeptide comprising the light chain of an anti-EGFR antibody; and The anti-4-1BB scFv is composed of the following in the N-terminal to C-terminal direction: the light chain variable region of an anti-4-1BB antibody; Optionally, a peptide linker (second peptide linker), and Heavy chain variable region of anti-4-1BB antibody may include:
[0072] Alternatively, the bispecific antibody may comprise: (i) in the N-terminal to C-terminal direction, heavy chain of an anti-EGFR antibody, Optionally, a peptide linker (first peptide linker), and Anti-4-1BB scFv a first polypeptide comprising: (ii) a second polypeptide comprising the light chain of an anti-EGFR antibody; and The anti-4-1BB scFv is composed of the following in the N-terminal to C-terminal direction: a heavy chain variable region of an anti-4-1BB antibody; Optionally, a peptide linker (second peptide linker), and Light chain variable region of anti-4-1BB antibody may include:
[0073] Alternatively, the bispecific antibody may comprise: (i) in the N-terminal to C-terminal direction, anti-4-1BB scFv, Optionally, a peptide linker (first peptide linker), and Anti-EGFR antibody heavy chain a first polypeptide comprising: (ii) a second polypeptide comprising the light chain of an anti-EGFR antibody; and The anti-4-1BB scFv is composed of the following in the N-terminal to C-terminal direction: a heavy chain variable region of an anti-4-1BB antibody; Optionally, a peptide linker (second peptide linker), and Light chain variable region of anti-4-1BB antibody may include:
[0074] When the bispecific antibody comprises a full-length anti-4-1BB antibody and an anti-EGFR scFv, the bispecific antibody is (i) in the N-terminal to C-terminal direction, the heavy chain of an anti-4-1BB antibody, Optionally, a peptide linker (first peptide linker), and Anti-EGFR scFv a first polypeptide comprising: (ii) a second polypeptide comprising the light chain of an anti-4-1BB antibody; and In this case, the anti-EGFR scFv is arranged in the N-terminal to C-terminal direction as follows: the light chain variable region of an anti-EGFR antibody; Optionally, a peptide linker (second peptide linker), and Heavy chain variable region of anti-EGFR antibody may include:
[0075] Alternatively, the bispecific antibody may comprise: (i) in the N-terminal to C-terminal direction, anti-EGFR scFv, Optionally, a peptide linker (first peptide linker), and Anti-4-1BB antibody heavy chain a first polypeptide comprising: (ii) a second polypeptide comprising the light chain of an anti-4-1BB antibody; In this case, the anti-EGFR scFv is arranged in the N-terminal to C-terminal direction as follows: the light chain variable region of an anti-EGFR antibody; Optionally, a peptide linker (second peptide linker), and Heavy chain variable region of anti-EGFR antibody may include:
[0076] Alternatively, the bispecific antibody may comprise: (i) in the N-terminal to C-terminal direction, the heavy chain of an anti-4-1BB antibody, Optionally, a peptide linker (first peptide linker), and Anti-EGFR scFv a first polypeptide comprising: (ii) a second polypeptide comprising the light chain of an anti-4-1BB antibody; In this case, the anti-EGFR scFv may comprise, in the N-terminal to C-terminal direction: a heavy chain variable region of an anti-EGFR antibody; Optionally, a peptide linker (second peptide linker), and Light chain variable region of anti-EGFR antibody may include:
[0077] Alternatively, the bispecific antibody may comprise: (i) in the N-terminal to C-terminal direction, anti-EGFR scFv, Optionally, a peptide linker (first peptide linker), and Anti-4-1BB antibody heavy chain a first polypeptide comprising: (ii) a second polypeptide comprising the light chain of an anti-4-1BB antibody; In this case, the anti-EGFR scFv may comprise, in the N-terminal to C-terminal direction: a heavy chain variable region of an anti-EGFR antibody; Optionally, a peptide linker (second peptide linker), and Light chain variable region of anti-EGFR antibody may include:
[0078] The first peptide linker and the second peptide linker may independently be present or absent and may be the same as or different from each other in the bispecific antibody.
[0079] In another embodiment, both the EGFR targeting moiety and the 4-1BB targeting moiety contained within the bispecific antibody can be full-length antibodies or antigen-binding fragments comprising heavy chain CDRs, light chain CDRs, or a combination thereof, linked to each other directly or via a peptide linker.
[0080] Given that each of the antibodies can bind to both 4-1BB (such as human 4-1BB) and EGFR (such as human EGFR), the CDR sequences, or V H (heavy chain variable region) sequence, and V LThe (light chain variable region) sequences can be "mixed and matched" to create other anti-EGFR / anti-4-1BB binding bispecific molecules.
[0081] Peptide Linker For high antibody purity, the bispecific antibody may comprise a peptide linker (first peptide linker) between the heavy chain and the scFv in the first polypeptide, and / or a peptide linker (second peptide linker) between the heavy chain variable region and the light chain variable region in the scFv.
[0082] As used herein, the term "peptide linker" may refer to an oligopeptide containing 1 to 100 amino acids, particularly 2 to 50 amino acids, each of which may be any type of amino acid without any limitations. Any conventional peptide linker may be used with or without appropriate modifications suitable for a specific purpose. In specific embodiments, the peptide linker may contain, for example, Gly, Asn, and / or Ser residues, and / or may contain neutral amino acids such as Thr and / or Ala. Amino acid sequences suitable for peptide linkers may be known in the relevant technical field. The length of the peptide linker may be appropriately determined within such limits so that the function of the polypeptide and / or scFv is not affected. For example, the peptide linker can be formed by including a total of about 1 to about 100 amino acids, about 2 to about 50 amino acids, or about 5 to about 25 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) amino acids, each of which is independently selected from the group consisting of Gly, Asn, Ser, Thr, and Ala. In one embodiment, the peptide linker is m S l ) n (m, l, and n are "G", "S", and "(G m S l)" independently selected from the integers of about 1 to about 10, particularly 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In one embodiment, the peptide linker can be, but is not limited to, the amino acids (GGGGS), (GGGGS), (GGGGS), or (GS).
[0083] medical use Medical uses of bispecific antibodies are provided for enhancing immune responses and / or treating and / or preventing cancer.
[0084] More specifically, embodiments provide pharmaceutical compositions comprising the bispecific antibody as an active ingredient. The pharmaceutical composition may further comprise a pharmaceutically acceptable carrier. The pharmaceutical composition may be used to enhance immune responses and / or treat and / or prevent cancer.
[0085] Another embodiment provides a pharmaceutical composition for treating and / or preventing cancer, the composition comprising a bispecific antibody as an active ingredient.
[0086] Another embodiment provides a method for treating and / or preventing cancer in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of a bispecific antibody or pharmaceutical composition. The method may further comprise the step of identifying the subject in need of cancer treatment and / or prevention prior to the administering step.
[0087] Another embodiment provides the use of a bispecific antibody or pharmaceutical composition in the treatment and / or prevention of cancer.Another embodiment provides the use of a bispecific antibody in the preparation of a medicament for treating and / or preventing cancer.
[0088] In some embodiments, the cancer may be characterized by expression of EGFR or overexpression of EGFR (compared to normal).
[0089] Another embodiment provides a pharmaceutical composition for enhancing an immune response, the composition comprising a bispecific antibody as an active ingredient.
[0090] Another embodiment provides a method of enhancing an immune response in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of a bispecific antibody or pharmaceutical composition. The method may further comprise the step of identifying the subject in need of an enhanced immune response prior to the administering step.
[0091] Another embodiment provides the use of a bispecific antibody or pharmaceutical composition in enhancing an immune response.Another embodiment provides the use of a bispecific antibody in the preparation of a medicament for enhancing an immune response.
[0092] In some embodiments, the bispecific antibody or pharmaceutical composition may enhance an immune response conditional on the presence of EGFR. For example, in a method of enhancing an immune response, a subject may have EGFR-expressing or EGFR-overexpressing cells (e.g., EGFR-expressing or EGFR-overexpressing cancer cells).
