Topical formulations of recombinant collagen

Abstract

To provide topical formulations of recombinant collagens.SOLUTION: This disclosure provides methods of improving firmness, elasticity, brightness, hydration, tactile texture or visual texture of skin. The method comprises topically applying non-naturally occurring truncated collagen molecules to skin. Such a polypeptide may be a non-naturally occurring polypeptide and / or a recombinant polypeptide, including one or more amino acid sequences truncated relative to a naturally occurring collagen, such as a naturally occurring collagen described herein.SELECTED DRAWING: None

Description

[Technical Field]

[0001] cross reference This application claims the benefit of U.S. Provisional Application No. 62 / 827,662, filed April 1, 2019, which is incorporated herein by reference in its entirety. [Background technology]

[0002] background Collagen and similar proteins are the most abundant proteins in the biosphere. Collagen is a structural protein found in the skin, connective tissue, and bones of animals and other tissues. In humans, the amount of collagen present in the body is about one-third of the total protein and accounts for about three-quarters of the dry weight of skin.

[0003] The structure of native collagen can be a triple helix, with three polypeptide chains joining together to form a helical coil. Each polypeptide chain is composed of a repeating triplet amino acid sequence, designated GLY-XY. X and Y can be any amino acid, but the first amino acid is glycine. The amino acids proline and hydroxyproline are found in high concentrations in collagen. The most common triplet is glycine-proline-hydroxyproline (Gly-Pro-Hyp), which accounts for approximately 10.5% of the triplets in collagen.

[0004] Gelatin is a product obtained by partial hydrolysis of certain (e.g., natural) collagen. Typically, gelatin is produced by acid hydrolysis, alkaline hydrolysis, and enzymatic hydrolysis, or by exposing collagen to heat in an aqueous solution (e.g., by boiling animal bones and skin, boiling fish scales, etc.).

[0005] Gelatin is used in numerous products, including cosmetics, foods, pharmaceuticals, medical devices, photographic film, adhesives, binders, and many others. Gelatin's physical and chemical properties are tailored to specific applications. These physical / chemical properties include gel strength, melting temperature, viscosity, color, turbidity, pH, isoelectric point, etc. Summary of the Invention [Means for solving the problem]

[0006] Abstract In certain embodiments, there are various polypeptides, compositions comprising such polypeptides, and methods of using such polypeptides and / or compositions. In certain embodiments, such polypeptides include non-naturally occurring and / or recombinant polypeptides that include one or more amino acid sequences that are truncated relative to native collagen, e.g., native collagen as described herein. In certain instances, such polypeptides are described herein as "truncated collagens." In certain embodiments, the polypeptides include one or more (e.g., two or more) truncated amino acid sequences of native human collagen. In other specific embodiments, the polypeptides include one or more (e.g., two or more) truncated amino acid sequences of native jellyfish collagen. In one aspect, methods for providing benefits to skin (e.g., the skin of an individual, e.g., human) (e.g., increasing skin firmness, elasticity, brightness, hydration, tactile texture, or visual texture) are provided. In some embodiments, the method comprises topically applying to the skin a polypeptide described herein (e.g., a non-naturally occurring truncated collagen as described herein) or a formulation (e.g., which includes a polypeptide such as a non-naturally occurring truncated collagen).

[0007] In certain aspects, methods are provided for reducing lines or wrinkles present on the skin or reducing erythema on the skin. In some embodiments, the methods include topically applying to the skin a polypeptide described herein (e.g., a non-naturally occurring truncated collagen as described herein) or a formulation thereof. In some embodiments, formulations comprising a polypeptide described herein, such as a non-naturally occurring truncated collagen, are also provided herein.

[0008] In certain instances, the polypeptides (e.g., truncated collagens) described herein are useful in or for increasing skin firmness, elasticity, brightness, moisture retention, tactile texture, and / or visual texture. In some instances, the polypeptides (e.g., truncated collagens) described herein are useful in or for reducing lines or wrinkles present in the skin or reducing skin erythema. In certain embodiments, the polypeptide (e.g., truncated collagen) is or comprises truncated jellyfish collagen (e.g., a truncated amino acid sequence of naturally occurring jellyfish collagen). In other certain embodiments, the polypeptide (e.g., truncated collagen) is or comprises truncated human collagen (e.g., a truncated amino acid sequence of naturally occurring human collagen).

[0009] In some embodiments, a polypeptide (e.g., a truncated collagen) (e.g., useful in the methods disclosed herein) is or comprises a truncated amino acid sequence relative to naturally occurring (e.g., human or jellyfish (hydrozoan)) collagen. In some cases, such polypeptides are referred to herein as non-naturally occurring collagens. In certain embodiments, the non-naturally occurring collagen is or comprises the amino acid sequence of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:27, and / or SEQ ID NO:29, or a homolog thereof (e.g., a homolog having at least 85%, at least 90%, at least 95%, or at least 98% sequence identity thereto). In more particular embodiments, the non-naturally occurring collagen is the amino acid sequence of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:27, or SEQ ID NO:29, or a homolog thereof (e.g., a homolog having at least 85%, at least 90%, at least 95%, or at least 98% sequence identity thereto).

[0010] In certain embodiments, compositions are provided herein. In some embodiments, such compositions comprise any of the polypeptides described herein (e.g., truncated collagen or non-naturally occurring collagen). In one aspect, compositions are provided comprising any suitable amount of any of the polypeptides provided herein (e.g., truncated collagen or non-naturally occurring collagen), for example, 0.005% to 30% w / w. The compositions can further comprise at least one additional ingredient, including an excipient, a topical carrier, or a preservative.

[0011] In certain embodiments, the compositions provided herein are topical compositions, e.g., compositions formulated and / or suitable for topical administration or topical use. In one aspect, the present invention provides a method for providing a benefit (e.g., as described herein) to an individual's skin, comprising topically administering a topical composition to the skin. In certain embodiments, the topical composition is used in a method for reducing skin damage, promoting repair of damaged skin, or stimulating collagen production by skin cells. In certain embodiments, the topical composition is used in a method for increasing, promoting, stimulating, or otherwise increasing elastin production in the skin.

[0012] One aspect provides a method of applying collagen or a composition comprising collagen to the skin of a subject.

[0013] As discussed herein, in some embodiments, the polypeptides provided herein are or comprise a truncated amino acid sequence relative to native (e.g., human or jellyfish (hydrozoan)) collagen. In certain embodiments, such polypeptides are truncated collagens (e.g., comprise one or more truncated amino acid sequences relative to native collagen). In some embodiments, the truncated collagen is jellyfish collagen or human collagen. In various embodiments, the collagen is truncated at the C-terminus, the N-terminus, internally truncated, or both the C-terminus and the N-terminus (e.g., relative to native collagen). In one embodiment, the collagen is truncated at both the C-terminus and the N-terminus (e.g., relative to native collagen). In certain embodiments, the polypeptides provided herein are or comprise truncated collagens of any suitable truncation, such as a truncation at the C-terminus, the N-terminus, and / or one or more internal truncations. In some embodiments, shortening of collagen is appropriate to achieve advantageous results (e.g., improved results compared to native collagen and / or added benefits compared to native collagen) and / or to shorten the length of collagen while retaining one or more advantageous aspects of collagen. In some embodiments, the polypeptides provided herein are or comprise collagen that has been shortened in such a way as to retain one or more local benefits of collagen.

[0014] In some embodiments, truncated collagens (amino acid sequences thereof) (e.g., of the polypeptides provided herein) are truncated at the C-terminus by any suitable number of amino acid residues, e.g., up to 10, 10-800, 10-700, 10-500, 10-400, 10-300, 50-800, 50-700, 50-600, 50-500, 50-400, etc. In certain embodiments, truncated collagens (amino acid sequences thereof) (e.g., of the polypeptides provided herein) are truncated at the N-terminus by any suitable number of amino acid residues, e.g., up to 10, 10-900, 10-800, 10-700, 10-500, 10-400, 10-300, 50-800, 50-700, 50-600, 50-500, 50-400, etc. In some embodiments, truncated collagens (the amino acid sequences thereof) (e.g., of the polypeptides provided herein) are internally truncated by any suitable number of amino acid residues, e.g., up to 10, 10-900, 10-800, 10-700, 10-500, 10-400, 10-300, 50-800, 50-700, 50-600, 50-500, 50-400, etc. In certain embodiments, truncated collagens (the amino acid sequences thereof) (e.g., of the polypeptides provided herein) are truncated at the C-terminus by 10 to 800 amino acids and / or at the N-terminus by 10 to 800 amino acids.In another embodiment, the truncated collagen (the amino acid sequence thereof) (e.g., of the polypeptides provided herein) is between 10 and 900 amino acids in length, between 10 and 800 amino acids in length, between 10 and 700 amino acids in length, between 10 and 600 amino acids in length, between 10 and 500 amino acids in length, between 10 and 400 amino acids in length, between 10 and 300 amino acids in length, between 10 and 200 amino acids in length, between 10 and 100 amino acids in length, between 10 and 50 amino acids in length, between 50 and 800 amino acids in length, between 50 and 700 amino acids in length, between 50 and 600 amino acids in length, between 50 and 500 amino acids in length, between 50 and 400 amino acids in length, between 50 and 300 amino acids in length, between 50 and 200 amino acids in length, or between 50 and 100 amino acids in length.

[0015] In certain embodiments, provided herein are polypeptides that are or include the amino acid sequence of human (e.g., human type 21) collagen. In certain embodiments, the truncated human collagen is truncated human type 21 collagen. In various embodiments, the truncation is according to any of the disclosures provided herein. In certain embodiments, the disclosed truncated human type 21 collagen is SEQ ID NO: 16 (or a homolog thereof, e.g., having at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 98% sequence identity, or other sequence identity provided herein to the amino acid sequence of SEQ ID NO: 16). In various embodiments, such polypeptides are provided in any of the compositions, formulations, or methods provided herein.

[0016] In certain embodiments, provided herein are polypeptides that are or include the amino acid sequence of jellyfish (hydrozoan) collagen. In various embodiments, the truncation is according to any of the disclosures provided herein. In certain embodiments, the disclosed truncated jellyfish collagen is SEQ ID NO: 5 (or a homolog thereof, e.g., having at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 98% sequence identity, or other sequence identity provided herein to the amino acid sequence of SEQ ID NO: 5). In various embodiments, such polypeptides are provided in any of the compositions, formulations, or methods provided herein.

[0017] In certain embodiments, provided herein are methods that include administering a polypeptide (e.g., a polypeptide that is or includes a truncated collagen described herein) to the skin of an individual, e.g., to provide a benefit to the individual or to the skin. In some cases, the benefit provided to the skin is improved skin firmness, improved skin elasticity, improved skin moisture retention, improved skin texture, improved skin brightness, reduced skin wrinkles, reduced skin erythema, improved collagen production in the skin, improved or increased elastin production in the skin, antioxidant protection for the skin, reduced redness of the skin, or other benefit, or a combination of benefits as described herein. In various cases, the improvement in skin characteristics or benefit provided by the methods provided herein is determined by any suitable method, for example, by use of a measurement tool or by evaluation by a clinician. In one aspect, a method of increasing skin firmness is provided, wherein skin firmness is increased by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, or 75%. In one embodiment, skin firmness is measured using a cutometer.

[0018] Another aspect provides a method of increasing skin elasticity, wherein skin firmness is increased by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, or 75%. In one embodiment, skin elasticity is measured using a Cutometer.

[0019] In another aspect, a method of increasing skin moisture retention is provided, wherein skin moisture retention is increased by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, or 75%. In one embodiment, skin moisture retention is measured with a corneometer.

[0020] In one aspect, a method of increasing skin firmness is provided, in which skin firmness is increased. In one embodiment, skin firmness is determined by an expert clinical grader.

[0021] In one aspect, a method of increasing skin elasticity is provided, in which skin elasticity is increased, hi one embodiment, skin elasticity is determined by an expert clinical grader.

[0022] In one aspect, a method of increasing skin lightness is provided, wherein skin lightness is increased, hi one embodiment, skin lightness is determined by an expert clinical grader.

[0023] In another aspect, a method of increasing the tactile texture of the skin is provided, wherein the tactile texture of the skin is increased. In one embodiment, the tactile texture of the skin is determined by an expert clinical grader.

[0024] In one aspect, a method of increasing the visual texture of the skin is provided, wherein the visual texture of the skin is increased. In one embodiment, the visual texture of the skin is determined by an expert clinical grader.

[0025] In one aspect, a method of reducing lines or wrinkles present on the skin is provided, wherein the amount of lines or wrinkles present on the skin is reduced, hi one embodiment, the amount of lines or wrinkles present on the skin is determined by an expert clinical grader.

[0026] In one aspect, a method of reducing skin erythema is provided, wherein the skin erythema is reduced, hi one embodiment, the skin erythema is determined by an expert clinical grader.

[0027] Another aspect provides a method for stimulating collagen production in skin cells. In one embodiment, the method comprises applying to the skin a non-naturally occurring truncated collagen or a formulation containing a non-naturally occurring truncated collagen. In one embodiment, truncated jellyfish collagen or truncated human collagen stimulates collagen production. In a specific embodiment, the truncated human collagen is truncated human type 21 collagen of SEQ ID NO: 16. In another specific embodiment, the truncated jellyfish collagen is truncated jellyfish collagen of SEQ ID NO: 5.

[0028] Yet another embodiment provides a method of stimulating collagen production in skin cells, resulting in an increase in collagen in the skin by at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, or at least 10%.

