Anti-properdin antibody and its preparation
Anti-properdin antibodies address the limitations of current complement therapies by selectively inhibiting the alternative pathway, reducing complement activation, and maintaining immune function, offering a more targeted and safer treatment approach.
Patent Information
- Application Number
- JP2022542023
- Authority / Receiving Office
- JP · JP
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2020-01-08
- Filing Date
- 2021-01-08
- Publication Date
- 2025-10-01
- Estimated Expiration
- 2041-01-08
AI Technical Summary
Current complement therapies, such as anti-C5 antibodies, face challenges in effectively targeting the alternative complement pathway, leading to inadequate responses and safety issues, while the complement market lacks therapeutics directed at alternative targets in the cascade, necessitating more comprehensive patient stratification and robust monitoring.
Development of anti-properdin antibodies that selectively inhibit the alternative complement pathway, allowing the classical and lectin pathways to continue, with altered FcγR binding to minimize ADCC activity and increased FcRn affinity for extended half-life, enabling less frequent administration.
The anti-properdin antibodies effectively inhibit complement activation, reducing anaphylatoxin and MAC formation, minimizing tissue damage, and providing therapeutic benefits while preserving immune defense, suitable for treating complement-mediated diseases.
Smart Images

Figure 0007747639000010 
Figure 0007747639000011 
Figure 0007747639000012
Abstract
Description
[Technical Field]
[0001] The present invention relates to antibodies or antigen-binding portions thereof capable of binding to properdin (factor P). The antibodies of the present invention are further used in the preparation of a medicament for treating diseases through inhibition of the alternative complement pathway. [Background technology]
[0002] Scientists have been working for decades to develop drugs to treat complement-mediated diseases. By the end of the 20th century, many anti-complement agents had shown promise in vitro and in animal models, but few drug candidates advanced to humans, and even then, progressed little beyond that. Among the preclinical molecules tested at that time were antibodies against complement components that inhibit their function. For example, blockade of C5 function using anti-mouse C5 monoclonal antibodies and anti-human C5 monoclonal antibodies was readily established using both in vitro and in vivo animal disease models. By the early 21st century, the humanized anti-human C5 monoclonal antibody, eculizumab, was progressing through clinical development and was approved by the FDA in 2007 for the rare but devastating condition paroxysmal nocturnal hemoglobinuria (PNH). This clinical validation of anti-complement therapy was a milestone in complement drug discovery; this breakthrough, combined with groundbreaking data emerging from genome-wide association studies (GWAS) that demonstrated the critical role of complement in a wide range of diseases, spurred a renaissance in anti-complement drug discovery that has brought us to this day, with many new drugs progressing through late-stage clinical development in this field and many others in the discovery or preclinical stages. (1)
[0003] However, the excitement generated by one drug candidate developed for ocular indications (i.e., lampalizumab, a mAb targeting factor D (FD)) failed to translate into meaningful clinical responses in Phase III trials, indicating that specific challenges regarding the drug's bioavailability or efficacy remain unaddressed. The recent FDA approval of a long-acting version of eculizumab (ALXN1210 / ravulizumab, Ultomiris, Alexion), characterized by its extended plasma residence time and requiring administration only every 8 weeks instead of every 2 weeks, represents an important step in improving patient management, but it cannot be considered a bona fide new drug registration in this field. Currently, only one complement-specific drug is available in clinical practice, and it clearly cannot address all complement-related clinical conditions, making the need for disease-tailored therapeutic approaches more urgent than ever. (2)
[0004] However, it should be noted that developing drugs that target the complement pathway is associated with numerous challenges, including the large number of proteins from which to choose, the abundance of each such target circulating or membrane-bound protein, the natural primary role of complement in fighting infection and the safety implications of overregulating complement, and identifying appropriate disease or drug indications.In many diseases, complement plays a pathogenic role, whereas in others, complement is a "promoting factor" of the disease, inducing the progression of pathologies initiated by different disease triggers and thus promoting inflammation and tissue damage.
[0005] Nevertheless, the number of promising drugs in the complement system is increasing as the role of complement beyond lysis and in crosstalk with other biological systems (e.g., blood clotting) becomes clearer. Drugs targeting each of the three pathways within the complement system are in development and include small molecules, peptides, biologics, antibodies, and DNA-based therapeutics.