[0093] The cancer to be prevented and / or treated by the bispecific antibody or pharmaceutical composition may be associated with 4-1BB and / or EGFR, particularly EGFR-expressing or EGFR-overexpressing cancers. The cancer may be selected from solid cancers and hematological cancers. The cancer may be, but is not limited to, one or more cancers selected from the group consisting of breast cancer, colon cancer, gastric cancer, lung cancer (e.g., lung squamous cell carcinoma, small cell lung cancer, non-small cell lung cancer, lung adenocarcinoma), peritoneal cancer, skin cancer, squamous cell carcinoma, melanoma of the skin or eye, rectal cancer, perianal cancer, esophageal cancer, small intestine tumor, endocrine gland cancer, parathyroid cancer, adrenal cancer, soft tissue sarcoma, urethral cancer, chronic or acute leukemia, lymphocytic lymphoma, liver cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatocellular adenoma, colorectal cancer, endometrial or uterine cancer, salivary gland tumor, kidney cancer, cervical cancer, prostate cancer, vulvar cancer, thyroid cancer, head and neck cancer, brain cancer, bile duct cancer, gallbladder cancer, etc. The cancer may be a primary cancer or a metastatic cancer.
[0094] As used herein, the term "preventing and / or treating cancer" may refer to cancer cell death, inhibiting cancer cell proliferation, alleviating symptoms associated with cancer, inhibiting cancer metastasis, and the like.
[0095] As used herein, the term "enhanced immune response" may refer to any enhancement of immune response associated with 4-1BB, such as activation of 4-1BB signaling, activation of 4-1BB-induced signals (e.g., but not limited to, activation of 4-1BB-induced NF-kB signaling, increased cytokine release, killing of target cells by immune cells such as T cells, etc.). In some embodiments, the enhancement of immune response by the bispecific antibodies provided by the present disclosure may occur in the presence of EGFR.
[0096] In addition to the bispecific antibody as an active ingredient, the pharmaceutical composition may further comprise a pharmaceutically acceptable carrier, diluent, and / or additive. The pharmaceutically acceptable carrier, diluent, and / or additive may be any pharmaceutically acceptable carrier, diluent, and / or additive selected from those commonly used for formulating antibodies. For example, the pharmaceutically acceptable carrier may be, but is not limited to, one or more pharmaceutically acceptable carriers selected from the group consisting of lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia gum, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methylcellulose, methyl hydroxybenzoate, propyl hydroxybenzoate, talc, magnesium stearate, and mineral oil.
[0097] The pharmaceutical composition may further comprise one or more agents selected from the group consisting of lubricating agents, wetting agents, sweetening agents, flavor enhancers, emulsifying agents, suspending agents, preservatives, and the like.
[0098] The bispecific antibody or pharmaceutical composition may be administered to a subject orally or parenterally. Parenteral administration may be intravenous, subcutaneous, intramuscular, intraperitoneal, intradermal, topical, intranasal, intrapulmonary, or rectal administration. Because oral administration results in digestion of proteins or peptides, the active ingredient in a composition for oral administration must be coated or formulated to prevent digestion in the stomach. In addition, the composition may be administered using any device that allows the active ingredient to be delivered to target cells (e.g., cancer cells).
[0099] As used herein, the term "pharmaceutically effective amount" may refer to an amount of a bispecific antibody, which is an active ingredient, that can exert a pharmaceutically significant effect in the prevention or treatment of cancer. The pharmaceutically effective amount of a bispecific antibody, or the appropriate dosage of a pharmaceutical composition, indicated by the amount of the bispecific antibody, can be formulated in various ways depending on various factors, such as the patient's age, body weight, sex, condition, diet, excretion rate, and / or reaction sensitivity, type of formulation, number of doses, administration route, and administration method. For example, the pharmaceutically effective amount of a bispecific antibody, or the appropriate dosage of a pharmaceutical composition, can be in the range of about 0.001 to about 1,000 mg (amount of bispecific antibody) per kg (body weight) per day for an adult, about 0.01 to about 100 mg / kg, or 0.1 to 50 mg / kg.
[0100] The subject to which the bispecific antibody or pharmaceutical composition is administered may be, but is not limited to, a subject selected from mammals, such as humans, monkeys, rats, mice, dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, etc., or cells or tissues obtained therefrom, and may be a subject suffering from cancer.
[0101] The pharmaceutical composition may be formulated into unit or multi-dosage form with pharmaceutically acceptable carriers and / or additives by methods readily practiced by those skilled in the art. The dosage form may be a solution, suspension, syrup, emulsion, extract, powder, granules, tablet, or capsule in an oily or aqueous vehicle, and may further include a dispersing agent or stabilizer.
[0102] Polynucleotides, Recombinant Vectors, and Antibody Preparations Certain embodiments provide polynucleotides encoding bispecific antibodies. For example, the polypeptide may comprise a first polynucleotide encoding the heavy chain of an anti-EGFR antibody described herein and the scFv of an anti-4-1BB antibody described herein, linked directly or via a peptide linker; and a second polynucleotide encoding the light chain of the anti-EGFR antibody. Alternatively, the polypeptide may comprise a first polynucleotide encoding the heavy chain of an anti-4-1BB antibody described herein and the scFv of an anti-EGFR antibody described herein, linked directly or via a peptide linker; and a second polynucleotide encoding the light chain of the anti-4-1BB antibody.
[0103] Another embodiment provides a recombinant vector comprising the polynucleotide. For example, the recombinant vector may comprise a first polynucleotide and a second polynucleotide together in one vector, or may comprise the first polynucleotide and the second polynucleotide separately in two vectors. Another embodiment provides a recombinant cell comprising the first polynucleotide and the second polynucleotide. For example, the recombinant cell may be a cell transfected with the recombinant vector.
[0104] Another embodiment provides a method for preparing a bispecific antibody, the method comprising expressing polynucleotides, e.g., a first polynucleotide and a second polynucleotide, in a cell. The step of expressing the polynucleotides can be carried out by culturing cells containing the polynucleotides (e.g., in a recombinant vector) under conditions that allow expression of the polynucleotides. The method can further comprise isolating and / or purifying the anti-4-1BB antibody or antigen-binding fragment thereof from the cell culture after the expressing or culturing step.
[0105] The term "vector" refers to a means for expressing a target gene in a host cell, as exemplified by plasmid vectors, cosmid vectors, and viral vectors such as bacteriophage vectors, adenovirus vectors, retrovirus vectors, and adeno-associated virus vectors. Recombinant vectors can be constructed from plasmids frequently used in the art (e.g., pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8 / 9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX series, pET series, and pUC19), phages (e.g., λgt4λB, λ-Charon, λΔz1, and M13), or by manipulating viruses (e.g., SV40, etc.).
[0106] Within the recombinant vector, the polynucleotide may be operably linked to a promoter. The term "operably linked" is intended to refer to a functional link between a nucleotide sequence of interest and an expression control sequence (e.g., a promoter sequence). When "operably linked," the control element may control the transcription and / or translation of the nucleotide sequence of interest.
[0107] Recombinant vectors can typically be constructed as cloning vectors or expression vectors. For recombinant expression vectors, vectors generally available in the relevant technical fields can be used for the expression of foreign proteins in plant, animal, or microbial cells. Various methods well known in the art can be used to construct recombinant vectors.
[0108] For use in hosts such as prokaryotic or eukaryotic cells, recombinant vectors can be constructed according to the host. For example, when a vector is constructed as an expression vector for use in a prokaryotic host, the vector typically contains a strong promoter for transcription (e.g., pLκλ promoter, CMV promoter, trp promoter, lac promoter, tac promoter, T7 promoter, etc.), a ribosome binding site for initiating translation, and a transcription / translation termination sequence. On the other hand, expression vectors for use in eukaryotic hosts contain, but are not limited to, origins of replication operable in eukaryotic cells, such as the f1 origin of replication, the SV40 origin of replication, the pMB1 origin of replication, the adenovirus origin of replication, the AAV origin of replication, and the BBV origin of replication. In addition, expression vectors typically contain a promoter derived from the genome of a mammalian cell (e.g., a metallothionein promoter) or a promoter derived from a mammalian virus (e.g., an adenovirus late promoter, a vaccinia virus 7.5K promoter, an SV40 promoter, a cytomegalovirus promoter, and an HSV tk promoter), and a polyadenylation sequence as a transcription termination sequence.
[0109] Recombinant cells can be prepared by introducing a recombinant vector into a suitable host cell. Any host cell known in the art can be used in the present disclosure, as long as it allows for the sequential cloning and expression of the recombinant vector in a stable manner. Examples of prokaryotic host cells that can be used for the present disclosure include Bacillus species, such as E. coli, Bacillus subtilis, and Bacillus thuringiensis, as well as Enterobacteriaceae strains, such as Salmonella typhimurium and Serratia marcescens, and various Pseudomonas species. Eukaryotic host cells that can be used for transformation can be selected from, but are not limited to, Saccharomyce cerevisiae, insect cells, and animal cells such as Sp2 / 0, CHO (Chinese Hamster Ovary) K1, CHO DG44, PER.C6, W138, BHK, COS-7, 293, HepG2, Huh7, 3T3, RIN, and MDCK.