[0029] A topical formulation is disclosed that includes truncated collagen and one or more additional ingredients selected from the group consisting of water, oil glycereth-8 esters, glycerin, coconut alkane, hydroxyethyl acrylate / sodium acryloyldimethyltaurate copolymer, pentylene glycol, disodium EDTA, caprylyl glycol, chlorphenesin, and phenoxyethanol. In one embodiment, the truncated collagen is truncated jellyfish collagen or truncated human collagen. In another embodiment, the truncated collagen is truncated human type 21 collagen. Yet another embodiment disclosed herein is a topical formulation that includes collagen and further includes a vegetable oil. In one embodiment, the vegetable oil is olive oil. In certain embodiments, for example, the following are provided: (Item 1) 1. A method for increasing skin firmness, elasticity, brightness, moisture retention, tactile texture, collagen content, elastin content, and reducing redness or visual texture, comprising topically applying to the skin a non-naturally occurring truncated collagen (e.g., the truncated collagen is a polypeptide comprising an amino acid sequence that is truncated relative to or includes the amino acid sequence of naturally occurring collagen, e.g., naturally occurring human or jellyfish collagen). (Item 2) A method for reducing lines or wrinkles present on the skin or reducing erythema of the skin, the method comprising topically applying to the skin a non-naturally occurring truncated collagen (e.g., the truncated collagen is a polypeptide comprising an amino acid sequence that is truncated relative to or includes the amino acid sequence of a naturally occurring collagen, such as naturally occurring human or jellyfish collagen). (Item 3) 3. The method according to item 1 or 2, wherein the non-naturally occurring truncated collagen is human collagen or jellyfish collagen. (Item 4) 4. The method according to item 1 or 3, wherein the truncated collagen is human collagen. (Item 5) 4. The method of claim 3, wherein the human collagen is C-terminally, N-terminally, internally truncated, or truncated at both the C-terminus and the N-terminus. (Item 6) 6. The method of claim 5, wherein the human collagen is truncated at both the C-terminus and the N-terminus. (Item 7) 7. The method of claim 6, wherein the collagen is truncated by between 10 and 800 amino acids at the C-terminus and / or by between 10 and 800 amino acids at the N-terminus. (Item 8) 8. The method of any one of items 3 to 7, wherein the truncated collagen is between 10 and 900 amino acids in length, between 10 and 800 amino acids in length, between 10 and 700 amino acids in length, between 10 and 600 amino acids in length, between 10 and 500 amino acids in length, between 10 and 400 amino acids in length, between 10 and 300 amino acids in length, between 10 and 200 amino acids in length, between 10 and 100 amino acids in length, between 10 and 50 amino acids in length, between 50 and 800 amino acids in length, between 50 and 700 amino acids in length, between 50 and 600 amino acids in length, between 50 and 500 amino acids in length, between 50 and 400 amino acids in length, between 50 and 300 amino acids in length, between 50 and 200 amino acids in length, or between 50 and 100 amino acids in length. (Item 9) 9. The method according to any one of items 1 to 8, wherein the collagen is truncated human type 21 collagen. (Item 10) Item 10. The method of item 9, wherein the truncated human type 21 collagen is SEQ ID NO: 16. (Item 11) 11. The method of any of items 1 to 10, wherein the firmness of the skin is increased by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, or 75% as measured using a Cutometer. (Item 12) 11. The method of any of items 1 to 10, wherein the elasticity of the skin is increased by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, or 75% as measured by a Cutometer. (Item 13) Item 13. The method of item 12, wherein the elasticity of the skin is increased by at least 8% as measured by a cutometer after one week of treatment. (Item 14) Item 13. The method of item 12, wherein the elasticity of the skin is increased by at least 25% as measured by a Cutometer after two weeks of treatment. (Item 15) Item 13. The method of item 12, wherein the elasticity of the skin is increased by at least 30% as measured by a Cutometer after two weeks of treatment. (Item 16) Item 13. The method of item 12, wherein the elasticity of the skin is increased by at least 100% as measured by a Cutometer after 4 weeks of treatment. (Item 17) 17. The method of any one of items 13 or 16, wherein the non-naturally occurring truncated collagen is applied to the skin as a facial serum comprising 0.1% w / w of the non-naturally occurring truncated collagen. (Item 18) 11. The method of any of items 1 to 10, wherein the moisture retention of the skin is increased by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, or 75% as measured by a corneometer. (Item 19) 11. The method of any of items 1 to 10, wherein the firmness of the skin is improved as judged by an expert clinical grader. (Item 20) 11. The method according to any of items 1 to 10, wherein the elasticity of the skin is improved as judged by an expert clinical grader. (Item 21) 11. The method of any of items 1 to 10, wherein the lightness of the skin is improved as judged by an expert clinical grader. (Item 22) Item 11. The method of any of items 1 to 10, wherein the collagen content of the skin is increased by at least 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, or 15% as measured by SIAscope. (Item 23) 23. The method of claim 22, wherein the collagen content of the skin is increased by at least 5% after 2 weeks. (Item 24) 23. The method of claim 22, wherein the collagen content of the skin is increased by at least 7% after 2 weeks. (Item 25) 23. The method of claim 22, wherein the collagen content of the skin is increased by at least 9% after 4 weeks. (Item 26) 11. The method of any of items 1 to 10, wherein the tactile texture of the skin is improved as judged by an expert clinical grader. (Item 27) 11. The method of any of items 1 to 10, wherein the visual texture of the skin is improved as judged by an expert clinical grader. (Item 28) 11. The method according to any of items 1 to 10, wherein the lines or wrinkles present on the skin are reduced as judged by an expert clinical grader. (Item 29) Item 29. The method of item 28, wherein the lines or wrinkles present on the skin are reduced by at least 10% as judged by a professional clinical grader. Item 29. The method of any one of items 1 to 10, wherein the erythema of the skin is reduced as judged by a professional clinical grader. (Item 30) 30. The method of claim 29, wherein the erythema of the skin is reduced by at least 10%, 20%, 30%, 40%, or 45% as judged by an expert clinical grader after two weeks of topical application. (Item 31) 30. The method of claim 29, wherein the erythema of the skin is reduced by at least 10%, 20%, 30%, 40%, 45%, 50%, or 55% as judged by an expert clinical grader after 4 weeks of topical application. (Item 32) 1. A method of stimulating collagen production in skin cells, comprising topically applying a non-naturally occurring truncated collagen to the skin. (Item 33) 33. The method of claim 32, wherein the non-naturally occurring truncated collagen is human collagen. (Item 34) 34. The method of claim 33, wherein the human collagen is C-terminally, N-terminally, internally truncated, or truncated at both the C-terminus and the N-terminus. (Item 35) 35. The method of claim 34, wherein the human collagen is truncated at both the C-terminus and the N-terminus. (Item 36) 36. The method of claim 35, wherein the collagen is truncated by between 10 and 800 amino acids at the C-terminus and / or by between 10 and 800 amino acids at the N-terminus. (Item 37) 37. The method of any of items 33 to 36, wherein the truncated collagen is between 10 and 900 amino acids in length, between 10 and 800 amino acids in length, between 10 and 700 amino acids in length, between 10 and 600 amino acids in length, between 10 and 500 amino acids in length, between 10 and 400 amino acids in length, between 10 and 300 amino acids in length, between 10 and 200 amino acids in length, between 10 and 100 amino acids in length, between 10 and 50 amino acids in length, between 50 and 800 amino acids in length, between 50 and 700 amino acids in length, between 50 and 600 amino acids in length, between 50 and 500 amino acids in length, between 50 and 400 amino acids in length, between 50 and 300 amino acids in length, between 50 and 200 amino acids in length, or between 50 and 100 amino acids in length. (Item 38) 38. The method according to any one of items 32 to 37, wherein the collagen is truncated human type 21 collagen. (Item 39) 39. The method of claim 38, wherein the truncated human type 21 collagen is SEQ ID NO: 16. (Item 40) 39. The method of any of items 32 to 39, wherein the collagen in the skin is increased by at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, or at least 10%. (Item 41) 39. The method of any of items 32 to 39, wherein the collagen in the skin is increased by at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, or at least 10%. (Item 42) A topical formulation comprising truncated human type 21 collagen and one or more additional ingredients selected from the group consisting of water, oil glycereth-8 esters, glycerin, coconut alkane, hydroxyethyl acrylate / sodium acryloyldimethyltaurate copolymer, pentylene glycol, disodium EDTA, caprylyl glycol, chlorphenesin, and phenoxyethanol. (Item 43) 43. The topical formulation of item 42, wherein the truncated human type 21 collagen is SEQ ID NO: 16. (Item 44) 44. The topical formulation according to item 42 or item 43, wherein the oil is a vegetable oil, preferably olive oil. (Item 45) Item 45. The topical formulation of item 43 or item 44, wherein the truncated human type 21 collagen upregulates elastin expression to a higher level when applied to human primary fibroblasts than when marine collagen is applied to human primary fibroblasts. (Item 46) A topical formulation comprising truncated jellyfish collagen and one or more additional ingredients selected from the group consisting of water, oil glycereth-8 esters, glycerin, coconut alkane, hydroxyethyl acrylate / sodium acryloyldimethyltaurate copolymer, pentylene glycol, disodium EDTA, caprylyl glycol, chlorphenesin, and phenoxyethanol. (Item 47) 47. The topical formulation of item 46, wherein the truncated jellyfish collagen is SEQ ID NO: 5. (Item 48) 48. The topical formulation according to item 46 or item 47, wherein the oil is a vegetable oil, preferably olive oil.

[0030] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which: [Brief explanation of the drawings]

[0031] [Figure 1] FIG. 1 shows the effect of exemplary polypeptides provided herein (comprising truncated human collagen amino acid sequences) on collagen type 1 protein secretion in fibroblasts.

[0032] [Figure 2A] FIG. 2A shows collagen type 1 mRNA expression in fibroblasts treated with exemplary polypeptides provided herein (comprising truncated human collagen amino acid sequences).

[0033] [Figure 2B] FIG. 2B shows the expression of elastin mRNA in fibroblasts treated with exemplary polypeptides provided herein (comprising truncated human collagen amino acid sequences).

[0034] [Figure 2C] FIG. 2C shows fibronectin mRNA expression in fibroblasts treated with exemplary polypeptides provided herein (comprising truncated human collagen amino acid sequences).

[0035] [Figure 3] FIG. 3 shows the expression of IL-1a in human primary keratinocytes treated with exemplary polypeptides provided herein, including truncated human collagen amino acid sequences.

[0036] [Figure 4] FIG. 4 shows the antioxidant capacity of exemplary polypeptides provided herein, including truncated human collagen amino acid sequences.

[0037] [Figure 5] FIG. 5 shows the viability of UVB-irradiated keratinocytes treated with exemplary polypeptides provided herein, including truncated human collagen amino acid sequences.

[0038] [Figure 6] FIG. 6 illustrates skin elasticity following treatment with exemplary polypeptides provided herein, including truncated human collagen amino acid sequences.

[0039] [Figure 7] FIG. 7 shows skin collagen content after treatment with exemplary polypeptides provided herein, including truncated human collagen amino acid sequences.

[0040] [Figure 8] FIG. 8 shows quantification of skin redness following treatment with exemplary polypeptides provided herein (comprising truncated human collagen amino acid sequences).

[0041] [Figure 9] FIG. 9 shows quantification of skin wrinkles following treatment with exemplary polypeptides provided herein (comprising truncated human collagen amino acid sequences).

[0042] [Figure 10] FIG. 10 shows the secretion of collagen type 1 protein by a human skin tissue model treated with exemplary polypeptides provided herein, including truncated jellyfish collagen amino acid sequences.

[0043] [Figure 11] FIG. 11 shows UVB-induced TT dimers in keratinocytes treated with exemplary polypeptides provided herein (comprising truncated jellyfish collagen amino acid sequences).

[0044] [Figure 12] FIG. 12 shows keratinocyte viability after UVB irradiation treated with exemplary polypeptides provided herein, including truncated jellyfish collagen amino acid sequences.

[0045] [Figure 13] FIG. 13 shows cell viability upon treatment with urban dust and an exemplary polypeptide provided herein (comprising a truncated jellyfish collagen amino acid sequence).

[0046] [Figure 14] FIG. 14 shows the relative expression of IL-1a induced by UVB after treatment with exemplary polypeptides provided herein (comprising truncated jellyfish collagen amino acid sequences).

[0047] [Figure 15] FIG. 15 illustrates the antioxidant capacity of exemplary polypeptides provided herein, including truncated jellyfish collagen amino acid sequences.

[0048] [Figure 16] FIG. 16 illustrates skin moisture retention after treatment with exemplary polypeptides provided herein, including truncated jellyfish collagen amino acid sequences.

[0049] [Figure 17] FIG. 17 illustrates skin elasticity following treatment with exemplary polypeptides provided herein, including truncated jellyfish collagen amino acid sequences. DETAILED DESCRIPTION OF THE INVENTION

[0050] explanation In the following description, certain specific details are set forth in order to provide a thorough understanding of various embodiments of the present disclosure. However, it will be understood by those skilled in the art that the disclosure may be practiced without these details.

[0051] As used herein, the term "about" generally means ±10%.

[0052] The term "consisting of" means "including and limited to." Generally, a disclosure of "comprising" includes a disclosure of "consisting of."

[0053] The term "consisting essentially of" means that a composition, method, or structure may include additional ingredients, steps, and / or moieties only if the additional ingredients, steps, and / or moieties do not materially alter the basic and novel characteristics of the claimed composition, method, or structure. Generally, a disclosure of "comprising" includes a disclosure of "consisting essentially of."

[0054] As used herein, the singular forms "a," "an," and "the" include plural references unless the context clearly dictates otherwise. For example, the term "a compound" or "at least one compound" can include a plurality of compounds, including mixtures thereof.

[0055] Throughout this document, various embodiments of the present disclosure may be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and is not to be construed as an inflexible limitation on the scope of the present disclosure. Thus, the description of a range shall be considered to specifically disclose not only each individual numerical value within that range, but also all possible subranges. For example, description of a range such as 1 to 6 shall be considered to specifically disclose subranges such as 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 6, 3 to 6, etc., as well as each individual numerical value within that range, e.g., 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.

[0056] Whenever a range of numerical values ​​is given herein, it is meant to include any recited number (fractional or integer) within the given range. The phrases "ranging between" a first denoted value and a second denoted value and "ranging from" a first denoted value to a second denoted value are used interchangeably herein and are meant to include the first denoted value and the second denoted value, and all fractional and integer numbers therebetween.

[0057] As used herein, the term "collagen" or "collagen-like" refers to a (e.g., monomeric) polypeptide that, in some cases, can combine with one or more collagen or collagen-like polypeptides to form a quaternary structure. Non-limiting examples of collagen include human type 21 alpha 1 collagen (e.g., SEQ ID NO: 31), human type 1 alpha 2 collagen (e.g., SEQ ID NO: 32), and jellyfish (hydrozoan) collagen (e.g., SEQ ID NO: 33). In some cases, collagen can be treated with acid, base, or heat to prepare gelatin. While the quaternary structure of native collagen is typically a triple helix composed of three polypeptides, it should be noted that the "truncated collagens" or polypeptides comprising "truncated collagens" provided herein may or may not have such a quaternary structure, and do not necessarily have such a quaternary structure. In certain instances, of the three polypeptides that form native collagen, two are typically identical and are referred to as alpha chains. The third polypeptide is referred to as a beta chain. In certain instances, typical native collagen can be referred to as AAB, where collagen is composed of two alpha ("A") chains and one beta ("B") chain. In certain instances, polypeptides, including "truncated collagens" provided herein, may or may not have such structural elements. The term "collagen" or "collagen-like" can refer to alpha chain polypeptides, beta chain polypeptides, or both alpha and beta chain polypeptides. As used herein, the term "procollagen" generally refers to a polypeptide produced by cells that can be processed into naturally occurring collagen.

[0058] As used herein, the term "expression vector" or "vector" generally refers to a nucleic acid assembly capable of directing the expression of an exogenous gene. Expression vectors can include a promoter operably linked to the exogenous gene, restriction endonuclease sites, nucleic acid encoding one or more selectable markers, and other nucleic acid useful for practicing recombinant techniques.

[0059] The term "fibroblast" as used herein generally refers to cells that synthesize procollagen and other structural proteins. Fibroblasts are widely distributed in the body and are found in skin, connective tissue, and other tissues.

[0060] The term "fluorescent protein" generally refers to a protein that can be used in genetic engineering techniques as a reporter for the expression of exogenous polynucleotides. This protein fluoresces when exposed to ultraviolet or blue light, emitting bright visible light. Proteins that emit green light include green fluorescent protein (GFP), and proteins that emit red light include red fluorescent protein (RFP).

[0061] The term "gelatin" as used herein generally refers to collagen that has been further processed by exposure to acid, base, or heat. In some cases, gelatin solutions form reversible gels that are used in foods, cosmetics, pharmaceuticals, industrial products, medical products, laboratory growth media, and many other applications.

[0062] The term "gene" as used herein generally refers to a polynucleotide that encodes a particular protein, and may refer to the coding region alone or may include regulatory sequences preceding (5' non-coding sequences) and following (3' non-coding sequences) the coding sequence.

[0063] The term "histidine tag" generally refers to a string of 2 to 30 consecutive histidine residues on a recombinant polypeptide.

[0064] The term "host cell" generally refers to a cell that has been engineered to express an introduced exogenous polynucleotide.

[0065] The term "keratinocyte" generally refers to a keratin-producing cell found in the epidermal layer of the skin.

[0066] As used herein, the term "lactamase" generally refers to an enzyme that hydrolyzes antibiotics that contain a lactam (cyclic amide) moiety. A "beta-lactamase" or "β-lactamase" is an enzyme that hydrolyzes antibiotics that contain a β-lactam moiety.

[0067] As used herein, the term "non-naturally occurring" refers to a gene, polypeptide, or protein, e.g., collagen, that is not normally found in nature. Non-naturally occurring collagen can be recombinantly prepared. Non-naturally occurring collagen can be recombinant collagen. In one embodiment, non-naturally occurring collagen is a truncated collagen. Other non-naturally occurring collagen polypeptides include chimeric collagens. Chimeric collagens are polypeptides in which a portion of a collagen polypeptide is adjacent to a portion of a second collagen polypeptide. For example, a collagen molecule containing a portion of jellyfish collagen adjacent to a portion of human collagen is a chimeric collagen. In another embodiment, non-naturally occurring collagens include fusion polypeptides containing additional amino acids, such as a secretion tag, a histidine tag, green fluorescent protein, a protease cleavage site, GEK repeats, GDK repeats, and / or beta-lactamase.