[0006] Because of the cascade nature of the complement pathway and the large number of proteins (both soluble and membrane-bound) that comprise it, different intervention points may result in different therapeutic outcomes. In most triggers, the complement pathway is activated by foreign or altered surfaces. In the classical pathway, recognition of immune complexes (and other non-immunoglobulin moieties) by C1q activates the associated serine proteases C1r and C1s, which cleave the plasma proteins C2 and C4, forming the C3 convertase complex (C4b2a) on the activated surface. The same result is achieved when pattern recognition proteins of the lectin pathway (mannose-binding lectin [MBL], ficolins, and collectins) bind to carbohydrate patterns on pathogen surfaces and induce cleavage of C2 / C4 by MBL-associated serine proteases. In the alternative pathway, the proteases factor B and factor D (FB, FD) interact with surface-bound C3b to form another type of C3 convertase. In all three complement pathways, the convergence point is the generation of one or other C3 convertase, which activates C3, resulting in at least two key events on the surface of diseased cells. One is the deposition of C3b on the target's surface (making it a candidate for opsonization by macrophages) and the simultaneous release of the anaphylatoxin C3a. The other is the formation and stabilization of C3bBb (C3 convertase) by properdin, leading to the assembly of C5 convertase, which cleaves C5. The second pathway is the only one that remains constitutively active, providing a constant, minimal background activity, ensuring the correct trigger is available and primed for amplification. The released anaphylatoxin C5a is one of the most potent chemoattractants and pro-inflammatory modulators, acting primarily through binding to C5a receptor 1 (C5aR1), whereas the C5b fragment can induce the formation of the membrane attack complex (MAC), which damages or induces lysis of the attacked cell. (1)
[0007] More than 20 therapeutic agents targeting different components and effector pathways of the complement cascade are currently in clinical development for a variety of indications. (2)
[0008] The amplification loop of the alternative pathway is the primary driving force behind complement activation and often determines the initiation of C5 convertase formation, which subsequently initiates C5 cleavage and terminal pathway activation. Even in diseases whose pathogenic mechanisms are mediated by the lectin or classical pathway, blocking the alternative pathway may offer therapeutic benefits due to the reduced effects mediated through the amplification loop. Therefore, specific interventions targeting only the amplification loop are considered an attractive proposition for drug development, as they could block the alternative pathway and limit collateral damage to normal tissues, while leaving the lectin and classical pathways at least partially functional for fighting infection.
[0009] There are numerous druggable targets within the amplification loop (e.g., C3 (or C3b), FB, FD, and FP (properdin)), all of which have been targeted in drug development (1).
[0010] Despite advances in drugs leading to late-stage clinical development, and more than a decade after the introduction of eculizumab, the complement market remains largely lacking in newly approved therapeutics directed at alternative targets in the cascade. The emergence of cases of inadequate response to anti-C5 therapy and the still poorly understood appreciation that multiple triggers and complex genetic traits may obscure patients' underlying antibody activity highlight the need for more comprehensive patient stratification and robust monitoring during anti-complement therapy for diseases currently treated with eculizumab.
[0011] Although the approval of eculizumab and the introduction of the first etiologic therapy for these patients dramatically changed the landscape of PNH, unmet clinical needs have emerged, including a gene-driven refractory phenotype to anti-C5 in some patients, residual hemolysis of C3-opsonized PNH cells in the extravascular compartment, and pharmacokinetic / pharmacodynamic (PK / PD) breakthrough hemolysis observed in some cases leading to potent complement activation (i.e., acute infection) regardless of drug dose level. (2)
[0012] It is important to note that anti-C5 therapy is associated with life-threatening and fatal meningococcal infections, which can rapidly become life-threatening or fatal if not recognized and treated early. (3)
[0013] Therefore, in most complement-mediated disease situations, complete inhibition of MAC formation resulting from the entire complement pathway is not essential, and it is quite possible that reducing, rather than shutting off, complement may be sufficient to confer therapeutic benefit while leaving a sufficient portion of complement activity intact to protect against serious infections. The goal of such treatment would be to reverse dysregulation and restore homeostasis. In this context, the amplification loop is one excellent target. Reducing cycling through the amplification loop by increasing loop regulation or reducing convertase availability could fine-tune therapy and ameliorate disease while preserving complement's protective role in immune defense. This would be a major advantage when treating elderly individuals in the community and those vulnerable to infection. Several AP-specific drugs are in phase 2 development, including inhibitors of FB and FD. Other drugs with regulatory properties are emerging; delivery of functional domains of regulators (such as FH) can directly modulate convertases, as in the preclinical molecule AMY201 (Amyndas), a truncated recombinant form of FH engineered to bind more efficiently to target surfaces. Finally, it may be possible to block natural regulators of complement; properdin stabilizes AP convertase, and MASP3 activates FD, and interference at these levels with drugs such as CLG561 (anti-properdin, Novartis) and OMS906 (preclinical anti-MASP3, Omeros) may drive the complement system toward restoring homeostasis. (4)
[0014] The present invention relates to antibodies that target properdin (factor P) to inhibit the alternative pathway.