[0110] The polynucleotide or a recombinant vector carrying the polynucleotide can be introduced (transfected) into a host cell using a method well known in the relevant technical field. For example, when the host cell is a prokaryotic cell, the transfection can be performed using the CaCl2 method or electroporation. For eukaryotic host cells, gene transfer can be achieved using methods such as, but not limited to, microinjection, calcium phosphate precipitation, electroporation, liposome-mediated transfection, or particle bombardment.
[0111] To select transformed host cells, the phenotype associated with the selectable marker can be used according to methods well known in the art. For example, if the selectable marker is a gene that confers resistance to a particular antibiotic, the host cells can be grown in the presence of the antibiotic in the medium to select for the desired transformants.
[0112] Another embodiment provides a method for making a bispecific antibody comprising expressing a polynucleotide or recombinant vector in a host cell. In one embodiment, the production method may comprise culturing recombinant cells harboring the polynucleotide or recombinant vector therein, and optionally isolating and / or purifying the antibody from the culture medium.
[0113] Beneficial effects The present disclosure relates to bispecific antibodies, each of which comprises an antibody specific for a tumor-associated antigen (TAA; EGFR) and an antibody specific for 4-1BB, and uses thereof. These bispecific antibodies activate 4-1BB signaling and boost potent immune cells only in the presence of EGFR-expressing cells. Due to the specific EGFR-mediated immune response, the use of bispecific antibodies is expected to significantly reduce liver toxicity compared to the 4-1BB monoclonal antibody. [Brief explanation of the drawings]
[0114] [Figure 1a] 1 is a graph showing the antigen (human 4-1BB) binding activity of anti-4-1BB antibodies measured by ELISA. [Figure 1b] 1 is a graph showing the cell binding activity of anti-4-1BB antibodies measured by ELISA. [Figure 2a] 1 is a graph showing the antigen (human EGFR) binding activity of anti-EGFR / anti-4-1BB bispecific antibodies measured by ELISA. [Figure 2b] 1 is a graph showing the antigen (human EGFR) binding activity of anti-EGFR / anti-4-1BB bispecific antibodies measured by ELISA. [Figure 3a] 1 is a graph showing the antigen (human 4-1BB) binding activity of anti-EGFR / anti-4-1BB bispecific antibodies measured by ELISA. [Figure 3b] 1 is a graph showing the antigen (human 4-1BB) binding activity of anti-EGFR / anti-4-1BB bispecific antibodies measured by ELISA. [Figure 4a] 1 is a graph showing the level of 4-1BB signal activation in the MDA-MB231 cell line (EGFR highly expressing cells) by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 4b] 1 is a graph showing the level of 4-1BB signal activation in the BT-474 cell line (EGFR-negative cells) by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 5a] 1 is a graph showing the level of 4-1BB signal activation in the EGFR-expressing A431 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 5b] 1 is a graph showing the level of 4-1BB signal activation in the EGFR-expressing HCC1954 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 5c] 1 is a graph showing the level of 4-1BB signal activation in the EGFR-expressing Calu-3 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 5d] 1 is a graph showing the level of 4-1BB signal activation in the EGFR-expressing DLD-1 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 5e] 1 is a graph showing the level of 4-1BB signal activation in the EGFR-expressing SK-BR-3 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 5f] 1 is a graph showing the level of 4-1BB signal activation in the EGFR-expressing NCI-N87 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 5g] 1 is a graph showing the level of 4-1BB signal activation in the EGFR-expressing MDA-MB-231 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 5h] 1 is a graph showing the level of 4-1BB signal activation in the EGFR-expressing Panc-1 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 6a] 1 is a graph showing the level of 4-1BB signal activation in a non-EGFR-expressing CHO-k1 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 6b] 1 is a graph showing the level of 4-1BB signal activation in the non-EGFR-expressing SW620 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 6c] 1 is a graph showing the level of 4-1BB signal activation in the non-EGFR-expressing MC38 cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 6d] 1 is a graph showing the level of 4-1BB signal activation in a non-EGFR-expressing Jurkat cell line by an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 7a] 7 is a graph showing the correlation between EGFR sABC and 4-1BB-induced NF-kB signaling by anti-EGFR / anti-4-1BB bispecific antibodies (7a, 7b) in various cell lines. [Figure 7b] 7 is a graph showing the correlation between EGFR sABC and 4-1BB-induced NF-kB signaling by anti-EGFR / anti-4-1BB bispecific antibodies (7a, 7b) in various cell lines. [Figure 7c] FIG. 1 is a graph showing the correlation of EGFR sABC with 4-1BB-induced NF-kB signaling by a control antibody (7c) in various cell lines. [Figure 8a] 1 is a graph showing IFN-gamma levels released from EGFR-expressing DLD-1 cells treated with anti-EGFR / anti-4-1BB bispecific antibody. [Figure 8b] 1 is a graph showing IFN-gamma levels released from EGFR-expressing DLD-1 cells treated with anti-EGFR / anti-4-1BB bispecific antibody. [Figure 9a-9b]1 is a graph showing the % survival of EGFR-expressing DLD-1 cells treated with anti-EGFR / anti-4-1BB bispecific antibody. [Figure 9c-9d] 1 is a graph showing the % survival of EGFR-expressing DLD-1 cells treated with anti-EGFR / anti-4-1BB bispecific antibody. [Figure 10] 1 is a graph showing the in vivo anti-tumor activity of anti-EGFR / anti-4-1BB bispecific antibodies in hPBMC-engrafted mice bearing DLD-1. [Figure 11a-11b] 1 is a graph showing the in vivo anti-tumor activity of anti-EGFR / anti-4-1BB bispecific antibodies in 4-1BB knock-in mice bearing human EGFR / MC38 tumors. [Figure 12] 1 is a graph showing in vivo anti-tumor activity by anti-EGFR / anti-4-1BB bispecific antibody in mice cured with anti-EGFR / anti-4-1BB bispecific antibody and re-challenged with human EGFR / MC38 and B16 F10 tumor cells. [Figure 13] 1 is a graph showing the antibody-dependent cell-mediated cytotoxicity (ADCC) effect of anti-EGFR / anti-4-1BB bispecific antibodies. [Figure 14a] 1 is a graph showing the results of an FcγRIIb-dependent 4-1BB bioassay for an anti-EGFR / anti-4-1BB bispecific antibody. [Figure 14b] 1 is a graph showing the results of an FcγRIIb-independent 4-1BB bioassay for an anti-EGFR / anti-4-1BB bispecific antibody.