[0068] Generally, the disclosure of collagens or truncated collagens provided herein, e.g., having a particular amino acid sequence, includes polypeptides having or containing the exact amino acid sequence and homologs thereof. In some cases, homologs of the amino acid sequences provided herein may have longer or shorter sequences and may have substitutions of one or more amino acid residues of such amino acid sequences. Such homologs have a particular sequence identity to the listed sequence, e.g., in the amounts provided herein. Sequence identity, such as for purposes of assessing percent identity, may be determined using, but is not limited to, the Needleman-Wunsch algorithm (e.g., EMBOSS Neural Networks, available at www.ebi.ac.uk / Tools / psa / emboss_needle / nucleotide.html). Alignment can be measured by any suitable alignment algorithm, including the BLAST algorithm (see, e.g., the BLAST alignment tool available at blast.ncbi.nlm.nih.gov / Blast.cgi, with default settings where appropriate), or the Smith-Waterman algorithm (see, e.g., the EMBOSS Water aligner available at www.ebi.ac.uk / Tools / psa / emboss_water / nucleotide.html, with default settings where appropriate). Optimal alignment can be assessed using any suitable parameters of the selected algorithm, including default parameters. In some cases, the non-naturally occurring collagen may have at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% sequence identity to the sequences disclosed herein.

[0069] The term "protease cleavage site" generally refers to an amino acid sequence that is cleaved by a particular protease.

[0070] The term "secretion tag" or "signal peptide" generally refers to an amino acid sequence that recruits the cellular machinery of a host cell to transport an expressed protein to a specific location or cellular offspring within the host cell.

[0071] The term "truncated collagen" generally refers to a monomeric polypeptide smaller than full-length collagen, in which one or more portions of full-length collagen are absent. The collagen polypeptide may be truncated at the C-terminus, the N-terminus, by removal of an internal portion(s) of the full-length collagen polypeptide (e.g., internal truncation), or at both the C-terminus and the N-terminus. In a non-limiting embodiment, the truncated human collagen may comprise the amino acid sequence set forth in SEQ ID NO: 16, or a homolog thereof. In another non-limiting example, the truncated jellyfish collagen may comprise the amino acid sequence set forth in SEQ ID NO: 5, or a homolog thereof. Generally, the truncated collagens provided herein have similar or substantially similar functions to those of native or full-length collagen and / or may provide similar or substantially similar benefits (e.g., as provided herein) to those of native or full-length collagen. In some cases, the truncated collagens provided herein may have improved or increased functions and / or benefits (e.g., as provided herein) compared to native or full-length collagen.

[0072] When used in reference to an amino acid position, "truncation" encompasses said amino acid position. For example, an N-terminal truncation at amino acid position 100 of a full-length protein refers to a truncation of 100 amino acids from the N-terminus of the full-length protein (i.e., the truncated protein lacks amino acids 1-100 of the full-length protein). Similarly, a C-terminal truncation at amino acid position 901 of a full-length protein (assuming a 1000 amino acid full-length protein) refers to a truncation of 100 amino acids from the C-terminus (i.e., the truncated protein lacks amino acids 901-1000 of the full-length protein). Similarly, an internal truncation at amino acid positions 101 and 200 refers to an internal truncation of 100 amino acids from the full-length protein (i.e., the truncated protein lacks amino acids 101-200 of the full-length protein).

[0073] In some embodiments, the cell culture may further comprise one or more of ammonium chloride, ammonium sulfate, calcium chloride, amino acids, iron (II) sulfate, magnesium sulfate, peptone, potassium phosphate, sodium chloride, sodium phosphate, and yeast extract.

[0074] The host bacterial cells can be cultured continuously or discontinuously in a batch process, a fed-batch process, or a repeated fed-batch process.

[0075] Generally, the signal sequence may be a component of the expression vector, or may be part of the exogenous gene inserted into the vector. The selected signal sequence may be one that is recognized and processed (e.g., cleaved by a signal peptidase) by the host cell. For bacterial host cells that do not recognize and process the native signal sequence of the exogenous gene, the signal sequence may be substituted with any commonly known bacterial signal sequence. In some embodiments, recombinantly produced polypeptides may be targeted to the periplasmic space using the DsbA signal sequence. Dinh and Bernhardt, J Bacteriol, Sept. 2011, 4984-4987。

[0076] In one aspect, non-naturally occurring collagen produced by host cells is provided.Non-naturally occurring collagen can be jellyfish collagen or human collagen.Non-naturally occurring collagen can be truncated collagen.Truncation can be internal truncation (e.g., truncation of the internal portion), truncation at the N-terminal portion of collagen, truncation at the C-terminal portion of collagen, or truncation at both the C-terminal and N-terminal. Collagen can be truncated by truncations of between 50 and 1000 amino acids, between 50 and 950 amino acids, between 50 and 900 amino acids, between 50 and 850 amino acids, between 50 and 800 amino acids, between 50 and 850 amino acids, between 50 and 800 amino acids, between 50 and 750 amino acids, between 50 and 700 amino acids, between 50 and 650 amino acids, between 50 and 600 amino acids, between 50 and 650 amino acids, between 50 and 500 amino acids, between 50 and 450 amino acids, between 50 and 400 amino acids, between 50 and 350 amino acids, between 50 and 300 amino acids, between 50 and 250 amino acids, between 50 and 200 amino acids, between 50 and 150 amino acids, or between 50 and 100 amino acids. In another embodiment, the collagen is about 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990, 1000, 1010, 1020, 1030, 1040, 10 The polynucleotide sequences may be truncated by 70, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 650, 700, 750, 800, 850, 900, 950, or 1000 amino acids. Non-naturally occurring collagens may be encoded by portions or the entire polynucleotide sequences disclosed herein.

[0077] The truncated collagens disclosed herein may comprise a truncation relative to full-length collagen. In some embodiments, the truncated collagens disclosed herein may comprise a truncation relative to full-length human type 21 alpha 1 collagen. In some embodiments, the truncated collagens disclosed herein may comprise a truncation relative to full-length human type 1 alpha 2 collagen. In some embodiments, the truncated collagens disclosed herein comprise a truncation relative to full-length jellyfish (hydrozoan) collagen. Non-limiting examples of full-length collagens are provided in Table 1 below. [Table 1-1] [Table 1-2]

[0078] In some cases, truncated collagens as described herein may include an N-terminal truncation at any amino acid position between amino acid positions 1 and 548, between amino acid positions 1 and 553, between amino acid positions 1 and 558, between amino acid positions 1 and 563, between amino acid positions 1 and 568, or between amino acid positions 1 and 573 of SEQ ID NO: 31. In some cases, truncated collagens as described herein may include a C-terminal truncation at any amino acid position between amino acid positions 726 and 957, between amino acid positions 731 and 957, between amino acid positions 736 and 957, between amino acid positions 741 and 957, between amino acid positions 746 and 957, between amino acid positions 751 and 957, or between amino acid positions 756 and 957 of SEQ ID NO: 31. In some cases, truncated collagens as described herein may include both N-terminal and C-terminal truncations. For example, truncated collagens as described herein can comprise an N-terminal truncation at any amino acid position between amino acid positions 1 and 548; between amino acid positions 1 and 553; between amino acid positions 1 and 558; between amino acid positions 1 and 563; between amino acid positions 1 and 568; or between amino acid positions 1 and 573 of SEQ ID NO: 31; and a C-terminal truncation at any amino acid position between amino acid positions 726 and 957; between amino acid positions 731 and 957; between amino acid positions 736 and 957; between amino acid positions 741 and 957; between amino acid positions 746 and 957; between amino acid positions 751 and 957; or between amino acid positions 756 and 957 of SEQ ID NO: 31. In certain embodiments, truncated collagens disclosed herein can comprise an N-terminal truncation at amino acid position 558 of SEQ ID NO: 31 and a C-terminal truncation at amino acid position 746 of SEQ ID NO: 31.

[0079] In some cases, truncated collagens as described herein may include an N-terminal truncation at any amino acid position between amino acid positions 1 and 401; between amino acid positions 1 and 406; between amino acid positions 1 and 411; between amino acid positions 1 and 416; between amino acid positions 1 and 421; between amino acid positions 1 and 426; or between amino acid positions 1 and 431 of SEQ ID NO: 32. In some cases, truncated collagens as described herein may include a C-terminal truncation at any amino acid position between amino acid positions 585 and 1366; between amino acid positions 590 and 1366; between amino acid positions 595 and 1366; between amino acid positions 600 and 1366; between amino acid positions 605 and 1366; between amino acid positions 610 and 1366; between amino acid positions 615 and 1366; or between amino acid positions 620 and 1366 of SEQ ID NO: 32. In some cases, the truncated collagens described herein may include both N-terminal truncations and C-terminal truncations. For example, the truncated collagens described herein may include an N-terminal truncation at any amino acid position between amino acid positions 1 and 401, between amino acid positions 1 and 406, between amino acid positions 1 and 411, between amino acid positions 1 and 416, between amino acid positions 1 and 421, between amino acid positions 1 and 426, or between amino acid positions 1 and 431 of SEQ ID NO: 32; and a C-terminal truncation at any amino acid position between amino acid positions 585 and 1366, between amino acid positions 590 and 1366, between amino acid positions 595 and 1366, between amino acid positions 600 and 1366, between amino acid positions 605 and 1366, between amino acid positions 610 and 1366, between amino acid positions 615 and 1366, or between amino acid positions 620 and 1366 of SEQ ID NO: 32. In certain embodiments, the truncated collagens provided herein may comprise an N-terminal truncation at amino acid position 416 of SEQ ID NO:32; and a C-terminal truncation at amino acid position 605 of SEQ ID NO:32.

[0080] In some cases, the truncated collagens described herein may include an N-terminal truncation at any amino acid position between amino acid positions 1 and 101; between amino acid positions 1 and 106; between amino acid positions 1 and 111; between amino acid positions 1 and 116; between amino acid positions 1 and 121; or between amino acid positions 1 and 126 of SEQ ID NO: 32. In some cases, the truncated collagens described herein may include a C-terminal truncation at any amino acid position between amino acid positions 276 and 1366; between amino acid positions 281 and 1366; between amino acid positions 286 and 1366; between amino acid positions 291 and 1366; between amino acid positions 296 and 1366; between amino acid positions 301 and 1366; or between amino acid positions 306 and 1366 of SEQ ID NO: 32. In some cases, the truncated collagens described herein may include both an N-terminal truncation and a C-terminal truncation. For example, the truncated collagens described herein can include an N-terminal truncation at any amino acid position between amino acid positions 1 and 101; between amino acid positions 1 and 106; between amino acid positions 1 and 111; between amino acid positions 1 and 116; between amino acid positions 1 and 121; or between amino acid positions 1 and 126 of SEQ ID NO: 32; and a C-terminal truncation at any amino acid position between amino acid positions 276 and 1366; between amino acid positions 281 and 1366; between amino acid positions 286 and 1366; between amino acid positions 291 and 1366; between amino acid positions 296 and 1366; between amino acid positions 301 and 1366; or between amino acid positions 306 and 1366 of SEQ ID NO: 32. In certain embodiments, the truncated collagens provided herein can include an N-terminal truncation at amino acid position 111 of SEQ ID NO: 32; and a C-terminal truncation at amino acid position 291 of SEQ ID NO: 32.

[0081] In some cases, the truncated collagens described herein may include internal truncations at any amino acid position between amino acid positions 16 and 240; between amino acid positions 16 and 245; between amino acid positions 16 and 250; between amino acid positions 16 and 255; between amino acid positions 16 and 260; between amino acid positions 16 and 265; between amino acid positions 6 and 255; between amino acid positions 11 and 255; between amino acid positions 21 and 255; between amino acid positions 26 and 255; between amino acid positions 31 and 255; between amino acid positions 21 and 250; between amino acid positions 21 and 245; between amino acid positions 26 and 250; between amino acid positions 26 and 245; between amino acid positions 31 and 250; or between amino acid positions 31 and 245 of SEQ ID NO: 33. In certain embodiments, the truncated collagens described herein may include internal truncations at amino acid positions 16 and 255 of SEQ ID NO: 33.

[0082] In some cases, the truncated collagen may comprise any of the amino acid sequences provided in Table 2 below. In some cases, the truncated collagen may consist of any of the amino acid sequences provided in Table 2 below. In some cases, the truncated collagen may consist essentially of any of the amino acid sequences provided in Table 2 below. In certain embodiments, the non-naturally occurring collagen is or comprises the amino acid sequence of any one of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:27, and SEQ ID NO:29. In some embodiments, the truncated collagen comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to any one of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:27, and SEQ ID NO:29. [Table 2-1] [Table 2-2] [Table 2-3]

[0083] In some cases, the truncated collagen may be between 100 and 300 amino acids, between 150 and 250 amino acids, between 160 and 250 amino acids, between 160 and 220 amino acids, between 170 and 200 amino acids, between 180 and 190 amino acids, or between 185 and 190 amino acids in length.

[0084] In some embodiments, the non-naturally occurring collagen can further comprise an amino acid sequence comprising a secretion tag. The secretion tag can direct the collagen to the periplasmic space of the host cell. In certain embodiments, the signal peptide is derived from DsbA, PelB, OmpA, TolB, MalE, lpp, TorA, Hy1A, DegP, or a hybrid secretion tag comprising a portion of one secretion tag fused to a portion of a second secretion tag. In one aspect, the secretion tag can be bound to the non-naturally occurring collagen. In another aspect, the secretion tag can be cleaved from the non-naturally occurring collagen.

[0085] In some embodiments, the non-naturally occurring collagen comprises a histidine (or polyhistidine) tag. In certain embodiments, the histidine or polyhistidine tag is or comprises a sequence of 2 to 20 histidine residues attached to the collagen. In various embodiments, the histidine tag comprises 2 to 20 histidine residues, 5 to 15 histidine residues, 5 to 18 histidine residues, 5 to 16 histidine residues, 5 to 15 histidine residues, 5 to 14 histidine residues, 5 to 13 histidine residues, 5 to 12 histidine residues, 5 to 11 histidine residues, 5 to 10 histidine residues, 6 to 12 histidine residues, 6 to 11 histidine residues, or 7 to 10 histidine residues. Histidine tags can be useful in purifying proteins using chromatographic methods that utilize nickel-based chromatography media. Exemplary fluorescent proteins include green fluorescent protein (GFP) or red fluorescent protein (RFP). Fluorescent proteins are well known in the art. In one embodiment, the non-naturally occurring collagen comprises GFP and / or RFP. In one embodiment, a superfolder GFP is fused to the non-naturally occurring collagen. The superfolder GFP can be a GFP that folds properly even when fused to a poorly folding polypeptide. In one aspect, a histidine tag can be attached to the non-naturally occurring collagen. In another aspect, the histidine tag can be cleaved from the non-naturally occurring collagen.

[0086] In some embodiments, the non-naturally occurring collagen further comprises a protease cleavage site. Protease cleavage sites can be useful for cleaving recombinantly produced collagen to remove one or more portions of the polypeptide. Portions of the polypeptide that can be removed include secretion tags, histidine tags, fluorescent protein tags, and / or beta-lactamase. Proteases can include endoproteases, exoproteases, serine proteases, cysteine ​​proteases, threonine proteases, aspartic acid proteases, glutamic acid proteases, and metalloproteases. Exemplary protease cleavage sites include amino acids cleaved by thrombin, TEV protease, Factor Xa, enteropeptidase, and rhinovirus 3C protease. In one aspect, the cleavage tag is attached to the non-naturally occurring collagen. In another aspect, the cleavage tag is removed from the non-naturally occurring collagen by an appropriate protease.

[0087] In some embodiments, the non-naturally occurring collagen further comprises an enzyme that is a beta-lactamase. The beta-lactamase can be useful as a selectable marker. In one aspect, the beta-lactamase is bound to the non-naturally occurring collagen. In another aspect, the beta-lactamase is cleaved from the non-naturally occurring collagen.