[0115] The present invention includes the following embodiments. Aspect 1. (a) an anti-4-1BB antibody or an antigen-binding fragment thereof, and (b) an anti-EGFR antibody or an antigen-binding fragment thereof, wherein the anti-4-1BB antibody or antigen-binding fragment thereof is: H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, 2, or 3; H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, 5, or 6; H-CDR3 comprising the amino acid sequence of SEQ ID NO: 7, 8, 9, 10, or 11; L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12 or 13; L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14 or 15; and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16 or 17 1. An anti-4-1BB / anti-EGFR bispecific antibody comprising: Aspect 2. The anti-4-1BB antibody or antigen-binding fragment thereof is a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29; and a light chain variable region comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 30, 31, 32, 33, 34, or 88; 2. The anti-4-1BB / anti-EGFR bispecific antibody of embodiment 1, comprising: Aspect 3. The anti-4-1BB antibody or antigen-binding fragment thereof is a heavy chain comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 56, 57, 58, 59, 60, or 61; and 2. The anti-4-1BB / anti-EGFR bispecific antibody according to embodiment 1, comprising a light chain comprising or consisting essentially of the amino acid sequence of SEQ ID NO: 62, 63, or 64. Embodiment 4. An anti-4-1BB / anti-EGFR bispecific antibody according to embodiment 1, wherein the anti-4-1BB antibody or antigen-binding fragment thereof is an anti-4-1BB scFv of the anti-4-1BB antibody. Embodiment 5. The anti-4-1BB scFv comprises: a heavy chain variable region comprising an H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, 2, or 3, an H-CDR2 comprising the amino acid sequence of SEQ ID NO: 4, 5, or 6, and an H-CDR3 comprising the amino acid sequence of SEQ ID NO: 7, 8, 9, 10, or 11; and a light chain variable region comprising L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12 or 13, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 14 or 15, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 16 or 17; 5. The anti-4-1BB / anti-EGFR bispecific antibody of embodiment 4, comprising: Embodiment 6. An anti-4-1BB / anti-EGFR bispecific antibody according to embodiment 5, wherein the anti-4-1BB scFv further comprises a peptide linker between the heavy chain variable region and the light chain variable region. Embodiment 7. The anti-4-1BB / anti-EGFR bispecific antibody according to embodiment 1, wherein the anti-EGFR antibody is cetuximab. Embodiment 8. The anti-EGFR antibody or antigen-binding fragment thereof: H-CDR1 comprising the amino acid sequence of SEQ ID NO: 65; H-CDR2 comprising the amino acid sequence of SEQ ID NO: 66; H-CDR3 comprising the amino acid sequence of SEQ ID NO: 67; L-CDR1 comprising the amino acid sequence of SEQ ID NO: 68; L-CDR2 comprising the amino acid sequence of SEQ ID NO: 69; and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 70 2. The anti-4-1BB / anti-EGFR bispecific antibody of embodiment 1, comprising: Embodiment 9. The anti-EGFR antibody or antigen-binding fragment thereof: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 71; and A light chain variable region comprising the amino acid sequence of SEQ ID NO: 72 2. The anti-4-1BB / anti-EGFR bispecific antibody of embodiment 1, comprising: Embodiment 10. The anti-EGFR antibody or antigen-binding fragment thereof: a heavy chain comprising the amino acid sequence of SEQ ID NO: 73 or 74; and A light chain comprising the amino acid sequence of SEQ ID NO: 75 2. The anti-4-1BB / anti-EGFR bispecific antibody of embodiment 1, comprising: Embodiment 11. The anti-4-1BB / anti-EGFR bispecific antibody according to embodiment 1, wherein the anti-EGFR antibody or antigen-binding fragment thereof is an anti-EGFR scFv of the anti-EGFR antibody. Embodiment 12. An anti-EGFR scFv comprising: a heavy chain variable region comprising an H-CDR1 comprising the amino acid sequence of SEQ ID NO: 65, an H-CDR2 comprising the amino acid sequence of SEQ ID NO: 66, and an H-CDR3 comprising the amino acid sequence of SEQ ID NO: 67; and A light chain variable region comprising L-CDR1 comprising the amino acid sequence of SEQ ID NO: 68, L-CDR2 comprising the amino acid sequence of SEQ ID NO: 69, and L-CDR3 comprising the amino acid sequence of SEQ ID NO: 70. 12. The anti-4-1BB / anti-EGFR bispecific antibody of embodiment 11, comprising: Embodiment 13. An anti-4-1BB / anti-EGFR bispecific antibody according to embodiment 12, wherein the anti-EGFR scFv further comprises a peptide linker between the heavy chain variable region and the light chain variable region. Embodiment 14. An anti-4-1BB / anti-EGFR bispecific antibody according to embodiment 1, comprising a full-length form of the anti-EGFR antibody and an scFv of the anti-4-1BB antibody. Embodiment 15. An anti-4-1BB / anti-EGFR bispecific antibody according to embodiment 1, comprising a full-length form of the anti-4-1BB antibody and an scFv of the anti-EGFR antibody. Embodiment 16. A pharmaceutical composition for the treatment or prevention of cancer, comprising the anti-4-1BB / anti-EGFR bispecific antibody of any one of embodiments 1 to 15, and a pharmaceutically acceptable carrier. Embodiment 17. The pharmaceutical composition of embodiment 16, wherein the cancer is characterized by expression of EGFR. Embodiment 18. A pharmaceutical composition for enhancing an immune response, comprising administering an anti-4-1BB / anti-EGFR bispecific antibody according to any one of embodiments 1 to 15, and a pharmaceutically acceptable carrier. Embodiment 19. An anti-4-1BB / anti-EGFR bispecific antibody according to any one of embodiments 1 to 15 for use in the treatment or prevention of cancer. Embodiment 20. Use of an anti-4-1BB / anti-EGFR bispecific antibody according to embodiment 19, wherein the cancer is characterized by expression of EGFR. Embodiment 21. An anti-4-1BB / anti-EGFR bispecific antibody according to any one of embodiments 1 to 15, for use in enhancing an immune response. Invention Method Hereinafter, the present invention will be described in detail by way of examples.
[0116] The following examples are intended only to illustrate the present invention and are not to be construed as limiting thereof. [Example]
[0117] Example 1 Anti-4-1BB antibody 1.1. Preparation of fully human monoclonal antibodies against 4-1BB Full-length IgG-form, fully human monoclonal anti-4-1BB antibodies were screened by immunotube panning of a phage library (obtained from KBio Health) against 4-1BB. A total of four rounds of panning were performed using immunotubes coated with 4-1BB (NCBI accession number: NP_001552.2) to pan the phage library against the target molecule.
[0118] Bacterial colonies from the panning output over three rounds were grown in 96-deep well plates in SB-carbenicillin (Biomatik product no. A2311-5g) until turbid, at which point 10 11 pfu of VCSM13 helper phage (K-Bio Health) was added to each well. One hour after infection, 70 μg / mL kanamycin was added at 37°C with gentle shaking (80 rpm), and the cells were grown overnight at 30°C with shaking at 200 rpm.
[0119] The next day, the plates were centrifuged, and the phage-containing supernatant was added to a 4-1BB antigen-coated ELISA plate blocked with 3% (v / v) BSA (bovine serum albumin) in PBST (phosphate-buffered saline with Tween 20). After incubation for 1 hour at room temperature, the plate was washed three times with PBST, and anti-M13 antibody (Sino Biological product number: 11973-MM05) was added. The plate was incubated for 1 hour, washed three times with PBST, and binding activity was measured using tetramethylbenzidine (TMB).
[0120] The 4-1BB-specific binders were amplified and the plasmid DNA was sequenced. The light chain variable region sequences and heavy chain variable region sequences (VL and VH sequences) were analyzed to identify unique sequences and determine sequence diversity (underlined: CDR1, CDR2, and CDR3 order) as shown in Tables 6-13. In the following examples, an anti-4-1BB antibody designated as BMUR (Urelumab, manufactured by BMS, U.S. Patent No. 7,288,638) is used to compare agonist activity. TIFF0007738545000006.tif219170TIFF0007738545000007.tif220170TIFF0007738545000008.tif220170TIFF0007738545000009.tif220170 TIFF0007738545000010.tif220170TIFF0007738545000011.tif226170TIFF0007738545000012.tif231170TIFF0007738545000013.tif215170
[0121] 1.2. Preparation of scFv antibody against 4-1BB Anti-4-1BB scFv antibodies with the structure (N')-VL-linker-VH-(C') were prepared using the variable regions of fully human monoclonal antibodies against 4-1BB shown in Tables 6 to 13 in Example 1.1, in which the amino acid residue "G" at position 44 in the heavy chain variable region was substituted with "C" and the amino acid residue "G" at position 103 in the light chain variable region was substituted with "C." Such a "G" to "C" amino acid substitution within the scFv may contribute to increased stability of bispecific antibodies containing the scFv as one target-specific moiety. The amino acid sequences of the prepared anti-4-1BB scFvs are exemplified in Tables 14 to 19 below. However, those skilled in the art can apply changes or modifications to the amino acid sequences in the following embodiments, including the use of various types of peptide linkers such as (GGGGS)2, (GGGGS)3, (GGGGS)4, or (GS)9, to meet specific purposes. TIFF0007738545000014.tif59170TIFF0007738545000015.tif66170TIFF0007738545000016.tif66170 TIFF0007738545000017.tif66170TIFF0007738545000018.tif71170TIFF0007738545000019.tif59170
[0122] 1.3. Antigen-binding ability of anti-4-1BB antibody (full-length IgG form) to human 4-1BB (1) Antigen binding activity measured by ELISA To assess antigen-binding activity, the antibody candidates prepared in Example 1.1 were subjected to an ELISA test. Briefly, microtiter plates were coated with 0.1 μg / ml human 4-1BB-Fc protein (Sino Biological) in PBS, 100 μl per well, overnight at 4°C, and then blocked with 5% (v / v) BSA, 100 μl per well. Five-fold dilutions of humanized antibodies (1A10, 1A12, and AB41), starting at 10 μg / ml, were added to each well and incubated at room temperature (RT) for 1-2 hours. The plates were washed with PBS / Tween and then incubated with goat anti-human IgG antibody conjugated with horseradish peroxidase (HRP) (Thermo) for 1 hour at RT. After washing, the plates were developed with TMB substrate and analyzed by spectrophotometer at OD 450-650 nm.
[0123] The results obtained are shown in Figure 1a. As shown in Figure 1a, all of the tested anti-4-1BB antibodies exhibit 4-1BB binding ability.
[0124] (2) Cell binding activity measured by FACS To assess cell binding activity, antibody candidates were analyzed for their binding to mammalian-expressed 4-1BB by fluorescence-activated cell sorting (FACS). Briefly, Jurkat cells expressing 4-1BB on their surface were cultured in the GloResponse™ NFκB-luc2 / 4-1BB Jurkat cell line (Promega; 3×10 cells). 5 Each well was incubated with antibodies (1A10 and 1A12; 10 μg / mL each). After washing with FACS buffer (1% (v / v) BSA in PBS), FITC-anti-human IgG antibody (Sigma, F9512, concentration: 2.0 mg / mL) was added to each well and incubated at 4°C for 1 hour. The mean fluorescence intensity (MFI) of FITC was assessed using a FACSCalibur (BD Biosciences).
[0125] The results are shown in Figure 1b. As shown in Figure 1b, all of the tested anti-4-1BB antibodies exhibited the ability to bind to 4-1BB expressed on the cell surface and could efficiently bind to 4-1BB expressed on mammalian cells.
[0126] Example 2 Preparation of anti-EGFR antibodies For the anti-EGFR / anti-4-1BB bispecific antibody, the EGFR-targeting moiety used was cetuximab (ERBITUX®: BMS”, DrugBank accession number: DB00002; human IgG1 kappa monoclonal antibody), or an antigen-binding fragment thereof, such as scFv.
[0127] The sequence of cetuximab is summarized below: Heavy chain: QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTL VTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 90) Light chain: DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 75)
[0128] The constant region of the anti-EGFR antibody contained within the bispecific antibody can be modified by introducing more than one mutation or change into human IgG1, one exemplary embodiment (hereinafter designated "ET(WT)") is illustrated in Table 20. TIFF0007738545000020.tif126170
[0129] The constant region of the anti-EGFR antibody contained within the bispecific antibody can be modified by introducing more than one mutation or change into human IgG1, one exemplary embodiment, EGFR (NA or N297A), is presented in Table 21 below. TIFF0007738545000021.tif133170
[0130] Example 3 Preparation of anti-EGFR / anti-4-1BB bispecific antibody Various anti-EGFR / anti-4-1BB bispecific antibody candidates were prepared in the full-length IgG (anti-EGFR antibody)-scFv (anti-4-1BB antibody) format or the full-length IgG (anti-4-1BB antibody)-scFv (anti-EGFR antibody) format. In this example, the anti-EGFR / anti-4-1BB bispecific antibodies were prepared in the IgG-scFv fusion form (in which an scFv antibody fragment of one antigen was fused to the C-terminus of an IgG fragment of another antigen), and the anti-EGFR IgG and 4-1BB scFv clones prepared in Examples 2 and 1.2, respectively, were selected as exemplary. When EGFR was placed in the full IgG moiety, IgG1 with a mutant backbone that reduced ADCC (e.g., N297A mutation; Cancer Cell, Vol. 19, No. 1, pp. 101-113) was used, and when 4-1BB was placed in the full IgG moiety, IgG4 was used.
[0131] DNA segment 1, containing a nucleotide sequence encoding the heavy chain of the IgG antibody of the anti-EGFR / anti-4-1BB bispecific antibody, was inserted into pcDNA 3.4 (Invitrogen, A14697; plasmid 1), and DNA segment 2, containing a nucleotide sequence encoding the light chain of the IgG antibody of the anti-EGFR / anti-4-1BB bispecific antibody, was inserted into pcDNA 3.4 (Invitrogen, A14697; plasmid 2). To construct a vector for expressing the bispecific antibody, DNA segment 3, encoding the scFv, was fused to the portion of DNA segment 1 inserted into plasmid 1 corresponding to the C-terminus of the Fc region of the IgG antibody using either DNA segment 4, encoding a 15-amino acid linker peptide consisting of (GGGGS)3, or DNA segment 5, encoding an 18-amino acid linker peptide consisting of (GS)9. Furthermore, as described in Example 1.2, to stabilize the scFv, a further modification was applied in which VL103-VH44 (VL103: VL with a G→C mutation at position 103; VH44: VH with a G→C mutation at position 44) was fused to the C-terminus of the light chain and the C-terminus of the heavy chain, respectively, to create a disulfide bridge.
[0132] Among the bispecific antibodies prepared, the sequences of the heavy chain, light chain, scFv, and DNA segments used in the preparation of some exemplary bispecific antibodies are exemplified in Tables 22 to 30. In the antibodies presented below, one or more point mutations can be applied within the amino acid sequence for purposes such as improving stability and titer, reducing immunogenicity, etc. TIFF0007738545000022.tif255170TIFF0007738545000023.tif255170TIFF000 7738545000024.tif220170TIFF0007738545000025.tif220170TIFF00077385450 00026.tif220170TIFF0007738545000027.tif220170TIFF0007738545000028.t if220170TIFF0007738545000029.tif220170TIFF0007738545000030.tif221170
[0133] Example 4 Testing the binding affinity of bispecific antibodies (BsAb) 4.1. Binding to human EGFR The binding affinity of the bispecific antibody to EGFR was determined by ELISA, as described in Example 1.3(1).
[0134] Briefly, 96-well microtiter plates (Nunc-Immuno Plates, NUNC) were coated with 1 μg / ml human EGFR-His protein (Sino Biological, 10001-H08B) in PBS, 100 μl per well, overnight at 4°C, and then blocked with blocking buffer (1% BSA (bovine serum albumin (Gibco, 30063572)) in PBS, 200 μl per well) for 2 hours at 37°C. Six-fold dilutions of the anti-EGFR / anti-4-1BB bispecific antibody prepared in Example 3, starting at 0.1 μM, were added to each well and incubated at 37°C for 1 hour. The plate was washed with PBS / 0.05% Tween 20 and then incubated with HRP-conjugated Fab multiclonal antibody reagent (Pierce, 31414) at 37°C for 1 hour. After washing, the plates were developed with TMB (tetramethylbenzidine, Sigma, T0440) substrate and analyzed by spectrophotometer at OD 450-650 nm.
[0135] The results obtained are shown in Figures 2a and 2b. As shown in Figures 2a and 2b, all of the tested anti-EGFR / anti-4-1BB bispecific antibodies were able to bind to human EGFR protein with high affinity, similar to that of the control anti-EGFR antibody.
[0136] 4.2. Binding to human 4-1BB The binding affinity of the bispecific antibody to 4-1BB was determined by ELISA, with reference to Example 1.3(1).
[0137] Briefly, 96-well microtiter plates (Nunc-Immuno Plates, NUNC) were coated overnight at 4°C with 100 μl per well of 1 μg / ml human 4-1BB-His protein (Sino Biological, 10041-H08H) in PBS, and then blocked with 100 μl per well of 1% BSA (bovine serum albumin (Gibco, 30063572)) in PBS for 2 hours at 37°C. Six-fold dilutions of the anti-EGFR / anti-4-1BB bispecific antibody prepared in Example 3, starting at 0.1 μM, were added to each well and incubated at 37°C for 1 hour. The plate was washed with PBS / 0.05% Tween 20 and then incubated with HRP-conjugated Fab multiclonal antibody reagent (Pierce, 31414) at 37°C for 1 hour. After washing, the plates were developed with TMB (tetramethylbenzidine, Sigma, T0440) substrate and analyzed by spectrophotometer at OD 450-650 nm.
[0138] The results are shown in Figures 3a and 3b. As shown in Figures 3a and 3b, all of the tested anti-EGFR / anti-4-1BB bispecific antibodies could bind to human 4-1BB protein with high affinity, whereas the anti-EGFR antibody did not bind to human 4-1BB protein.
[0139] The results of Figures 2a, 2b, 3a, and 3b were quantified and are summarized in Table 31 below. TIFF0007738545000031.tif87170
[0140] As shown in Table 31, all of the tested anti-EGFR / anti-4-1BB bispecific antibodies can bind with high affinity to both human EGFR protein and human 4-1BB protein.