[0088] Certain embodiments herein provide compositions or formulations (e.g., topical) comprising one or more polypeptides provided herein. In some embodiments, the compositions provide any suitable amount of a polypeptide provided herein, such as, for example, any suitable amount (e.g., an amount suitable to provide a benefit when dosed or administered to an individual or cell). In some particular embodiments, the composition comprises an amount suitable to provide a beneficial effect to the skin of an individual when administered to the skin of the individual (e.g., topically). In certain embodiments, the composition comprises between 0.001% and 30% w / w of a polypeptide (or non-naturally occurring collagen) as provided herein. In more specific embodiments, the composition comprises between 0.001% and 20% w / w of a polypeptide as provided herein (or non-naturally occurring collagen), between 0.001% and 10% w / w of a polypeptide as provided herein (or non-naturally occurring collagen), between 0.001% and 5% w / w of a polypeptide as provided herein (or non-naturally occurring collagen), between 0.001% and 2% w / w of a polypeptide as provided herein (or non-naturally occurring collagen), between 0.001% and 1% w / w of a polypeptide as provided herein (or non-naturally occurring collagen), between 0.001% and 0.5% w / w of a polypeptide as provided herein (or non-naturally occurring collagen), and between 0.001% and 0.2% w / w of a polypeptide as provided herein (or non-naturally occurring collagen).

[0089] In one aspect, the composition comprising non-naturally occurring collagen can be a personal care product (e.g., a cosmetic). In some embodiments, the composition is formulated for topical administration. The composition can include other cosmetic ingredients suitable for human use. The personal care product can be useful for preventing or treating UV damage to human skin or hair. The personal care product can be useful for increasing skin firmness, elasticity, brightness, moisture retention, tactile or visual texture, and / or stimulating collagen production. The personal care product can be useful for reducing skin redness. The personal care product can be applied to skin or hair. Compositions include, for example, masks, skin cleansers, such as soaps, cleansing creams, cleansing lotions, facial cleansers, cleansing emulsions, cleansing pads, facial washes, facial and body creams and moisturizers, facial serums, facial and body masks, facial toners and mists, eye creams and eye treatments, exfoliator formulas, lip balms, and the like. The Company's product range includes hair and lipsticks, hair shampoos, hair conditioners and body shampoos, hair and scalp serums, hair mists and hair sprays, eye shadows, concealers, mascaras, and other color cosmetics.

[0090] The composition containing non-naturally occurring collagen can further comprise at least one additional ingredient, including a topical carrier or a preservative.The topical carrier can be selected from the group consisting of liposomes, biodegradable microcapsules, lotions, sprays, aerosols, dusting powders, biodegradable polymers, mineral oil, triglyceride oil, silicone oil, glycerin, glyceryl monostearate, alcohol, emulsifiers, liquefied petroleum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene, wax, sorbitan monostearate, polysorbate, cetyl ester wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol, cyclomethicone, cyclopentasiloxane, and water. The preservative may include a preservative selected from the group consisting of tocopherol, diiodomethyl-p-tolylsulfone, 2-bromo-2-nitropropane-1,3-diol, cis-isomer 1-(3-chloroallyl)-3,5,7-triaza-1-azoniaadamantane chloride, glutaraldehyde, 4,4-dimethyloxazolidine, 7-ethylbicyclooxazolidine, phenoxyethanol, butylene glycol, 1,2 hexanediol, methylparaben, sorbic acid, germaben II, rosemary extract, and EDTA.

[0091] Also provided herein in certain embodiments are methods for reducing skin damage, promoting repair of damaged skin, protecting skin against UV damage, and / or protecting skin cells against the effects of exposure to urban dust. In another embodiment, a method for increasing skin firmness, elasticity, luminosity, moisture retention, tactile texture, or visual texture, and / or stimulating collagen production, is provided. The method may include applying a composition containing non-naturally occurring collagen to the skin of a subject. Without being bound by a particular theory or mechanism, the collagen in the composition may reduce skin damage by protecting against UV damage. In some cases, the collagen in the composition may promote repair of damaged skin by increasing cell viability. In some cases, the collagen in the composition may reduce skin damage and / or promote cell repair by increasing procollagen synthesis and / or promoting skin cell viability when applied to the skin. In some cases, the collagen reduces the formation of thymine-thymine (TT) dimers.

[0092] The methods provided herein encompass the use of a composition for treatment as indicated in the methods, e.g., by the steps provided herein. In embodiments, the present disclosure provides the use of a composition provided herein (e.g., truncated collagen or a formulation comprising truncated collagen) in a method of reducing skin damage, promoting repair of damaged skin, protecting skin against UV damage, and / or protecting skin cells from the effects of exposure to urban dust (e.g., by administering a composition provided herein to the skin of a subject). In embodiments, the present disclosure provides the use of a composition provided herein (e.g., truncated collagen or a formulation comprising truncated collagen) in a method of increasing skin firmness, elasticity, luminosity, moisture retention, tactile texture, or visual texture, and / or stimulating collagen production.

[0093] In some embodiments, the truncated collagens provided herein can stimulate fibroblast and / or keratinocyte production of type I collagen (see, e.g., Examples 4 and 6). In some cases, levels of procollagen type I C peptide (a readout for collagen production) can be measured. In some cases, levels of procollagen type I C peptide can be assessed using an in vitro MatTek full-thickness human skin tissue model (see, e.g., Example 6). In some cases, levels of type I collagen can be measured or determined by enzyme-linked immunosorbent assay (ELISA). In some cases, the truncated collagens provided herein can stimulate type I collagen production at levels higher than untreated cells, retinol-treated cells, and / or vitamin B3-treated cells.

[0094] In some embodiments, the truncated collagens provided herein can stimulate fibroblast overexpression of extracellular matrix genes (see, e.g., Example 4). In some cases, the level of extracellular matrix genes can be measured by RNA sequencing. In some cases, the truncated collagens provided herein can stimulate fibroblast overexpression of one or more of the collagen type I gene (COL1A), the elastin gene (ELN), and the fibronectin gene (FN1). In some cases, the level of extracellular matrix genes produced by fibroblasts treated with the truncated collagens provided herein can be higher than that of untreated fibroblasts or fibroblasts treated with retinol. In some cases, the level of extracellular matrix genes produced by fibroblasts treated with the truncated collagens provided herein can be similar to or higher than that of fibroblasts treated with vitamin C.

[0095] In some embodiments, the truncated collagens provided herein can reduce inflammation in keratinocytes irradiated with UVB light (see, e.g., Examples 4 and 6). In some cases, keratinocytes can be irradiated with UVB light and then treated with the truncated collagens provided herein. In some cases, inflammation can be measured by measuring the level of IL-1α produced by UVB-irradiated keratinocytes (e.g., by ELISA). In some cases, UVB-irradiated keratinocytes can produce lower levels of IL-1α when treated with the truncated collagens provided herein than untreated keratinocytes.

[0096] In some embodiments, the truncated collagens provided herein can increase the viability of keratinocytes irradiated with UVB light (see, e.g., Example 4). In some cases, keratinocytes can be pre-treated (before UVB irradiation) and post-treated (after UVB irradiation) with the truncated collagens provided herein. In some cases, cell viability can be measured using MTT metabolic colorimetry. In some cases, keratinocytes treated with the truncated collagens provided herein can exhibit higher cell viability after UVB irradiation than untreated keratinocytes.

[0097] In some embodiments, the truncated collagens provided herein can reduce DNA damage in keratinocytes after exposure to UVB light (see, e.g., Example 6). In some cases, DNA damage can be assessed by measuring the level of thymine dimers (TT dimers). In a non-limiting example, TT dimer levels can be measured using an OxiSelect UV-induced DNA damage ELISA kit. In some cases, UVB-irradiated keratinocytes treated with the truncated collagens provided herein can exhibit lower levels of TT dimers than untreated keratinocytes.

[0098] In some embodiments, the truncated collagens provided herein may have antioxidant capacity (see, e.g., Examples 4 and 6). In some cases, the oxidative capacity of truncated collagens can be measured using an oxygen radical absorbance capacity (ORAC) assay. In a non-limiting example, truncated collagen in the form of a 0.1% solution may have antioxidant properties of at least 10 μM Trolox (vitamin E) equivalent (TE), at least 50 μM TE, at least 100 μM TE, at least 150 μM TE, at least 160 μM TE, at least 170 μM TE, at least 180 μM TE, at least 190 μM TE, or at least 200 μM TE.

[0099] In some embodiments, the truncated collagens provided herein can increase cell viability of keratinocytes exposed to urban dust pollution compared to untreated cells (see, e.g., Example 6). In some cases, cell viability can be measured by MTT metabolic colorimetric assay.

[0100] In some embodiments, topical administration of the truncated collagen provided herein to a subject's face can increase facial skin elasticity at 1 week, 2 weeks, 4 weeks, 8 weeks, or longer after treatment compared to baseline (see, e.g., Examples 5 and 7). In some cases, facial skin elasticity can be measured with a cutometer.

[0101] In some embodiments, topical administration of the truncated collagen provided herein to a subject's face can increase facial skin collagen content compared to baseline at 1 week, 2 weeks, 4 weeks, 8 weeks, or longer after treatment (see, e.g., Example 5). In some cases, facial skin collagen content can be measured by SIAscope.

[0102] In some embodiments, topical administration of truncated collagen provided herein can reduce facial skin redness (erythema) at 1 week, 2 weeks, 4 weeks, 8 weeks, or longer after treatment compared to baseline (see, e.g., Example 5). In some cases, facial skin redness (erythema) can be scored by a blinded clinical grader (e.g., using the 5-point ordinal scale provided in Table 4).

[0103] In some embodiments, topical administration of truncated collagen provided herein can reduce facial wrinkles compared to baseline at 1 week, 2 weeks, 4 weeks, 8 weeks, or longer after treatment (see, e.g., Example 5). In some cases, facial wrinkles can be scored by a blinded clinical grader.

[0104] In some embodiments, topical administration of truncated collagen provided herein can increase facial skin moisture at 1 week, 2 weeks, 4 weeks, 8 weeks, or longer after treatment compared to baseline (see, e.g., Example 7). In some cases, topical administration of truncated collagen provided herein can increase facial skin moisture compared to topical administration of marine collagen. In some cases, skin moisture retention can be measured with a corneometer.

[0105] One aspect of the present disclosure provides a polynucleotide encoding a non-naturally occurring collagen. The polynucleotide may encode a collagen derived from jellyfish or humans. The polynucleotide may encode a full-length or truncated collagen. In various embodiments, the polynucleotide may comprise a polynucleotide set forth in any one of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:26, SEQ ID NO:28, or SEQ ID NO:30, or a homolog thereof (e.g., having at least 85%, at least 90%, at least 95%, or at least 98% sequence identity thereto). In some cases, the polynucleotide may be codon-optimized (e.g., for expression in a host cell).

[0106] In another aspect, the present disclosure provides a polynucleotide encoding a collagen fusion protein, which may include a secretion tag, a histidine tag, a fluorescent protein tag, a protease cleavage site, a beta-lactamase and / or a GEK and / or a GDK amino acid trimer repeat together with collagen.

[0107] In one embodiment, a vector containing a collagen-encoding polynucleotide can be used to transform a host cell to express the polynucleotide. The polynucleotide can further contain a nucleic acid encoding an enzyme that allows the host organism to grow in the presence of a selection agent. The selection agent can include certain sugars, including galactose-containing sugars, or antibiotics, including ampicillin, hygromycin, G418, etc. Enzymes that can be used to confer resistance to the selection agent include β-galactosidase or β-lactamase.

[0108] In one aspect, a host cell is provided that expresses a polynucleotide of the present invention. The host cell can be any host cell, including a gram-negative bacterial cell, a gram-positive bacterial cell, a yeast cell, an insect cell, a mammalian cell, a plant cell, or any other cell used to express an exogenous polynucleotide. An exemplary gram-negative host cell is E. coli.

[0109] Any desired or necessary supplements other than the carbon source, nitrogen source, and inorganic phosphate source may also be included at appropriate concentrations, either alone or introduced as a mixture with another supplement or medium, such as a complex nitrogen source. In certain embodiments, the medium further comprises one or more components selected from ammonium chloride, ammonium sulfate, calcium chloride, casamino acids, iron(II) sulfate, magnesium sulfate, peptone, potassium phosphate, sodium chloride, sodium phosphate, and yeast extract.

[0110] Beta-lactamase is an enzyme that confers resistance to lactam antibiotics in prokaryotic cells. Typically, when beta-lactamase is expressed in bacterial host cells, the expressed beta-lactamase protein also contains a targeting sequence (secretion tag) that directs the beta-lactamase protein to the periplasmic space. Beta-lactamase does not function unless it is transported to the periplasmic space. Beta-lactamase targeted to the periplasmic space without the use of a separate secretion tag to target the enzyme to the periplasmic space is provided. By creating a fusion protein in which a periplasmic secretion tag is added to the N-terminus of a protein such as GFP, collagen, or a GFP / collagen chimera, the functionality of beta-lactamase lacking the native secretion tag can be used to select for complete translation and secretion of the N-terminal fusion protein. Using this approach, DsbA-GFP-collagen-beta-lactamase fusion can be used to select for truncated products of the target collagen that promote translation and secretion.

[0111] Another embodiment provides a method for producing a polypeptide (or non-naturally occurring collagen) as provided herein. In some embodiments, the method includes inoculating a culture medium with recombinant host cells comprising a polynucleotide encoding the polypeptide or "collagen," culturing the host cells, and isolating the polypeptide (or non-naturally occurring collagen) from the host cells.

[0112] A process for the fermentative preparation of a polypeptide (or protein) is provided, the process comprising: (a) culturing recombinant Gram-negative bacterial cells in a medium containing a magnesium salt, wherein the concentration of magnesium ions in the medium is at least about 6 mM, and the bacterial cells contain an exogenous gene encoding a protein; (b) recovering the protein from the culture medium Includes.

[0113] Bacteria can be cultured in any suitable manner for the purpose of producing a target protein, for example, continuously—as described, for example, in WO 05 / 021772—or in a batch process (batch culture), or in a fed-batch or repeated fed-batch process. In some embodiments, protein production is performed on a large scale. A variety of large-scale fermentation procedures for producing recombinant proteins are available. Large-scale fermentation has a capacity of at least 1,000 liters, preferably about 1,000 to 100,000 liters. In some cases, fermentors use agitator impellers to distribute oxygen and nutrients, particularly glucose (a preferred carbon / energy source). Small-scale fermentation generally refers to fermentation in a fermentor with a volumetric capacity of about 20 liters or less.

[0114] For target protein accumulation, the host cells can be cultured under conditions sufficient for target protein accumulation. Such conditions include, for example, temperature, nutrient, and cell density conditions that allow protein expression and cellular accumulation. Furthermore, such conditions can be those that allow the cells to perform the basic cellular functions of transcription, translation, and protein passage from one cellular compartment to another for secreted proteins, as known to those skilled in the art.

[0115] Any suitable bacterial cells may be utilized in the methods provided herein, as desired. The bacterial cells may be cultured at any suitable temperature. In certain embodiments, the bacterial cells are E. coli cells. For example, typical temperatures for E. coli growth range from about 20°C to about 39°C. In one embodiment, the temperature is about 20°C to about 37°C. In another embodiment, the temperature is about 30°C. In one embodiment, the host cells may be cultured at one temperature in an unswitched or switched state and then switched to a different temperature to induce protein production. The host cells may be initially cultured at one temperature to grow the cells, and then cultured at a lower temperature to induce protein production. The first temperature may be about 23°C, 24°C, 25°C, 26°C, 27°C, 28°C, 29°C, 30°C, 31°C, 32°C, 33°C, 34°C, 35°C, 36°C, or 37°C. The second temperature can be about 20° C., 21° C., 22° C., 23° C., 24° C., 25° C., 26° C., 27° C., 28° C., 29° C., 30° C., 31° C., 32° C., 33° C., 34° C., 35° C., or 36° C. Cultivation at the second temperature can be between 1 hour and 100 hours, between 5 hours and 90 hours, between 5 hours and 80 hours, between 5 hours and 80 hours, between 5 hours and 70 hours, between 10 hours and 70 hours, between 15 hours and 70 hours, between 15 hours and 65 hours, between 15 hours and 60 hours, between 20 hours and 60 hours, between 20 hours and 55 hours, between 20 hours and 50 hours, between 24 hours and 50 hours, between 24 hours and 48 hours, between 30 hours and 50 hours, between 30 hours and 45 hours, or between 30 hours and 40 hours.

[0116] The pH of the culture medium can be any pH between about 5 and 9, depending primarily on the host organism. For E. coli, the pH can be about 6.0 to about 7.4, about 6.2 to about 7.2, about 6.2 to about 7.0, about 6.2 to about 6.8, about 6.2 to about 6.6, about 6.4, or about 6.5.

[0117] For inducing gene expression, typically, cells can be cultured until a certain optical density is reached, e.g., an OD of about 1.1, at which point induction is initiated (e.g., by addition of an inducer, depletion of a repressor, suppressor, or medium component, etc.) to induce expression of the exogenous gene encoding the target protein. In some embodiments, expression of the exogenous gene can be induced by an inducer selected from, e.g., isopropyl-β-d-1-thiogalactopyranoside, lactose, arabinose, maltose, tetracycline, anhydrotetracycline, bubricin, xylose, copper, zinc, etc. Induction of gene expression can also be achieved by reducing the dissolved oxygen level during fermentation. The dissolved oxygen level of the fermentation during cell growth can be between 10% and 30%. To induce gene expression, the dissolved oxygen level can be reduced to 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, less than 1%, or 0%. In host cells, either in the physiological state or in the switched state, production of the protein can be induced by lowering the fermentation temperature as disclosed herein. [Example]

[0118] Example 1 Production of truncated collagen A codon-optimized DNA sequence encoding a jellyfish collagen optimized for expression in E. coli and truncated by 240 internal amino acids (relative to full-length jellyfish collagen (SEQ ID NO:33)) was synthesized and expressed. The DNA sequence is shown in SEQ ID NO:1 below. In SEQ ID NO:1, the DsbA secretion tag is encoded by nucleotides 1-72, which encodes amino acids 1-24 of SEQ ID NO:2. The histidine tag containing nine histidine residues is encoded by nucleotides 73-99 of SEQ ID NO:1, which encodes amino acids 25-33 of SEQ ID NO:2. The linker is encoded by nucleotides 100-111 of SEQ ID NO:1, which encodes amino acids 34-37 of SEQ ID NO:2. The thrombin cleavage site is encoded by nucleotides 112-135 of SEQ ID NO:1, which encodes amino acids 38-45 of SEQ ID NO:2. The cleaved collagen is encoded by nucleotides 136-822 of SEQ ID NO:1, which encodes amino acids 46-274 of SEQ ID NO:2.

[0119] (SEQ ID NO: 1)

[0120] The truncated collagen is approximately 54% of the full-length jellyfish collagen (SEQ ID NO: 33) and is disclosed in SEQ ID NO: 2 below.

[0121] MKKIWLALAGLVLAFSASAAQYEDHHHHHHHHHSGSSLVPRGSHMGPQGVVGADGKDGTPGEKGEQGRTGAAGKQGSPGADGARGPLGSIGQQGARGEPGDPGSPGLRGDTGLAGVKGVAGPSGRPGQPGANGLPGVNGRGGLERGLAGPPGPDGRRGETGSPGIAGALGKPGLEGPKGYPGLRGRDGTNGKRGEQGETGPDGVRGIPGNDGQSGKPGIDGIDGTNGQPGEAGYQGGRGTRGQLGETGDVGQNGDRGAPGPDGSKGSAGRPGLR (SEQ ID NO: 2)

[0122] A polynucleotide encoding a truncated jellyfish collagen without the DsbA secretion tag, histidine tag, linker and thrombin cleavage site is disclosed in SEQ ID NO:3.

[0123] (SEQ ID NO: 3)

[0124] The amino acid sequence of the truncated jellyfish collagen without the DsbA secretion tag, histidine tag, linker and thrombin cleavage site is disclosed in SEQ ID NO:4.

[0125] GPQGVVGADGKDGTPGEKGEQGRTGAAGKQGSPGADGARGPLGSIGQQGARGEPGDPGSPGLRGDTGLAGVKGVAGPSGRPGQPGANGLPGVNGRGGLERGLAGPPGPDGRRGETGSPGIAGALGKPGLEGPKGYPGLRGRDGTNGKRGEQGETGPDGVRGIPGNDGQSGKPGIDGIDGTNGQPGEAGYQGGRGTRGQLGETGDVGQNGDRGAPGPDGSKGSAGRPGLR (Array number No. 4)

[0126] The polynucleotide of SEQ ID NO: 1 was codon-optimized and cloned into Gen9 DNA (now Ginkgo The pET28a vector was synthesized by in-house synthesis at Bioworks. The overlap between the pET28 vector and SEQ ID NO:1 was designed to be 30-40 bp in length and added using PCR with the enzyme PrimeSTAR® GXL Polymerase (www.clontech.com / US / Products / PCR / GC_Rich / PrimeSTAR_GXL_DNA_Polymerase?sitex=10020:22372:US). The opened pET28a vector and insert DNA (SEQ ID NO:1) were then co-assembled into the final plasmid using SGI GibsonAssembly® (us.vwr.com / store / product / 17613857 / gibson-assembly-hifi-1-step-kit-synthetic-genomics-inc). The plasmid sequence was then verified by Sanger sequencing by Eurofins Genomics (www.eurofinsgenomics.com).

[0127] Transformed cells were grown in minimal medium and frozen in 1.5 ml aliquots containing a 50:50 cell to glycerol ratio. One vial of this frozen culture was revived in 50 ml of minimal medium overnight at 37°C and 200 rpm. Cells were transferred to 300 ml of minimal medium and grown for 6-9 hours to reach an OD600 of 5-10.

[0128] A bioreactor was prepared with 2.7 L of minimal medium plus glucose, and 300 ml of a culture with an OD600 of 5–10 was added to bring the starting volume to 3 L. Cells were grown at 28°C and pH 7, maintaining dissolved oxygen at 20% saturation using a cascade of agitation, air, and oxygen. pH was controlled using a 28% w / w ammonium hydroxide solution. Fermentation was performed in fed-batch mode using a DO-stat-based feeding algorithm once the 40 g / L initial bolus had been depleted for approximately 13 hours. After 24–26 hours of initial growth, the OD600 exceeded 100. At this point, 300 mL of 500 g / L sucrose was added, and the temperature was reduced to 25°C. High-density cultures were induced for protein production using 1 mM IPTG. Fermentation continued for an additional 20–24 hours, and cells were harvested using a benchtop centrifuge at 9000 rcf and 15°C for 60 minutes. The cell pellet recovered from the centrifuge was resuspended in a buffer containing 0.5 M NaCl and 0.1 M KH2PO4 at pH 8 at a weight ratio of 2x buffer to 1x cells.

[0129] The collected cells were disrupted twice in a homogenizer at a pressure of 14,000 psi, and the resulting slurry contained collagen proteins along with other proteins.

[0130] Fermentations were carried out at various temperatures ranging from 25°C to 28°C. For some fermentations, the fermentation temperature was maintained constant, and collagen was purified immediately upon completion (OD600 of 5-10). For other fermentations, the fermentation temperature was maintained for the desired period, and when the cell density reached an OD600 of 5-10, the temperature was lowered to induce protein production. Typically, the temperature was lowered from 28°C to 25°C. Fermentation at 25°C continued for 40-60 hours, after which collagen was isolated.

[0131] Collagen was purified by acid treatment of the homogenized cell broth. Furthermore, acid treatment was also performed on the unhomogenized whole cells recovered from the bioreactor after centrifugation and resuspension in the above buffer. The pH of either the homogenized slurry or the resuspended whole cells was lowered to pH 3 using 6 M hydrochloric acid. The acidified cell slurry was incubated overnight at 4°C with mixing, followed by centrifugation. The supernatant of the acidified slurry was examined on a polyacrylamide gel and confirmed to contain a relatively high amount of abundant collagen compared to the starting pellet. The resulting collagen slurry was high in salt. To reduce the volume and salt, concentration and diafiltration steps were performed using an EMD Millipore Tangential Flow Filtration system, each equipped with a 0.1 m2 ultrafiltration cassette. The total filtration area using two cassettes in parallel was 0.2 m2. A 5x volume reduction and a 19x salt reduction were achieved in the TFF stage. The final collagen slurry was run on an SDS-PAGE gel to confirm the presence of collagen. The slurry was dried for 3 days using a multi-tray freeze dryer to yield a white fluffy collagen powder.

[0132] Purified truncated collagen obtained from homogenized cell broth or unhomogenized cells was analyzed on an SDS-PAGE gel, and a thick, clear band was observed at the expected size of 27 kilodaltons. The purified collagen was also analyzed by mass spectrometry, which confirmed that the 27 kilodalton protein was jellyfish collagen.

[0133] Alternative methods for purifying full-length and truncated collagens are provided below.

[0134] The fermentation broth was mixed with 0.3-0.5% w / v polyethylimine (PEI). After 15 minutes of incubation with PEI, the fermentation broth was centrifuged at 9000 rcf for 15 minutes, and the supernatant, which contained collagen protein, was collected. The cell pellet was discarded, and the PEI-treated collagen-containing supernatant was mixed with sodium bentonite (final 0.2% w / v) (Wyopure®, Wyoming Bentonite) and centrifuged. The bentonite-containing pellet was discarded, and the supernatant was collected.

[0135] The bentonite-treated supernatant was concentrated 3-6 times using a tangential flow filtration system (TFF) (EMD Millipore) with a 5 kDa cassette. Collagen was retained in the permeate with little loss. To remove salts, the retentate from the concentration step was diafiltered using the same TFF settings. The final conductivity of the protein solution was <10 mS. Typical conductivities were between 400 microS. and 1.5 mS. Concentrated collagen solutions had conductivities approaching 4 mS. Those skilled in the art will understand that conductivities higher than 10 mS may be observed depending on the collagen concentration. The desalted and concentrated protein was then treated with activated carbon using W-L9000 10 x 40 granular resin (Carbon Activated Corporation). 5% w / v carbon resin was mixed with the collagen-containing protein feed and mixed at 45-50°C with gentle agitation. The carbon-treated slurry was filtered using a Buchner funnel lined with an Ertel Filter Press Pad M-953 (Ertel Alsop) with or without a filter aid, such as diatomaceous earth (Sigma-Aldrich). After filtration, the collagen solution was filtered through a 0.2 micron filter, followed by treatment with sodium bentonite (final 0.2% w / v) (Wyopure®, Wyoming Bentonite) for one to several hours and centrifugation at 9000 rcf for 15 to 30 minutes to obtain a highly pure, clear, particle-free collagen solution. If endotoxin protein removal is desired, the protein can be passed through a chromatography filter, such as a Sartobind-Q (Sartorius-Stedim), to specifically remove endotoxin proteins.

[0136] The purified collagen was analyzed on an SDS-PAGE gel, and a thick, clear band was observed at 30 kilodaltons. The size shift is due to the structure of the collagen molecule and its high content of glycine and proline amino acids. The purified collagen was also analyzed by mass spectrometry, which confirmed that the 30 kilodalton protein was truncated collagen.

[0137] The truncated collagen was further analyzed by HPLC using an Agilent 1100 series HPLC. The column was a 50 mm Agilent PLRP-S reverse phase column with an internal diameter of 4.6 mm, a particle size of μM, and a pore size of 1000 Å.

[0138] Samples were prepared by diluting 1:1 with 0.04% sodium azide solution in HPLC-grade water. After dilution, the resulting mixture was filtered through a 0.45 μm filter to remove any large particles that could clog the HPLC column. For analysis, the sample was appropriately diluted with 20 mM ammonium acetate buffer in HPLC-grade water at a pH of approximately 4.5. After mixing, the sample was transferred to a 300 μL microvial and then placed in an autosampler. Using the ChemStation software operating the HPLC, analytical parameters such as sample flow rate, column temperature, mobile phase flow rate, and mobile phase composition could be varied. In one example, but non-limiting, analysis, the parameters were a sample flow rate of 1 mL / min, a column temperature of 80 °C, a column pressure of 60-70 bar, a mobile phase composition of 97.9% water / 1.9% acetonitrile and 0.2% trifluoroacetic acid; an analytical UV wavelength of 214.4 nm, a 10 μL injection volume, and a 10-minute sample run time.

[0139] Under these conditions, the truncated jellyfish match of SEQ ID NO: 5 has an elution time of approximately 5.4 minutes. ChemStation quantifies the peak area of ​​the elution peak and calculates the protein concentration using a calibration curve that directly relates peak area to protein concentration. The calibration curve is generated using a known collagen solution that is serially diluted to include a collagen concentration range of 0.06 mg / mL to 1.00 mg / mL.

[0140] His-tag-linker-truncated collagen without thrombin cleavage site A truncated jellyfish collagen lacking the His tag, linker, and thrombin cleavage site is disclosed below. The codon-optimized nucleotide sequence encoding this collagen is provided in SEQ ID NO:6. The amino acid sequence is disclosed in SEQ ID NO:7. The DsbA secretion tag is encoded by nucleotides 1-72 of SEQ ID NO:6, which encodes amino acids 1-24 of SEQ ID NO:7. The truncated collagen sequence is encoded by nucleotides 73-639 of SEQ ID NO:6, which encodes amino acids 25-213 of SEQ ID NO:7.

[0141] ATGAAAAAGATTTGGCTGGCGCTGGCTGGTTTAGTTTTAGCGTTTAGCGCATCGGCGGCGCAGTATGAAGATGGTCCGCAGGGTGTTGTTGGTGCAGATGGTAAAGACGGTACCCCGGGTAATGCAGGTCAGAAAGGTCCGTCAGGTGAACCTGGCAGCCCTGGTAAAGCAGGTAGTGCCGGTGAGCAGGGTCCGCCGGGCAAAGATGGTAGTAATGGTGAGCCGGGTAGCCCTGGCAAAGAAGGTGAACGTGGTCTGGCAGGACCGCCGGGTCCTGATGGTCGCCGCGGTGAAACGGGTTCACCGGGTATTGCCGGTGCCCTGGGTAAACCAGGTCTGGAAGGTCCGAAAGGTTATCCTGGTCTGCGCGGTCGTGATGGTACCAATGGCAAACGTGGCGAACAGGGCGAAACCGGTCCAGATGGTGTTCGTGGTATTCCGGGTAACGATGGTCAGAGCGGTAAACCGGGCATTGATGGTATTGATGGCACCAATGGTCAGCCTGGCGAAGCAGGTTATCAGGGTGGTCGCGGTACCCGTGGTCAGCTGGGTGAAACAGGTGATGTTGGTCAGAATGGTGATCGCGGCGCACCGGGTCCGGATGGTAGCAAAGGTAGCGCCGGTCGTCCGGGTTTACGTTAA(SEQ ID NO: 6)

[0142] MKKIWLALAGLVLAFSASAAQYEDGPQGVVGADGKDGTPGNAGQKGPSGEPGSPGKAGSAGEQGPPGKDGSNGEPGSPGKEGERGLAGPPGPDGRRGETGSPGIAGALGKPGLEGPKGYPGLRGRDGTNGKRGEQGETGPDGVRGIPGNDGQSGKPGIDGIDGTNGQPGEAGYQGGRGTRGQLGETGDVGQNGDRGAPGPDGSKGSAGRPGLR(SEQ ID NO: 7)

[0143] A polynucleotide encoding a truncated jellyfish collagen without the His tag, linker, and thrombin cleavage site is disclosed in SEQ ID NO:8.

[0144] (SEQ ID NO: 8)

[0145] A truncated jellyfish collagen without the His tag, linker, and thrombin cleavage site is disclosed in SEQ ID NO:5.