[0141] 4.3. Binding to diverse cell surface-expressed human EGFR The binding affinity of the bispecific antibodies to various cells expressing EGFR on their surface was determined by FACS analysis, see Example 1.3(2).
[0142] EGFR is expressed in a variety of cancer cells and has been reported to be overexpressed in a variety of solid tumors, including skin cancer, breast cancer, cervical cancer, colon cancer, gastric cancer, pancreatic cancer, and head and neck cancer.
[0143] For this experiment, the following cells were used: A431 (ATCC® CRL-1555™, epidermoid carcinoma), BT474 (ATCC® HTB-20™, ductal carcinoma), HCC1954 (ATCC® CRL-2338™, TNM stage IIA, grade 3, ductal carcinoma), Jimt-1 (DSMZ ACC 589, breast carcinoma), Hela (ATCC® CCL-2™, cervical adenocarcinoma), DLD-1 (ATCC® CCL-221™, Dukes type C, colorectal adenocarcinoma), Kato III (ATCC (registered trademark) HTB-103 (trademark), gastric cancer), NCI-N87 (ATCC (registered trademark) CRL-5822 (trademark), human gastric cancer), MDA-MB-231 (ATCC (registered trademark) HTB-26 (trademark), human breast cancer), CFPAC-1 (ATCC (registered trademark) CRL-1918 (trademark), pancreatic ductal adenocarcinoma), Panc-1 (ATCC (registered trademark) CRL-1469 (trademark), pancreatic epidermoid carcinoma), A253 (ATCC (registered trademark) HTB-41 (trademark), submandibular gland epidermoid carcinoma), Detroit562 (ATCC (registered trademark) Various cancer cell lines were used, including CCL-138™, pharyngeal carcinoma, FaDu (ATCC® HTB-43™, pharyngeal squamous cell carcinoma), SCC9 (ATCC® CRL-1629™, tongue squamous cell carcinoma), SCC15 (ATCC® CRL-1623™, tongue squamous cell carcinoma), and SCC25 (ATCC® CRL-1628™, tongue squamous cell carcinoma). Binding of the cell lines to EGFR was analyzed by FACS (FACSCalibur, BD Biosciences) using the antibodies of the present invention.
[0144] Specifically, after each cell line was dissociated and washed in PBS, the cells were counted and 2 x 10 cells were collected per 200 μl of FACS buffer. 5 Then, the cells were treated with anti-EGFRx4-1BB antibody at 10 μg / mL and reacted for 1 hour at 4° C. After the reaction, the cells were washed in FACS buffer, and then FITC-labeled constant region (Fc)-specific antibody (goat anti-human IgG FITC-conjugated Fc-specific antibody, Sigma, F9512, concentration: 2.0 mg / mL) was added at 1×10 cells per 200 μL of FACS buffer. 5 The cells were suspended in 2 μl of 1000 μL of EGFR antibody per 1000 μL of EGFR antibody and incubated at 4°C for 1 hour. After incubation, the cells were washed with FACS buffer and analyzed using a FACSCalibur device. The negative control group was treated with only an FITC-labeled constant region (Fc)-specific antibody. To compare the expression levels of EGFR between cancer cell lines, the peak shift values in the test group were divided by the peak shift values in the negative control group (mean fluorescence intensity ratio, MFI ratio: MFI for test antibody / MFI for second antibody).
[0145] The results obtained are shown in Table 32 below. TIFF0007738545000032.tif147170
[0146] As shown in Table 32, all tested anti-EGFR / anti-4-1BB bispecific antibodies are capable of binding to cell surface-expressed human EGFR protein.
[0147] Example 5 Binding affinity of BsAb to 4-1BB (SPR) For SPR experiments, flow cell 1 on a Biocore® Series S Sensor Chip CM5 (GE Healthcare, BR100530), on which an anti-human Fab antibody (GE Healthcare, 28958325) was immobilized by amine coupling, was held as a reference, while the anti-EGFR / anti-4-1BB bispecific antibody was captured separately on flow cells 2, 3, and 4. Recombinant human 4-1BB protein (ACROBiosystems, 41B-H5227) was flowed across the chip at concentrations of 400, 200, 100, 50, 25, 12.5, 6.25, 3.13, 1.56, and 0.78 nM at 30 μl / min for 300 s, followed by a 400 s dissociation phase. Regeneration was performed with 10 mM glycine-HCl (pH 2.0) (GE Healthcare, BR100355).
[0148] The results obtained are shown in Table 33 below. TIFF0007738545000033.tif45170
[0149] As shown in Table 33, the tested anti-EGFR / anti-4-1BB bispecific antibodies exhibit high 4-1BB binding affinity.
[0150] Example 6 Activation of 4-1BB signaling 6.1. BsAbs vs. Monospecific Antibodies In this example, to measure activation of 4-1BB signaling, the GloResponse™ NFκB-luc2 / 4-1BB Jurkat cell line (Promega), which was genetically modified to stably express human 4-1BB and luciferase downstream of the response element, was used as effector cells, and cancer cells that either expressed or did not express EGFR were used as target cells. Briefly, MDA-MB-231 (EGFR-expressing; 2.5 × 10 cells) were used as target cells. 4 cells) or BT-474 (non-EGFR expressing; 2.5 × 10 cells 4On the day of the assay, test anti-EGFR / anti-4-1BB bispecific antibodies (Example 3; 100 nM or 4 nM, 5-fold dilutions) and effector Jurkat cells (2.5 × 10 cells) were seeded into a 96-well assay plate and cultured overnight. 4 After 6 hours of incubation, Bio-Glo™ reagent (Promega) was added and luminescence was measured using a microplate reader.
[0151] The results are shown in Figures 4a (MDA-MB-231 cell line) and 4b (BT-474 cell line) below. In Figures 4a and 4b, BMUR (Urelumab from BMS, U.S. Patent No. 7,288,638) indicates the anti-4-1BB antibody used to compare agonist activity. As shown in Figures 4a and 4b, the anti-EGFR / anti-4-1BB bispecific antibody potently activates the 4-1BB signal only when co-cultured with EGFR-highly expressing cells. The Fc-crosslinked anti-4-1BB monoclonal antibody showed minimal activity.
[0152] 6.2. Activation of 4-1BB in various EGFR-expressing cells In this example, to measure activation of 4-1BB signaling, GloResponse™ NFκB-luc2 / 4-1BB Jurkat cell line (Promega), which was genetically modified to stably express human 4-1BB and luciferase downstream of the response element, was used as effector cells, and cancer cells expressing or not expressing EGFR were used as target cells. Briefly, EGFR-expressing (A-431, HCC1954, Calu-3, DLD-1, SK-BR-3, NCI-N87, MDA-MB-231, Panc-1) or EGFR-non-expressing (CHO-k1, SW620, MC38, Jurkat) cancer cells (2.5 × 10 cells per well) were cultured. 4The cells (each at 100 nM) were seeded into a 96-well assay plate and cultured overnight. On the day of the assay, the test anti-EGFR / anti-4-1BB bispecific antibody (Example 3; 100 nM or 2 nM, 5-fold dilutions) and effector Jurkat cells were added to the plate. After 6 hours of incubation, Bio-Glo™ reagent (Promega) was added and luminescence was measured using a microplate reader.
[0153] The results are shown in Figures 5a to 5h (EGFR-expressing cells) and Figures 6a to 6d (EGFR-non-expressing cells). As shown in Figures 5a to 5h and 6a to 6d, the anti-EGFR / anti-4-1BB bispecific antibody potently activated 4-1BB signaling only when co-cultured with EGFR-expressing cells.
[0154] 6.3. EGFR quantification EGFR cell surface expression levels were quantified on various cancer cell lines using the QIFIKIT quantification kit (Dako) according to the manufacturer's recommendations. Briefly, cells were stained with a saturating concentration of unlabeled anti-EGFR mouse monoclonal antibody (Abcam) or purified mouse IgG2b isotype control (Abcam). After washing, the stained cells and calibration beads provided by the kit were simultaneously labeled with the same FITC-conjugated goat anti-mouse IgG secondary antibody provided by the kit. The labeled cells and calibration beads were analyzed on a flow cytometer. Linear regression was performed using the MFI values from the calibration beads. The antibody-binding capacity (ABC) was extrapolated from this regression line, and the specific ABC (sABC) was determined by subtracting the ABC of the isotype control antibody from the ABC of the anti-EGFR antibody.
[0155] The results obtained are shown in Table 34. TIFF0007738545000034.tif98170
[0156] As shown in Table 34, the sABC of nine cancer cell lines was determined.
[0157] 6.4. Correlation between EGFR sABC and 4-1BB-induced NF-kB signaling The EGFR levels measured in Example 6.3 were normalized to the EGFR levels expressed by MDA-MB231. The level of 4-1BB activation by the bispecific antibody was determined as the highest level of fold change compared to the control in the 4-1BB NF-kB luciferase reporter assay of Example 6.2. The common area indicates the confidence interval for the linear fit.
[0158] The results are shown in Figures 7a to 7c. As shown in Figures 7a to 7c, 4-1BB activation by the anti-EGFR / anti-4-1BB bispecific antibody showed a strong correlation with cell surface expression of EGFR compared with BMUR (Figure 7c).
[0159] Example 7 T cell immune response 7.1. Effects on cytokine release To examine the ability of bispecific antibodies to stimulate responses in human peripheral blood mononuclear cells (PBMCs), the supernatant concentration of IFN-gamma was measured. Human PBMCs stimulated with human anti-CD3 antibody (BioLegend, 5 μg / mL) were used as effector cells. DLD-1 cells expressing EGFR were used as target cells. In this system, PBMCs were co-cultured with DLD-1 cells in the presence of human anti-CD3 antibody. Bispecific antibodies (Example 3) (starting at 20 nM (=4 μg / mL) and diluted over 10 doses) and their corresponding monospecific antibodies (starting at 26.67 nM (=4 μg / mL) and diluted over 10 doses) were added to the mixed culture. After incubation in a humidified chamber at 37° C. with 5% CO 2 for 72 hours, the supernatant concentration of IFN-gamma was measured by human IFN-gamma Quantikine kit (R&D systems, SIF50).
[0160] The results are shown in Figures 8a and 8b. As shown in Figures 8a and 8b, all of the tested bispecific antibodies induced greater cytokine release than the combination of each monoclonal antibody in the presence of highly EGFR-expressing cells.
[0161] 7.2. Effect on target cell proliferation A target cell lysis assay was used to examine the ability of bispecific antibodies to stimulate responses in human PBMCs. Human PBMCs stimulated with human anti-CD3 antibodies were used as effector cells. DLD-1 cells expressing EGFR were used as target cells. In this system, PBMCs were co-cultured with DLD-1 cells in the presence of human anti-CD3 antibodies (BioLegend, 5 μg / mL). Bispecific antibodies (starting at 20 nM (=4 μg / mL) and diluted over 10 doses) and their corresponding monospecific antibodies (starting at 26.67 nM (=4 μg / mL) and diluted over 10 doses) were added to the mixed culture. After the culture, the viability of DLD-1 cells was measured using a Cell Counting Kit-8 (Dojindo, CK04-20).
[0162] The results are shown in Figures 9a to 9d. As shown in Figures 9a to 9d, all of the tested bispecific antibodies exhibited superior cancer cell killing activity in the presence of highly EGFR-expressing cells compared to the combination of each monospecific antibody.
[0163] Example 8 In vivo antitumor effect in mice engrafted with hPBMC bearing DLD-1 To investigate the in vivo antitumor effect of the anti-EGFR / anti-4-1BB bispecific antibody, PBMC-humanized NPG mice were used. 6- to 8-week-old NPG mice were inoculated with 1 × 10 human PBMCs. 7 5 × 10 DLD-1 cancer cells were intravenously injected. 6The mice were inoculated into the right flank 5 days after PBMC injection. DLD-1-bearing humanized mice were randomized into each test group (n=8 per group) based on tumor volume 6 days after tumor implantation, and the mean tumor volume in each group was approximately 85 mm 3 The human IgG1 control antibodies cetuximab and urelumab, and the anti-EGFR / anti-4-1BB bispecific antibody ET(NA)x1A10 were administered intraperitoneally at a dose of 10 or 60 mg / kg twice weekly. During the experiment, tumor size was measured with a digital caliper. Tumor volumes were measured at 3000 mm. 3 Animals were euthanized when they reached a body weight of 0.05g or experienced a weight loss of more than 20% from the initial treatment.
[0164] The survival results are shown in Figure 10. As shown in Figure 10, urelumab induced adverse effects, including weight loss and a slight antitumor effect. Meanwhile, mice treated with ET(NA)x1A10 at a dose of 60 mg / kg showed a superior survival rate compared to mice receiving other treatments.
[0165] Example 9 In vivo antitumor effect in 4-1BB knock-in mice 9.1. Antitumor Activity The in vivo antitumor effect of the anti-EGFR / anti-4-1BB bispecific antibody was assessed in 4-1BB knock-in mice (Biocytogen) bearing human EGFR / MC38 tumors. The human EGFR / MC38 cell line was generated by Sirion Biotech based on MC38-WT, and EGFR expression was confirmed. 5 × 10 EGFR / MC38 cells were cultured. 5 Mice were inoculated into the right flank. Eight days after tumor inoculation, the mice were treated with 100 mg / kg of 10 ... 3Mice were randomized into study groups (n=5 per group) based on the tumor size. The human IgG1 antibody cetuximab and the anti-EGFR / anti-4-1BB bispecific antibodies (ET(WT)×1A10 M12, ET(NA)×1A10 M12) were intraperitoneally administered to mice at a dose of 10 mg / kg twice weekly for 4 weeks. Tumor size was measured with a digital caliper.
[0166] The results are shown in Figure 11. As shown in Figure 11, the anti-EGFR / anti-4-1BB bispecific antibody exhibited superior antitumor effects in human EGFR / MC38 tumors compared to cetuximab. NA )×1A10 Most mice treated with M12 were cured.
[0167] 9.2. Assessing the Efficacy of Tumor-Specific Memory T Cells Mice cured by ET(WT)×1A10 M12 and ET(NA)×1A10 M12 were rechallenged with human EGFR / MC38 tumor cells (Biocytogen) and B16F10 tumor cells (ATCC) in both flanks 100 days after tumor injection. Mice were drug-free during the rechallenge study. Tumor size was measured with digital calipers.
[0168] The results are shown in Figure 12. As shown in Figure 12, the development of human EGFR / MC38 tumors was not observed. In addition, the growth of B16F10 tumors was also significantly affected by EGFR(WT) x 1A10 M12 treatment and EGFR( NA )×1A10 was suppressed by M12 treatment.
[0169] Example 10 Antibody-dependent cell-mediated cytotoxicity (ADCC) activity (NA scaffold vs. WT) 10.1. NK cell-mediated ADCC In this example, human peripheral blood-derived CD56 +NK cells were used as effector cells, and DLD-1 cells (ATCC) expressing EGFR and labeled with CellTrace Violet (Thermo Fisher Scientific) were used as target cells. The cells were co-cultured at 37°C with 50 nM of anti-EGFR / anti-4-1BB bispecific antibody (Example 3) at an effector:target ratio of 5:1. After 4 hours, the cells were stained with Fixable Viablity dye (eBioscience™), and the ratio of target dead cells was analyzed by flow cytometry.
[0170] The results obtained are shown below in Figure 13. As shown in Figure 13, the IgG1 type (WT) anti-EGFR / anti-4-1BB bispecific antibody exhibited a significant ADCC effect mediated by NK cells.
[0171] 10.2. 4-1BB signaling activation depends on FcγRIIb engagement In this example, FcγRIIb-expressing CHO-K1 cells (Promega) were seeded into 96-well assay plates and cultured overnight. On the day of the assay, Jurkat / 4-1BB cells (Promega) were seeded into the 96-well plates. The cells were incubated with titrated amounts of anti-EGFR / anti-4-1BB bispecific antibodies in the presence (FcγRIIb-dependent) or absence (FcγRIIb-independent) of FcγRIIb-expressing CHO-K1 cells (Promega). Six hours after induction, Bio-Glo™ luciferase assay reagent was added, and luminescence was determined using a SpectraMax L luminometer (Molecular Devices). Four-parameter logistic curve analysis was performed using GraphPad Prism® software.