[0146] GPQGVVGADGKDGTPGNAGQKGPSGEPGSPGKAGSAGEQGPPGKDGSNGEPGSPGKEGERGLAGPPGPDGRRGETGSPGIAGALGKPGLEGPKGYPGLRGRDGTNGKRGEQGETGPDGVRGIPGNDGQSGKPGIDGIDGTNGQPGEAGYQGGRGTRGQLGETGDVGQNGDRGAPGPDGSKGSAGRPGLR (SEQ ID NO: 5)

[0147] Fusion of truncated collagen with DsbA secretion tag-His tag-linker-thrombin cleavage site and GFP beta-lactamase (version 1): A fusion of jellyfish collagen and GFP beta-lactamase with a DsbA secretion tag-His tag-linker-thrombin cleavage site is disclosed below. The codon-optimized nucleotide sequence encoding this collagen is provided in SEQ ID NO:9. The amino acid sequence is disclosed in SEQ ID NO:10. The DsbA secretion tag is encoded by nucleotides 1-72 of SEQ ID NO:9, which encodes amino acids 1-24 of SEQ ID NO:10. The His tag is encoded by nucleotides 73-99 of SEQ ID NO:9, which encodes a histidine tag at amino acids 25-33 of SEQ ID NO:10. The linker is encoded by nucleotides 100-111 of SEQ ID NO:9, which encodes amino acids 34-37 of SEQ ID NO:10. The thrombin cleavage site is encoded by nucleotides 112-135 of SEQ ID NO:9, which encodes amino acids 38-45 of SEQ ID NO:10. The green fluorescent protein (GFP) with a linker is encoded by nucleotides 136-873 of SEQ ID NO:9, which encodes amino acids 46-291 of SEQ ID NO:10. The truncated collagen sequence is encoded by nucleotides 874-1440 of SEQ ID NO:9, which encodes amino acids 292-480 of SEQ ID NO:10. The beta-lactamase with the linker is encoded by nucleotides 1441-2232 of SEQ ID NO:9, which encodes amino acids 481-744 of SEQ ID NO:10. The beta-lactamase was properly targeted to the periplasmic space even though the polypeptide did not have a separate secretion tag. The DsbA secretion tag directed the entire transcript (DsbA secretion tag-His tag-linker-thrombin cleavage site truncated collagen and GFP beta-lactamase fusion protein) to the periplasmic space, and the beta-lactamase functioned properly.

[0148]

[0149] (SEQ ID NO: 10)

[0150] The polynucleotide of SEQ ID NO:9 was constructed by assembling several DNA fragments. The collagen-containing sequence was codon-optimized and synthesized by in-house synthesis at Gen9 DNA (now Ginkgo Bioworks). GFP was also synthesized by Gen9. Beta-lactamase was cloned from the plasmid pKD46 (cgsc2.biology.yale.edu / Strain.php?ID=68099) using PCR with the enzyme PrimeSTAR® GXL polymerase (www.clontech.com / US / Products / PCR / GC_Rich / PrimeSTAR_GXL_DNA_Polymerase?sitex=10020:22372:US). The overlap between the pET28 vector, GFP, collagen, and beta-lactamase was designed to be 30-40 bp in length and added using PCR with the enzyme PrimeSTAR® GXL polymerase. The opened pET28a vector and insert were then assembled together into the final plasmid using SGI GibsonAssembly® (us.vwr.com / store / product / 17613857 / gibson-assembly-hifi-l-step-kit-synthetic-genomics-inc). The plasmid sequence was then verified by Sanger sequencing by Eurofins Genomics (www.eurofinsgenomics.com).

[0151] Transformed cells were grown in minimal medium and frozen in 1.5 ml aliquots containing a 50:50 cell to glycerol ratio. One vial of this frozen culture was revived in 50 ml of minimal medium overnight at 37°C and 200 rpm. Cells were transferred to 300 ml of minimal medium and grown for 6-9 hours to reach an OD600 of 5-10.

[0152] A bioreactor was prepared with 2.7 L of minimal medium plus glucose, and 300 ml of a culture with an OD600 of 5–10 was added to bring the starting volume to 3 L. Cells were grown at 28°C and pH 7, maintaining dissolved oxygen at 20% saturation using a cascade of agitation, air, and oxygen. pH was controlled using a 28% w / w ammonium hydroxide solution. Fermentation was performed in fed-batch mode using a DO-stat-based feeding algorithm once the 40 g / L initial bolus had been depleted for approximately 13 hours. After 24–26 hours of initial growth, the OD600 exceeded 100. At this point, 300 mL of 500 g / L sucrose was added, and the temperature was reduced to 25°C. High-density cultures were induced for protein production using 1 mM IPTG. Fermentation continued for an additional 20–24 hours, and cells were harvested using a benchtop centrifuge at 9000 rcf and 15°C for 60 minutes. The cell pellet recovered from the centrifuge was resuspended in a buffer containing 0.5 M NaCl and 0.1 M KH2PO4 at pH 8 at a weight ratio of 2x buffer to 1x cells.

[0153] The collected cells were disrupted twice in a homogenizer at a pressure of 14,000 psi, and the resulting slurry contained collagen proteins along with other proteins.

[0154] Collagen was purified by acid treatment of unhomogenized whole cells harvested from the bioreactor after centrifugation and resuspension in the above buffer. The pH of the resuspended suspension was lowered to 3 using 6 M hydrochloric acid. The acidified cell slurry was incubated overnight at 4°C with mixing, followed by centrifugation. The pH was then raised to 9 using 10 N NaOH, and the supernatant was examined on a polyacrylamide gel to confirm the presence of relatively high amounts of abundant collagen compared to the starting pellet. The resulting collagen slurry was high in salt. To reduce volume and salt, concentration and diafiltration steps were performed using an EMD Millipore Tangential Flow Filtration system, each equipped with a 0.1 m2 ultrafiltration cassette. The total filtration area using two cassettes in parallel was 0.2 m2. A 5x volume reduction and a 19x salt reduction were achieved in the TFF step. The final collagen slurry was run on an SDS-PAGE gel to confirm the presence of collagen. The slurry was dried for 3 days using a multi-tray freeze dryer to yield a white fluffy collagen powder.

[0155] The purified collagen-GFP-beta-lactamase fusion protein was analyzed on an SDS-PAGE gel and observed to migrate with an apparent molecular weight of 90 kilodaltons. The expected size of the fusion protein is 85 kDa. The 90 kDa band was confirmed by mass spectrometry to be the correct collagen fusion protein.

[0156] Truncated collagen with DsbA secretion tag-His tag-linker-thrombin cleavage site and GFP beta-lactamase fusion (version 2): A fusion of jellyfish collagen and GFP beta-lactamase with a DsbA secretion tag-His tag-linker-thrombin cleavage site is disclosed below. The codon-optimized nucleotide sequence encoding this collagen is provided in SEQ ID NO:11. The amino acid sequence is disclosed in SEQ ID NO:12. The DsbA secretion tag is encoded by nucleotides 1-72 of SEQ ID NO:11 and encodes amino acids 1-24 of SEQ ID NO:12. The His tag is encoded by nucleotides 73-99 of SEQ ID NO:11 and encodes a nine-histidine tag at amino acids 25-33 of SEQ ID NO:12. The linker is encoded by nucleotides 100-111 of SEQ ID NO:11 and encodes amino acids 34-37 of SEQ ID NO:12. The thrombin cleavage site is encoded by nucleotides 112-135 of SEQ ID NO:11 and encodes amino acids 38-45 of SEQ ID NO:12. The green fluorescent protein (GFP) with a linker is encoded by nucleotides 136-873 of SEQ ID NO:11 and encodes amino acids 46-291 of SEQ ID NO:12. The sequence of the truncated collagen is encoded by nucleotides 874 to 1440 of SEQ ID NO: 11, which encodes amino acids 292 to 480 of SEQ ID NO: 12. The beta-lactamase with linker is encoded by nucleotides 1441 to 2232 of SEQ ID NO: 11, which encodes amino acids 481 to 744 of SEQ ID NO: 12.

[0157]

[0158] (SEQ ID NO: 12)

[0159] Example 2 Human collagen Truncated human collagen type 21 alpha 1 A truncated human collagen type 21 alpha 1 (truncated relative to full-length human type 21 alpha 1 collagen (SEQ ID NO: 31)) lacking the His tag, linker, and thrombin cleavage site is disclosed below. The codon-optimized nucleotide and amino acid sequences encoding this collagen are disclosed below. The DsbA secretion tag is encoded by nucleotides 1-72 of SEQ ID NO: 13, which encodes amino acids 1-24 of SEQ ID NO: 14. The truncated collagen sequence is encoded by nucleotides 73-633 of SEQ ID NO: 13, which encodes amino acids 25-211 of SEQ ID NO: 14.

[0160] The codon-optimized nucleotide sequence encoding this collagen is provided in SEQ ID NO:13.

[0161] (SEQ ID NO: 13)

[0162] The amino acid sequence is disclosed in SEQ ID NO:14.

[0163] MKKIWLALAGLVLAFSASAAQYEDAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGENGRQGIPGQQGIQGHHGAKGERGEKGEPGVR (SEQ ID NO: 14)

[0164] The codon-optimized nucleotide sequence encoding the truncated human collagen type 21 alpha 1 without the DsbA secretion tag is provided in SEQ ID NO:15.

[0165] (SEQ ID NO: 15)

[0166] The amino acid sequence of truncated human collagen type 21 alpha 1 without the DsbA secretion tag is disclosed in SEQ ID NO:16.

[0167] AGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGENGRQGIPGQQGIQGHHGAKGERGEKGEPGVR (SEQ ID NO: 16)

[0168] The polynucleotide of SEQ ID NO: 13 was synthesized by Twist Bioscience. The overlap between the pET28 vector and SEQ ID NO: 15 and SEQ ID NO: 16 was designed to be 20-30 bp in length and added using PCR with the enzyme PrimeSTAR® GXL polymerase (www.takarabio.com / products / pcr / gc-rich-pcr / primestar-gxl-dna-polymerase). The polynucleotide of SEQ ID NO: 13 was then inserted into the opened pET28a vector. and insert DNA (SEQ ID NO: 13) were co-assembled into the final plasmid using In-Fusion Cloning (www.takarabio.com / products / cloning / in-fusion-cloning). The plasmid sequence was then verified by Sanger sequencing using Genewiz (www.genewiz.com / en).

[0169] Transformed cells were grown in minimal medium and frozen in 1.5 ml aliquots containing a 50:50 cell to glycerol ratio of vegetable glycerol. One vial of this frozen culture was revived in 50 ml of minimal medium overnight at 37°C and 200 rpm. Cells were transferred to 300 ml of minimal medium and grown for 6-9 hours to reach an OD600 of 5-10.

[0170] The minimal medium used in this example and throughout this application is prepared as follows: 1) Autoclave 5 L of glucose syrup at a concentration of 550 g / kg in DI water. (VWR, product number 97061-170) 2) Autoclave in 3946 mL of DI water: 20g of (NH4)2HPO4. (VWR, product number 97061-932); 66.5g KH2PO4. (VWR, product number 97062-348); 22.5g of H3C6H5O7. (VWR, product number BDH9228-2.5KG); 8.85g MgSO4.7H2O. (VWR, product number 97062-134); 10 mL of 1000x trace metals formulation (Table 3). After autoclaving, add 118 g of (1) to (2); 5 mL of 25 mg / mL kanamycin sulfate (VWR-V0408); Adjust the pH to 6.1 using 28% NH4OH (VWR, product number BDH3022). [Table 3]

[0171] Fermentations were carried out at various temperatures ranging from 25°C to 28°C. For some fermentations, the fermentation temperature was maintained at a constant temperature, and collagen was purified immediately upon completion of fermentation. For other fermentations, the fermentation temperature was maintained for the desired period, and when an OD600 cell density of 10-20 was reached, the temperature was lowered to induce protein production. Typically, the temperature was lowered from 28°C to 25°C. Fermentation at 25°C continued for 40-60 hours.

[0172] Collagen was purified as follows: The pH of the fermentation broth was lowered to between 3 and 3.5 using 5-50% sulfuric acid. Then, cells were separated using centrifugation. The acidified broth supernatant was examined on a polyacrylamide gel and confirmed to contain relatively high amounts of abundant collagen compared to the starting pellet. The resulting collagen slurry was high in salt. To reduce volume and salt, concentration and diafiltration steps were performed using an EMD Millipore Tangential Flow Filtration system, each equipped with a 0.1 m2 ultrafiltration cassette. The total filtration area using two cassettes in parallel was 0.2 m2. A 5x volume reduction and a 19x salt reduction were achieved in the TFF step. The final collagen slurry was run on an SDS-PAGE gel to confirm the presence of collagen.

[0173] The purified collagen was analyzed on an SDS-PAGE gel, and a thick, clear band was observed at the expected size of 25 kilodaltons. Quantification of collagen titer and purity was performed using reverse-phase and size-exclusion HPLC chromatography. Titers are typically between 3 and 8 grams per liter. The purified collagen was also further analyzed by mass spectrometry, which confirmed its identity with the published sequence of human type 21 collagen.

[0174] Truncated human collagen type 1 alpha 2(1) A truncated human collagen type 1 alpha 2 (truncated relative to full-length human collagen type 1 alpha 2 (SEQ ID NO: 32)) lacking the His tag, linker, and thrombin cleavage site is disclosed below. The codon-optimized nucleotide and amino acid sequences are disclosed below. The DsbA secretion tag is encoded by nucleotides 1-72 of SEQ ID NO: 17, which encodes amino acids 1-24 of SEQ ID NO: 18. The truncated collagen sequence is encoded by nucleotides 73-636 of SEQ ID NO: 17, which encodes amino acids 25-212 of SEQ ID NO: 18.

[0175] The codon-optimized nucleotide sequence encoding this collagen is provided in SEQ ID NO:17.

[0176] (SEQ ID NO: 17)

[0177] The amino acid sequence is disclosed in SEQ ID NO:18.

[0178] MKKIWLALAGLVLAFSASAAQYEDMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTG (SEQ ID NO: 18)

[0179] The nucleic acid sequence of truncated human collagen type 1 alpha 2(1) without the DsbA secretion tag is disclosed in SEQ ID NO:19.

[0180] (SEQ ID NO: 19)

[0181] The amino acid sequence of truncated human collagen type 1 alpha 2(1) without the DsbA secretion tag is disclosed in SEQ ID NO:20.

[0182] MGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTG (SEQ ID NO: 20)

[0183] Truncated human collagen type 1 alpha 2(2) A truncated human collagen type 1 alpha 2 (truncated relative to full-length human collagen type 1 alpha 2 (SEQ ID NO: 32)) lacking the His tag, linker, and thrombin cleavage site is disclosed below. The codon-optimized nucleotide and amino acid sequences are disclosed below. The DsbA secretion tag is encoded by nucleotides 1-72 of SEQ ID NO: 21, which encodes amino acids 1-24 of SEQ ID NO: 22. The truncated collagen sequence is encoded by nucleotides 73-609 of SEQ ID NO: 21, which encodes amino acids 25-203 of SEQ ID NO: 22.

[0184] The codon-optimized nucleotide sequence encoding this collagen is provided in SEQ ID NO:21.

[0185] (SEQ ID NO: 21)

[0186] The amino acid sequence is disclosed in SEQ ID NO:22.

[0187] MKKIWLALAGLVLAFSASAAQYEDGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGL (SEQ ID NO: 22)

[0188] The nucleic acid sequence of truncated human collagen type 1 alpha 2(2) without the DsbA secretion tag is disclosed in SEQ ID NO:23.

[0189] (SEQ ID NO: 23)

[0190] The amino acid sequence of truncated human collagen type 1 alpha 2(2) without the DsbA secretion tag is disclosed in SEQ ID NO:24.

[0191] GFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGL (SEQ ID NO: 24)

[0192] The polynucleotides of SEQ ID NOs: 13, 17, or 21 were subcloned into the vector pET28a as described herein to prepare transformation vectors. Host cells were transformed with the vectors, and the polynucleotides were expressed as described in Example 1.

[0193] After fermentation was completed, truncated human collagen was purified from the fermentation broth using the procedures disclosed in Example 2. The purified truncated human collagen was analyzed using SDS-PAGE and HPLC as disclosed in Example 2.

[0194] All three truncated human collagens ran at the expected molecular weight in SDS-PAGE analysis. For the analysis of the truncated human collagens using HPLC, a standard curve using the jellyfish collagen of Example 1 was utilized. The retention times of the human collagens were slightly different from those of the jellyfish collagen. SEQ ID NO: 16 had a retention time of 5.645 minutes, SEQ ID NO: 20 had a retention time of 5.631 minutes, and SEQ ID NO: 24 ran in two peaks with retention times of 5.531 minutes and 5.7 minutes.

[0195] DsbA secretion and truncated human collagen type 1 alpha 2 truncated 5 with a FLAG tag The amino acid sequence of truncated human collagen type 1 alpha 2 truncated 5 with DsbA secretion and a FLAG tag is disclosed in SEQ ID NO: 25. The DsbA secretion tag is encoded by nucleotides 1-57 of SEQ ID NO: 26, and the amino acid sequence is amino acids 1-19 of SEQ ID NO: 25. The collagen nucleotide sequence is nucleotides 58-657 of SEQ ID NO: 26, and the amino acid sequence is amino acids 20-219 of SEQ ID NO: 25. The FLAG nucleotide sequence is nucleotides 658-684 of SEQ ID NO: 26, and the amino acid sequence is amino acids 220-228 of SEQ ID NO: 25.

[0196] MKKIWLALAGLVLAFSASAGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLGDYKDDDDK (SEQ ID NO: 25)

[0197] The nucleic acid sequence of truncated human collagen type 1 alpha 2 truncated 5 with DsbA secretion and FLAG tag is disclosed in SEQ ID NO:26.

[0198] (SEQ ID NO: 26)

[0199] The polynucleotide of SEQ ID NO:26 was subcloned into the vector pET28a, expressed in host E. coli cells, and the truncated collagen was purified as described herein. The purified collagen produced a clear band on SDS-PAGE, and anti-FLAG Western was observed at approximately 100 kilodaltons. No pre-existing band appeared at that position on the gel in the absence of expression of this protein.

[0200] Truncated human collagen type 1 alpha 2 truncated 6 with DsbA secretion tag and FLAG tag The amino acid sequence of truncated human collagen type 1 alpha 2 truncated 6 with a DsbA secretion tag and a FLAG tag is disclosed in SEQ ID NO: 27. The DsbA secretion tag is encoded by nucleotides 1-57 of SEQ ID NO: 28, and the amino acid sequence is amino acids 1-19 of SEQ ID NO: 27. The collagen nucleotide sequence is nucleotides 58-657 of SEQ ID NO: 28, and the amino acid sequence is amino acids 20-219 of SEQ ID NO: 27. The FLAG nucleotide sequence is nucleotides 658-684 of SEQ ID NO: 28, and the amino acid sequence is amino acids 220-228 of SEQ ID NO: 27.

[0201] MKKIWLALAGLVLAFSASAKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDGDYKDDDDK (SEQ ID NO: 27)

[0202] The nucleic acid sequence of truncated human collagen type 1 alpha 2 truncated 6 with DsbA secretion tag and FLAG tag is disclosed in SEQ ID NO:28.

[0203] (SEQ ID NO: 28)

[0204] The polynucleotide of SEQ ID NO:28 was subcloned into the vector pET28a, expressed in host E. coli cells, and the truncated collagen was purified as described herein. The purified collagen gave a clear band on SDS-PAGE, and anti-FLAG Western was observed at approximately 25 kilodaltons. No pre-existing band appeared at that position on the gel in the absence of expression of this protein.

[0205] Truncated human collagen type 1 alpha 2 truncated 7 with DsbA secretion tag and FLAG tag The amino acid sequence of truncated human collagen type 1 alpha 2 truncated 7 with a DsbA secretion tag and a FLAG tag is disclosed in SEQ ID NO: 29. The DsbA secretion tag is encoded by nucleotides 1-57 of SEQ ID NO: 30, and the amino acid sequence is amino acids 1-19 of SEQ ID NO: 29. The collagen nucleotide sequence is nucleotides 58-759 of SEQ ID NO: 30, and the amino acid sequence is amino acids 20-253 of SEQ ID NO: 29. The FLAG nucleotide sequence is nucleotides 760-786 of SEQ ID NO: 30, and the amino acid sequence is amino acids 254-262 of SEQ ID NO: 29.

[0206] MKKIWLALAGLVLAFSASAYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFKGDYKDDDDK (SEQ ID NO: 29)

[0207] The nucleic acid sequence of truncated human collagen type 1 alpha 2 truncated 7 with DsbA secretion tag and FLAG tag is disclosed in SEQ ID NO:30.

[0208] TGAAAAAGATTTGGCTGGCGCTGGCTGGTTTAGTTTTAGCGTTTAGCGCATCGGCGTATGAAGTTGATGCAACCCTGAAAAGCCTGAATAATCAGATTGAAACACTGCTGACACCGGAAGGTAGCCGTAAAAATCCGGCCCGTACCTGTCGTGATCTGCGTCTGAGCCACCCGGAATGGAGCAGCGGTTATTATTGGATTGATCCGAATCAAGGTTGTACCATGGATGCAATTAAAGTTTATTGTGATTTTAGCACAGGTGAAACATGTATCCGTGCACAGCCGGAAAATATTCCGGCCAAAAATTGGTATCGTAGTAGCAAAGATAAAAAACATGTGTGGCTGGGTGAAACCATTAATGCAGGTAGCCAGTTTGAATACAATGTTGAAGGTGTTACCAGCAAAGAAATGGCAACACAGCTGGCATTTATGCGTCTGCTGGCAAATTATGCAAGCCAGAATATTACATATCATTGTAAAAATAGCATTGCATATATGGATGAAGAAACCGGTAATCTGAAAAAAGCAGTTATTCTGCAGGGTAGCAATGATGTTGAACTGGTTGCCGAAGGTAATAGCCGTTTTACATATACCGTTCTGGTTGATGGTTGTAGCAAAAAAACCAATGAATGGGGTAAAACCATCATTGAATATAAAACCAACAAACCGAGCCGTCTGCCGTTTCTGGATATCGCTCCGCTGGATATTGGTGGTGCCGATCAGGAATTTTTTGTCGATATCGGTCCTGTGTGTTTTAAAGGTGACTACAAAGACGACGACGACAAATAA(SEQ ID NO: 30)

[0209] The polynucleotide of SEQ ID NO:30 was subcloned into the vector pET28a, expressed in host E. coli cells, and the truncated collagen was purified as described herein. The purified collagen gave a clear band on SDS-PAGE, and anti-FLAG Western was observed at approximately 30 kilodaltons. No pre-existing band appeared at that position on the gel in the absence of expression of this protein.

[0210] Example 3 Human clinical trials of truncated human type 21 collagen A clinical trial will be conducted using human subjects to determine the efficacy of a topical skin care product containing truncated human collagen type 21 (SEQ ID NO: 16). The study will be conducted in accordance with US and international good clinical practice (FDA and ICH guidelines) and applicable government regulations.

[0211] A base formulation (control formulation) is prepared from water, olive oil glycereth-8 esters, glycerin, coconut alkane, hydroxyethyl acrylate / sodium acryloyldimethyl taurate copolymer, pentylene glycol, disodium EDTA, caprylyl glycol, chlorphenesin, and phenoxyethanol. A formulation containing truncated human type 21 collagen is prepared by adding enough collagen to create a topical formulation containing 0.1% w / w collagen.

[0212] Expert rating assessment of validation and validity Visual analog scales (VAS) are commonly used in clinical research to measure the intensity or frequency of various symptoms, subjective characteristics, or attitudes that cannot be measured directly. VAS are highly reliable and more sensitive to small changes than simple ordinal scales (A. Paul-Dauphin, F. Guillemin, J. Virion, and S. Briancon, "Bias and precision in visual analog scales: A randomized controlled trial," American Journal of Epidemiology, vol. 150, no. 10, pp. 1117–27, 1999). When responding to VAS items, expert raters indicate their level of agreement with the statement by indicating their position along a 10-cm line between two item or anchor responses. Simple VAS are used to assess efficacy parameters, defined as the extremes of a 10-cm horizontal line, from left (best) to right (worst). Signs of photoaging can be classified as follows: mild = 1-3.9 cm, moderate = 4-6.9 cm, severe = 7-10 cm.

[0213] The following VAS was used: [ka] [ka]

[0214] Ordinal scales allow for a direct and objective numerical assignment of the quality of a given attribute. When responding to an ordinal scale item, expert raters indicate their level of agreement with the statement by selecting a set score or level.

[0215] The appearance of redness (erythema) of each subject's facial skin will be assessed by expert raters using the following 5-point ordinal scale for validation at baseline (Table 4). If validated, each subject will undergo further erythema assessments at weeks 2, 4, 6, and 8. [Table 4]

[0216] The Corneometer CM820 (Courage+Khazaka, Germany) measures the relative hydration of the skin surface by passing an alternating current through the skin with a pair of closely spaced electrodes and measuring the capacitance: changes in the skin's moisture content change the conductance of the capacitive circuit.

[0217] The Corneometer can reproducibly detect small changes in hydration levels with a measurement time of only about 1 second. The shallow measurement depth (approximately 10-20 μm below the stratum corneum) ensures that the assessment is not influenced by deeper skin layers.

[0218] All subjects will undergo facial corneometer measurements at baseline, immediately after the first application, and at weeks 2, 4, and 8. Measurements will be taken in triplicate and averaged at each time point. Measurement locations will be recorded on a face map to ensure consistency across time points.

[0219] The Cutometer MPA580 (Courage+Khazaka, Germany) measures the viscoelastic properties of skin by applying suction to the skin surface, drawing the skin into the probe's opening, and determining the penetration depth using an optical measurement system.

[0220] The resistance of the skin to being sucked up by the negative pressure (stiffness) and its ability to return to its original position (elasticity) are calculated and shown as a curve. The Cutometer output contains many parameters for the various parts of the measurement curve, such as R0 (Uf, stiffness), R2 (Ua / Uf, total elasticity), R5 (Ur / Ue, net elasticity), R7 (Ur / Uf, elasticity portion) and R9 (R3[last max amp]-R0[Uf], fatigue).

[0221] All subjects undergo Cutometer measurements on either the left or right cheek (according to a prepared randomization code) at baseline, immediately after the first application, and at weeks 2, 4, and 8. Skin elasticity is reported using the R5 (Ur / Ue) and R2 (Ua / Uf) parameters. As skin becomes more elastic, this value increases. Skin firmness is reported using the R0 (Uf) parameter. As skin becomes firmer, this value decreases. The locations of the assessments are recorded on each subject's face map to ensure consistency of measurements across visits.

[0222] The COSMETRICS™ SIAScope (Astron Clinica, Toft, UK) is a noninvasive optical skin imaging device that uses spectrophotometric intracutaneous analysis (SIA), or chromophore mapping. This technology is based on a unique combination of dermatoscopy and contact remittance spectrophotometry. The hardware consists of a handheld imaging probe attached to a laptop computer. The unit is placed in contact with the skin surface, and a high-intensity LED illuminates the skin with discreet wavelengths spanning a narrow range of the visible and near-infrared spectrum from 400 to 1000 nm. Digital images are captured for each wavelength. Three parametric chromophore maps are acquired up to 2 mm deep and 11 mm in circumference for each of the following parameters: epidermal melanin, dermal hemoglobin, and dermal collagen.

[0223] For the purposes of this study, dermal collagen will be measured on the left or right cheek according to a predefined randomization code at baseline and at weeks 2, 4, and 8. The location of assessments will be recorded on each subject's face map to ensure consistency of measurements across visits.

[0224] The DermaScan C USB (Cortex Technology ApS, Hadsund, Denmark) is a compact, high-resolution ultrasound scanner. It uses a 20 MHz, high-resolution 60 × 150 μm, 13 mm penetration probe, providing linear scanning, high-precision operation, and true position detection for image clarity and sharpness.

[0225] This equipment is provided by cyberDERM, Inc. (Broomall, PA, USA). All subjects undergo facial ultrasound assessment at baseline and at weeks 2, 4, and 8. The assessment location remains the same at each visit and is recorded on a face map. After ultrasound scans are obtained, they are sent to cyberDERM, Inc. for analysis of dermal thickness (density).

[0226] All clinical photography will be conducted in accordance with IRSI's SOPs to ensure high-quality image reproducibility throughout the study. Photography will take place in a designated photography room with matte black walls and blocking all natural light. To prepare the subject for clinical photography, the subject will be asked to remove all jewelry, including earrings, necklaces, and any facial accessories. A trained technician will examine the subject under a bright magnifying loop to ensure no residual color cosmetics or skin care products are visible on the face, eyes, or lips. The subject will be provided with a black cape and black headband and instructed on how to position them to ensure all hair is neatly tied back and covered.

[0227] The Clarity™ 2D Research System Ti (Clarity) (BrighTex Bio-Photonics (BTBP), San Jose, CA, USA) captures high-quality full-face images of the front, left, and right sides. Three cameras in the system simultaneously capture 18-megapixel SLR images at 16-bit resolution, and a live feed display allows for automated face alignment checks against baseline images for repeatability.

[0228] Multispectral lighting (diffuse white light, cross-polarized light, blue light, parallel polarized light) reveals skin conditions above and below the surface of the skin. The system is used to recognize skin features and apply them to automatic skin segmentation and zone mapping, enabling subsequent skin analysis. Images are analyzed for attributes related to pigmentation, subsurface pigmentation, radiance, skin tone, redness, wrinkles, skin texture, pores, acne, and / or lips.

[0229] All subjects will have frontal, left, and right facial images captured in standard and parallel polarized light at baseline and at weeks 2, 4, and 8.

[0230] The subjective questionnaire allows the sponsor to assess the subject's opinion of their skin, the test product, and its effectiveness. Questions solicit subject agreement as well as open-ended responses to a 5-point scale.

[0231] Fourteen female subjects were enrolled. Inclusion criteria were Caucasian female subjects with Fitzpatrick skin type III, in good general health, and aged 35 to 65 years at enrollment. Inclusion criteria also included the following signs of facial aging as assessed by an expert rater at baseline: a) a score of ≥ 2 cm ≤ 6 on a 10 cm scale for lines / wrinkles; b) a score of ≥ 1 ≤ 3 on a 5-point ordinal scale for facial redness (erythema). Table 5 describes the demographics of study participants. [Table 5]

[0232] The results of expert clinical grader evaluations of lines / wrinkles, firmness (visual), elasticity (tactile), brightness, texture / softness (tactile), texture / smoothness (visual), and erythema after two weeks of treatment are shown in Table 6. All attributes tested improved. Scores for brightness, texture / softness (tactile), texture / smoothness (visual), and erythema were statistically significantly improved. [Table 6]

[0233] Instrumental assessments of hydration, firmness, and elasticity using the Corneometer and Cutometer are shown in Table 7. The improvements in skin hydration, firmness, and elasticity were statistically significant. Additionally, Table 7 shows the stimulation of collagen production by skin cells as shown by spectrophotometric intradermal analysis (SIA). [Table 7]

[0234] The results demonstrate that truncated human type 21 collagen provides statistically significant improvements in skin elasticity, brightness, moisture retention, tactile texture, and visual texture. Additionally, the results demonstrate that truncated human type 21 collagen provides statistically significant reductions in the appearance of lines and wrinkles, as well as significant reductions in erythema.

[0235] Example 4 In vitro study of truncated human type 21 collagen on skin cells Truncated human type 21 alpha 1 collagen stimulates fibroblast production of type I collagen A series of in vitro experiments were performed to evaluate the effects of truncated human type 21 collagen on human skin fibroblasts and keratinocytes. In the first experiment, the secretion of collagen type I protein from human primary fibroblasts was evaluated. Fibroblasts were cultured with 0.03% of the polypeptide set forth in SEQ ID NO: 16 for 48 hours. The culture supernatant was analyzed by enzyme-linked immunosorbent assay (ELISA) for procollagen type I C-peptide, an indicator of total secreted collagen type I protein. As shown in Figure 1, cells treated with the polypeptide of SEQ ID NO: 16 secreted higher levels of collagen type I (Figure 1; "B") than untreated cells (Figure 1; "A") or retinol-treated cells (Figure 1; "C").

[0236] Truncated human type 21 alpha 1 collagen stimulates fibroblast production of extracellular matrix protein genes RNA sequencing was performed to analyze global gene expression. After 48 hours of exposure, fibroblasts were incubated with 0.03% of the polypeptide set forth in SEQ ID NO: 16. These fibroblasts expressed higher levels of several extracellular matrix genes than cells incubated with medium alone. As shown in Figure 2A, fibroblasts treated with the polypeptide set forth in SEQ ID NO: 16 (Figure 2A; "C") upregulated the collagen type I gene (COL1A) compared to untreated cells (Figure 2A; "A") or fibroblasts treated with retinol (Figure 2A; "B"). This response was similar to that observed in fibroblasts treated with vitamin C (Figure 2A; "D"). As shown in Figure 2B, fibroblasts treated with the polypeptide set forth in SEQ ID NO: 16 (Figure 2B; "B") upregulated the elastin gene (ELN) compared to untreated cells (Figure 2B; "A") and various marine collagens (Figure 2B; "C," "D," "E," and "F"). As shown in Figure 2C, fibroblasts treated with the polypeptide of SEQ ID NO: 16 (Figure 2C; "B") upregulated the fibronectin gene (FN1) compared to untreated cells (Figure 2C; "A"), retinol (Figure 2C; "C"), and vitamin C (Figure 2C; "D").