[0172] The results obtained are shown in Tables 35 (FcγRIIb-dependent 4-1BB bioassay) and 36 (FcγRIIb-independent 4-1BB bioassay) below, and in Figures 14a (FcγRIIb-dependent 4-1BB bioassay) and 14b (FcγRIIb-independent 4-1BB bioassay). TIFF0007738545000035.tif71170TIFF0007738545000036.tif70170
[0173] As shown in Tables 35 and 36 and Figures 14a and 14b, the urelumab treatment group showed a 14.2-fold difference in maximum RLU and EC 50 The results showed a 2.3-fold difference in RLU. The four anti-EGFR / anti-4-1BB bispecific antibodies showed significantly lower RLU than urelumab, regardless of the presence or absence of FcγRIIb CHO-K1 cells. These data indicated that all tested anti-EGFR / anti-4-1BB bispecific antibodies offer potential benefits compared to urelumab, which caused severe toxicity in clinical studies (NCT00309023, NCT00612664, NCT014712210).
[0174] All references cited herein, including publications, patent applications, and patents, are incorporated by reference to the same extent as if each reference was individually and specifically indicated to be incorporated by reference and was set forth in its entirety herein.
[0175] Unless otherwise indicated herein or the context clearly dictates to the contrary, in the context of describing the invention (and particularly in the context of the claims which follow), the use of the terms "a" and "an" and "the" referents, as well as "at least one" and "one or more" referents, and similar referents, shall be understood to cover both the singular and plural referents. Unless otherwise indicated herein or the context clearly dictates to the contrary, the use of the term "at least one" (or "one or more") following one or more items in a list (e.g., "at least one of A and B") shall be understood to mean one item selected from the listed items (A or B), or any combination of two or more of the listed items (A and B). The terms "comprising," "having," "including," and "containing" shall be understood to be open-ended (i.e., meaning "including, but not limited to") unless otherwise noted. Unless otherwise indicated herein, the recitation of ranges of values herein is intended only to serve as a shorthand method of referring individually to each separate value falling within the range, and each separate value is incorporated into the present specification as if it were individually recited herein. Unless otherwise indicated herein or unless the context clearly dictates otherwise to the contrary, all methods described herein can be performed in any suitable order. The use of any and all examples or exemplary language (e.g., "etc.") presented herein is intended only to better illustrate the invention and does not pose a limitation on the scope of the invention unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the invention.
[0176] Preferred embodiments of the present invention are described herein, including the best mode known to the inventors for carrying out the invention. Variations of these preferred embodiments may become apparent to those of skill in the art upon reading the foregoing description. The inventors expect that skilled artisans will employ such variations where appropriate, and the inventors intend that the invention may be practiced otherwise than as specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Furthermore, any combination of the above-described elements in all possible variations thereof is encompassed by the present invention unless otherwise indicated herein or the context clearly dictates otherwise to the contrary.
Claims
1. (a) a 4-1BB targeting moiety that is an anti-4-1BB scFv; and (b) comprising an EGFR targeting portion that is a full-length form of an anti-EGFR antibody; anti-4-1BB scFv, (1) H-CDR1 consisting of the amino acid sequence of SEQ ID NO: 1, H-CDR2 consisting of the amino acid sequence of SEQ ID NO: 4, H-CDR3 consisting of the amino acid sequence of SEQ ID NO: 7, L-CDR1 consisting of the amino acid sequence of SEQ ID NO: 12, L-CDR2 consisting of the amino acid sequence of SEQ ID NO: 14, and L-CDR3 consisting of the amino acid sequence of SEQ ID NO: 16; (2) H-CDR1 consisting of the amino acid sequence of SEQ ID NO: 1, H-CDR2 consisting of the amino acid sequence of SEQ ID NO: 4, H-CDR3 consisting of the amino acid sequence of SEQ ID NO: 8, L-CDR1 consisting of the amino acid sequence of SEQ ID NO: 12, L-CDR2 consisting of the amino acid sequence of SEQ ID NO: 14, and L-CDR3 consisting of the amino acid sequence of SEQ ID NO: 16; (3) H-CDR1 consisting of the amino acid sequence of SEQ ID NO: 1, H-CDR2 consisting of the amino acid sequence of SEQ ID NO: 4, H-CDR3 consisting of the amino acid sequence of SEQ ID NO: 9, L-CDR1 consisting of the amino acid sequence of SEQ ID NO: 12, L-CDR2 consisting of the amino acid sequence of SEQ ID NO: 14, and L-CDR3 consisting of the amino acid sequence of SEQ ID NO: 16; (4) H-CDR1 consisting of the amino acid sequence of SEQ ID NO: 2, H-CDR2 consisting of the amino acid sequence of SEQ ID NO: 5, H-CDR3 consisting of the amino acid sequence of SEQ ID NO: 10, L-CDR1 consisting of the amino acid sequence of SEQ ID NO: 12, L-CDR2 consisting of the amino acid sequence of SEQ ID NO: 14, and L-CDR3 consisting of the amino acid sequence of SEQ ID NO: 16; or (5) H-CDR1 consisting of the amino acid sequence of SEQ ID NO: 3, H-CDR2 consisting of the amino acid sequence of SEQ ID NO: 6, H-CDR3 consisting of the amino acid sequence of SEQ ID NO: 11, L-CDR1 consisting of the amino acid sequence of SEQ ID NO: 13, L-CDR2 consisting of the amino acid sequence of SEQ ID NO: 15, and L-CDR3 consisting of the amino acid sequence of SEQ ID NO: 17; 1. An anti-4-1BB / anti-EGFR bispecific antibody comprising:
2. anti-4-1BB scFv, (1) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30; or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 24 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 33; (2) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 19 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30 or 31; or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 25 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 33 or 34; (3) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 20 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30 or 31; (4) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 21 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30; a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 22 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 31; a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 33; or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:28 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:34; or (5) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 23 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 32; or a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 29 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 88; The anti-4-1BB / anti-EGFR bispecific antibody of claim 1, comprising:
3. The anti-4-1BB / anti-EGFR bispecific antibody according to claim 1 or 2, wherein the anti-4-1BB scFv further comprises a peptide linker between the heavy chain variable region and the light chain variable region.
4. The anti-4-1BB / anti-EGFR bispecific antibody according to any one of claims 1 to 3, wherein the full-length anti-EGFR antibody is cetuximab.
5. The full-length form of the anti-EGFR antibody: H-CDR1 consisting of the amino acid sequence of SEQ ID NO: 65; H-CDR2 consisting of the amino acid sequence of SEQ ID NO: 66; H-CDR3 consisting of the amino acid sequence of SEQ ID NO: 67; L-CDR1 consisting of the amino acid sequence of SEQ ID NO: 68; L-CDR2 consisting of the amino acid sequence of SEQ ID NO: 69; and L-CDR3 consisting of the amino acid sequence of SEQ ID NO: 70 The anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 4, comprising:
6. The full-length form of the anti-EGFR antibody: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 71; and A light chain variable region comprising the amino acid sequence of SEQ ID NO: 72 The anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 5, comprising:
7. A full-length anti-EGFR antibody or: A heavy chain comprising the amino acid sequence of SEQ ID NO: 73 or 74; and A light chain comprising the amino acid sequence of SEQ ID NO: 75 The anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 6, comprising:
8. A polypeptide comprising the amino acid sequence of SEQ ID NO: 76, 77, 78, 79, 80, 81, 82, 83, or 84; and A polypeptide comprising the amino acid sequence of SEQ ID NO: 75 The anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 7, comprising:
9. A polypeptide comprising the amino acid sequence of SEQ ID NO: 79; and A polypeptide comprising the amino acid sequence of SEQ ID NO: 75 The anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 8, comprising:
10. A pharmaceutical composition for treating or preventing cancer, comprising the anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 9 and a pharmaceutically acceptable carrier.
11. The pharmaceutical composition of claim 10, wherein the cancer is characterized by expression of EGFR.
12. A pharmaceutical composition for enhancing immune responses, comprising the anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 9 and a pharmaceutically acceptable carrier.
13. 10. The anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 9 for use in the treatment or prevention of cancer.
14. The anti-4-1BB / anti-EGFR bispecific antibody of claim 13, wherein the cancer is characterized by expression of EGFR.
15. An anti-4-1BB / anti-EGFR bispecific antibody according to any one of claims 1 to 9 for use in enhancing an immune response.
16. A polynucleotide encoding the anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 9.
17. A recombinant vector comprising the polynucleotide of claim 16.
18. A recombinant cell comprising the polynucleotide of claim 16.
19. A method for preparing the anti-4-1BB / anti-EGFR bispecific antibody of any one of claims 1 to 9, comprising expressing the polynucleotide of claim 16 in a cell.
Citation Information
Patent Citations
Novel bispecific polypeptides against CD137
WO2017182672A1