[0237] Truncated human type 21 alpha 1 collagen reduces inflammation in UVB-irradiated keratinocytes 40 mJ / cm for human primary keratinocytes 2 After irradiation with 100 μg of UVB light, the cells were treated with 0.1% of the polypeptide of SEQ ID NO: 16 for 24 hours. The level of the pro-inflammatory cytokine IL-1α was determined by ELISA. As shown in Figure 3, UVB-irradiated keratinocytes treated with the polypeptide of SEQ ID NO: 16 (Figure 3; "B") expressed lower levels of IL-1α compared to untreated UVB-irradiated keratinocytes (Figure 3; "A").

[0238] Truncated human type 21 alpha 1 collagen has antioxidant properties. The antioxidant capacity of the polypeptide of SEQ ID NO: 16 was evaluated using the oxygen free radical absorbance capacity (ORAC) assay. The ORAC assay is a cell-free assay that measures the antioxidant capacity of a product using a fluorescent readout. Data are reported in Trolox (vitamin E) equivalents. As shown in Figure 4, a 0.1% solution of the polypeptide of SEQ ID NO: 16 had antioxidant properties equivalent to 190 μM Trolox.

[0239] Truncated human type 21 alpha 1 collagen increases cell survival of keratinocytes exposed to UVB light. To further evaluate the effect of treatment with the polypeptide of SEQ ID NO: 16 on UVB-irradiated keratinocytes, experiments were performed with pre- and post-irradiation treatment. Human primary keratinocytes were pre-treated with 0.1% of the polypeptide of SEQ ID NO: 16 for 24 hours and irradiated with 40 mJ / cm. 2 The keratinocytes were irradiated with 0.1% of UVB light and then treated again with 0.1% of the polypeptide of SEQ ID NO: 16 for another 24 hours. Cell viability was assessed using an MTT metabolic colorimetric assay. As shown in Figure 5, UVB-irradiated keratinocytes treated with the polypeptide of SEQ ID NO: 16 (Figure 5; "B") exhibited higher cell viability than UVB-irradiated keratinocytes without such treatment (Figure 5; "A").

[0240] Example 5 Human clinical trials of truncated human type 21 collagen. Topical application of truncated human type 21 alpha-1 collagen is associated with increased facial skin elasticity In a clinical trial (n=15 subjects), subjects used a topical facial serum containing 0.1% of the polypeptide of SEQ ID NO: 16 for 8 weeks, followed by a one-week washout period of a protein-free base facial serum. Topical application of the polypeptide of SEQ ID NO: 16 was associated with increased skin elasticity as measured using a Cutometer. As shown in Figure 6, 100% of subjects showed an improvement in skin elasticity at 2 weeks (Figure 6; "B") and 4 weeks (Figure 6; "C") when compared to baseline (Figure 6; "A").

[0241] Topical application of human type 21 alpha-1 collagen is associated with increased collagen content in facial skin In a clinical trial (n=15 subjects), subjects used a topical facial serum containing 0.1% of the polypeptide of SEQ ID NO: 16 for 8 weeks, followed by a 1-week washout period of a protein-free base facial serum. Topical application of the polypeptide of SEQ ID NO: 16 was associated with increased skin collagen content as measured by SIAscope. As shown in Figure 7, skin collagen content increased at 2 weeks (Figure 7; "B") and 8 weeks (Figure 7; "C") when compared to baseline (Figure 7; "A").

[0242] Topical application of human type 21 alpha collagen is associated with reduced facial redness In a clinical trial (n=15 subjects), subjects used a protein-free base facial serum with a one-week washout period followed by eight weeks of a topical facial serum containing 0.1% polypeptide of SEQ ID NO: 16. As shown in Figure 8, topical application of the polypeptide of SEQ ID NO: 16 was associated with a decrease in skin redness at four weeks (Figure 8; "B") and eight weeks (Figure 8; "C") when compared to baseline (Figure 8; "A").

[0243] Topical application of human type 21 alpha-1 collagen is associated with a reduction in facial wrinkles In a clinical trial (n=15 subjects), subjects used a protein-free base facial serum with a one-week washout period followed by eight weeks of a topical facial serum containing 0.1% polypeptide of SEQ ID NO: 16. As shown in Figure 9, topical application of the polypeptide of SEQ ID NO: 16 was associated with a reduction in facial wrinkles at four weeks (Figure 9; "B") and eight weeks (Figure 9; "C") when compared to baseline (Figure 9; "A").

[0244] Example 6 In vitro testing of truncated jellyfish collagen on skin cells Truncated jellyfish collagen stimulates skin cell production of collagen type I protein A series of in vitro experiments were conducted to evaluate the effects of truncated jellyfish collagen on human skin fibroblasts and keratinocytes. An in vitro full-thickness human skin tissue model (MatTek) containing fibroblasts and keratinocytes was evaluated for type I collagen secretion after 48 hours of treatment with the polypeptide of SEQ ID NO: 5. The tissue model was then rinsed and incubated in fresh medium for an additional 48 hours (96 hours). The culture supernatant was analyzed by ELISA for procollagen type I C-peptide (a readout for total secreted type I collagen protein). As shown in Figure 10, the tissue model treated with the polypeptide of SEQ ID NO: 5 (Figure 10; "A") secreted higher levels of type I collagen than the untreated tissue model (Figure 10; "B") or the tissue model treated with the positive control vitamin B3 (Figure 10; "C").

[0245] Truncated jellyfish collagen reduces DNA damage in keratinocytes after exposure to UVB light In further studies, 25 mJ / cm was administered to human primary keratinocytes. 2The cells were irradiated with 1000 uV of UVB light and then incubated overnight in medium containing 0.03% of the polypeptide of SEQ ID NO: 5. DNA was extracted from the cells and the levels of thymine dimers (an indicator of DNA damage) were analyzed using the OxiSelect UV-Induced DNA Damage ELISA kit. As shown in Figure 11, cells treated with the polypeptide of SEQ ID NO: 5 (Figure 11; "B") exhibited lower levels of thymine dimers, and therefore less DNA damage, than untreated cells (Figure 11; "A").

[0246] Truncated jellyfish collagen increases cell viability of UVB-irradiated keratinocytes Human primary keratinocytes were irradiated with 40 mJ / cm2 of UVB light and then incubated for 48 hours in a medium containing 0.03% of the polypeptide of SEQ ID NO: 5. Cell viability was assessed using an MTT metabolic colorimetric assay. As shown in Figure 12, UVB-irradiated keratinocytes treated with the polypeptide of SEQ ID NO: 5 (Figure 12; "B") exhibited higher cell viability than untreated UVB-irradiated keratinocytes (Figure 12; "A").

[0247] Truncated jellyfish collagen increases cell viability of keratinocytes exposed to urban dust pollution To test for protection from urban dust, human primary keratinocytes were pretreated with 0.03% of the polypeptide of SEQ ID NO: 5 for 24 hours and then exposed to 2 mg / ml of urban dust (NIST 1649B) for 24 hours. Cell viability was assessed using an MTT metabolic colorimetric assay. As shown in Figure 13, keratinocytes pretreated with the polypeptide of SEQ ID NO: 5 (Figure 13; "B") exhibited higher cell viability after exposure to urban dust than untreated keratinocytes exposed to urban dust (Figure 13; "A").

[0248] Truncated jellyfish collagen reduces inflammation in UVB-irradiated keratinocytes Further testing with an in vitro full-thickness human skin tissue model (MatTek) demonstrated that the MatTek tissue model was irradiated with 300 mJ / cm2 The tissue models were irradiated with 0.01% of UVB light and then treated with 0.01% of the polypeptide of SEQ ID NO: 5 for 24 hours. The levels of the pro-inflammatory cytokine IL-1α were determined by ELISA. As shown in Figure 14, the tissue model treated with the polypeptide of SEQ ID NO: 5 (Figure 14; "A") showed lower levels of IL-1α compared to the untreated UVB-irradiated control tissue model (Figure 14; "B").

[0249] Truncated jellyfish collagen has antioxidant properties The polypeptide of SEQ ID NO: 5 was also evaluated in an ORAC assay. As shown in Figure 15, a 0.1% solution of the polypeptide of SEQ ID NO: 5 had antioxidant properties equivalent to 193 μM Trolox.

[0250] Example 7 Human clinical trials of truncated jellyfish collagen Topical application of truncated jellyfish collagen is associated with increased facial skin hydration In a clinical trial (n=18 subjects), subjects used a topical facial cream containing 0.05% polypeptide of SEQ ID NO: 5 for two weeks. As shown in FIG. 16, topical application of the polypeptide of SEQ ID NO: 5 was associated with increased skin moisture retention at one week (FIG. 16; "A2") and two weeks (FIG. 16; "A3") when compared to baseline (FIG. 16; "A1"). Topical application of the polypeptide of SEQ ID NO: 5 also showed increased skin moisture retention compared to topical application of marine collagen at baseline (FIG. 16; "B1"), one week (FIG. 16; "B2"), and two weeks (FIG. 16; "B3"). Topical application of truncated jellyfish collagen is associated with increased facial skin elasticity In a clinical trial (n=18 subjects), subjects used a topical facial cream containing 0.05% polypeptide of SEQ ID NO: 5 for two weeks. As shown in Figure 17, topical application of the polypeptide of SEQ ID NO: 5 was associated with increased skin elasticity measured using a Cutometer at 1 week (Figure 17; "B") and 2 weeks (Figure 17; "C") when compared to baseline (Figure 17; "A").

[0251] The embodiments disclosed herein may be embodied in other specific forms without departing from the structure, methods, or other features as broadly described herein and as hereinafter claimed. The described embodiments are to be considered in all respects only as illustrative and not restrictive. All changes which come within the meaning and range of equivalency of the claims are intended to be embraced within their scope.

Claims

1. 1. A composition comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO:5 for use in a method of providing a cosmetic benefit to the skin of a subject, comprising: The method comprises topically applying the composition to the skin of the subject, wherein the cosmetic benefit is selected from the group consisting of: (i) increasing skin firmness, elasticity, luminosity, moisture retention, tactile texture, visual texture, and / or collagen content; (ii) reducing the appearance of skin lesions, lines, and / or wrinkles, and / or erythema or redness of the skin; (iii) preventing or treating UV damage to the skin; (iv) promoting the repair of damaged skin; (v) protecting skin cells from the effects of exposure to urban dust; (vi) stimulating collagen production in the skin; and (vii) any combination of two or more of (i)-(vi) above.

2. The composition of claim 1 , wherein the polypeptide consists of the amino acid sequence set forth in SEQ ID NO:

5.

3. 3. The composition of claim 1 or 2, wherein the firmness of the skin is increased by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 70%, or at least 75%, as measured using a Cutometer.

4. 4. The composition of any one of claims 1 to 3, wherein the elasticity of the skin is increased by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 70%, or at least 75% as measured by a Cutometer.

5. 5. The composition of claim 4, wherein the elasticity of the skin is increased by at least 8% as measured by a Cutometer after one week of topical application.

6. 6. The composition of claim 5, wherein the elasticity of the skin is increased by at least 25% as measured by a Cutometer after two weeks of topical application.

7. 6. The composition of claim 5, wherein the elasticity of the skin is increased by at least 30% as measured by a Cutometer after two weeks of topical application.

8. 6. The composition of claim 5, wherein the elasticity of the skin is increased by at least 100% as measured by a Cutometer after 4 weeks of topical application.

9. The composition of any one of claims 1 to 8, wherein the polypeptide is applied to the skin as a facial serum comprising 0.1% w / w of the polypeptide.

10. 10. The composition of any one of claims 1 to 9, wherein the moisture retention of the skin is increased by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 70%, or at least 75% as measured by a corneometer.

11. The composition of any one of claims 1 to 10, wherein the firmness of the skin is improved as judged by an expert clinical grader.

12. The composition of any one of claims 1 to 11, wherein the elasticity of the skin is improved as judged by an expert clinical grader.

13. The composition of any one of claims 1 to 12, wherein the luminosity of the skin is improved as judged by an expert clinical grader.

14. 14. The composition of any one of claims 1 to 13, wherein the collagen content of the skin is increased by at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, at least 10%, at least 11%, at least 12%, at least 13%, at least 14%, or at least 15% as measured by SIAscope.

15. 15. The composition of claim 14, wherein the collagen content of the skin is increased by at least 5% after two weeks of topical application.

16. 15. The composition of claim 14, wherein the collagen content of the skin is increased by at least 7% after two weeks of topical application.

17. 15. The composition of claim 14, wherein the collagen content of the skin is increased by at least 9% after 4 weeks of topical application.

18. 18. The composition of any one of claims 1 to 17, wherein the tactile texture of the skin is improved as judged by an expert clinical grader.

19. 19. The composition of any one of claims 1 to 18, wherein the visual texture of the skin is improved as judged by an expert clinical grader.

20. 20. The composition of any one of claims 1 to 19, wherein the lines or wrinkles present on the skin are reduced as judged by an expert clinical grader.

21. 21. The composition of claim 20, wherein the lines or wrinkles present on the skin are reduced by at least 10% as judged by an expert clinical grader.

22. 22. The composition of any one of claims 1 to 21, wherein the erythema of the skin is reduced as judged by an expert clinical grader.

23. 23. The composition of claim 22, wherein the erythema of the skin is reduced by at least 10%, at least 20%, at least 30%, at least 40%, or at least 45% as judged by an expert clinical grader after two weeks of topical application.

24. 23. The composition of claim 22, wherein the erythema of the skin is reduced by at least 10%, at least 20%, at least 30%, at least 40%, at least 45%, at least 50%, or at least 55% as judged by an expert clinical grader after 4 weeks of topical application.

25. A topical composition comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO:5 for use in a method for stimulating collagen production in skin cells, the method comprising topically applying the composition to the skin cells.

26. 26. The topical composition of claim 25, wherein the polypeptide consists of the amino acid sequence of SEQ ID NO:

5.

27. 27. The topical composition of claim 25 or 26, wherein the collagen in the skin is increased by at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, or at least 10%.

28. A polypeptide comprising the amino acid sequence of SEQ ID NO: 5; and one or more additional ingredients selected from the group consisting of water, oil, glycereth-8 esters, glycerin, coconut alkane, hydroxyethyl acrylate / sodium acryloyldimethyltaurate copolymer, pentylene glycol, disodium ethylenediaminetetraacetic acid (EDTA), caprylyl glycol, chlorphenesin, and phenoxyethanol.

29. 29. The topical formulation of claim 28, wherein the polypeptide consists of the amino acid sequence of SEQ ID NO:

5.

30. 30. The topical formulation of claim 28 or 29, wherein the oil is a vegetable oil.

31. 31. The topical formulation of claim 30, wherein the vegetable oil is olive oil.

32. Use of a polypeptide comprising the amino acid sequence set forth in SEQ ID NO:5 in the preparation of a composition for a method of providing a cosmetic benefit to the skin of a subject, comprising: The method comprises topically applying the composition to the skin of the subject, wherein the cosmetic benefit is selected from the group consisting of: (i) increasing skin firmness, elasticity, brightness, moisture retention, tactile texture, visual texture, and / or collagen content; (ii) reducing the appearance of skin lesions, lines, and / or wrinkles, and / or erythema or redness of the skin; (iii) preventing or treating UV damage to the skin; (iv) promoting the repair of damaged skin; (v) protecting skin cells from the effects of exposure to urban dust; (vi) stimulating collagen production in the skin; and (vii) any combination of two or more of (i)-(vi) above.

33. Use of a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 5 in the preparation of a topical composition for a method of stimulating collagen production in skin cells, said method comprising topically applying said composition to said skin cells.

Images