[0015] Monoclonal antibodies against properdin are known in the art and have been described, for example, in WO 2006131874, WO 2009110918, WO 201109494, WO 2013006449, and WO 2018140956. Various antibodies that bind to activated properdin have been developed, but to our knowledge, none have yet been approved. One antibody targeting properdin, CLG561, exists, but it is in early clinical stages and has been evaluated in combination with an anti-C5 antibody. (5)
[0016] Therefore, there remains an unmet need to effectively regulate properdin activity and thus control the alternative complement pathway. Accordingly, the present invention provides anti-properdin antibodies that can be developed to treat associated diseases. Summary of the Invention
[0017] The present invention provides antibodies or antigen-binding portions thereof capable of binding to properdin (factor P). The antibodies of the present invention selectively inhibit the alternative complement pathway while allowing the classical and lectin pathways to continue. Furthermore, the antibodies of the present invention may have altered or reduced binding to FcγR, thereby minimizing their ADCC activity. The present invention also provides antibodies comprising an amino acid sequence that minimizes the CDC activity of the antibody. Because the antibodies of the present invention have greater FcRn-binding affinity, the antibodies of the present invention may have a longer circulating half-life in the patient's body and can be administered less frequently. The antibodies of the present invention can also be used in the preparation of drugs for treating diseases through inhibition of the alternative complement pathway. [Brief explanation of the drawings]
[0018] [Figure 1] Figure 1 shows the dose-dependent binding of anti-properdin binders to native, purified human properdin. The anti-human properdin mAbs of the present invention tested showed significant binding to the native antigen.
[0019] [Figure 2a] Figure 2a shows that the anti-human properdin mAbs of the present invention inhibit the lysis of rabbit red blood cells (RBCs) through the human alternative complement pathway. This lysis was almost completely inhibited by each of the anti-properdin mAbs tested. An isotype control mAb was used as a negative control and showed only slight inhibition of lysis. [Figure 2b] Figure 2b shows that the anti-human properdin mAbs of the present invention inhibit the lysis of rabbit red blood cells (RBCs) through the human alternative complement pathway. This lysis was almost completely inhibited by each of the anti-properdin mAbs tested. An isotype control mAb was used as a negative control and showed only slight inhibition of lysis.
[0020] [Figure 3a] Figure 3a shows that anti-properdin mAbs cross-react with monkey properdin in monkey serum. All humanized anti-human properdin mAbs of the present invention tested were able to inhibit lysis of rabbit RBCs via the monkey alternative complement system from monkey serum.
[0021] [Figure 3b] Figure 3b shows the hemolysis inhibitory activity of anti-properdin mAb P15(GLS) in six different monkeys. P15(GLS) was able to inhibit monkey serum-mediated lysis of rabbit RBCs by 85–95% in the different monkeys.
[0022] [Figure 4] Figure 4 shows that LPS-induced complement activation is inhibited in a dose-dependent manner by all mAbs of the present invention tested. All mAbs tested effectively inhibited normal human serum (NHS)-mediated complement activation at both concentrations tested. All mAbs tested showed significant inhibition of MAC formation.
[0023] [Figure 5]Figure 5 shows that the anti-properdin mAb of the present invention inhibits the hemolysis of autologous RBCs induced by human serum, which is caused by dysfunction of CD55 and CD59. Human RBCs are generally not lysed in the presence of autologous human serum. However, in the presence of anti-CD55 and anti-CD59, the complement pathway is deregulated, leading to hemolysis of autologous RBCs by autologous serum. This lysis was inhibited by each of the anti-properdin mAbs tested.
[0024] [Figure 6] FIG. 6 shows that human serum-induced hemolysis of pronase-treated autologous RBCs is inhibited by all anti-properdin mAbs of the invention tested.
[0025] [Figure 7] FIG. 7 shows that TNF-α production induced by intratracheal LPS instillation in mice is reduced by rabbit anti-mouse properdin mAb (a surrogate antibody for the anti-properdin antibody of the present invention).
[0026] [Figure 8] FIG. 8 shows that IL-6 production induced by intratracheal LPS instillation in mice is reduced by rabbit anti-mouse properdin mAb (a surrogate antibody of the anti-properdin antibody of the present invention).
[0027] definition
[0028] The term "antibody," as used herein, includes whole antibodies and any antigen-binding fragment (i.e., "antigen-binding portion") or single chain thereof. "Antibody" refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains connected together by disulfide bonds, or an antigen-binding portion thereof. Each heavy chain contains a heavy chain variable region (referred to herein as V H Each light chain consists of a light chain variable region (abbreviated herein as V) and a heavy chain constant region. The heavy chain constant region consists of three domains, CH1, CH2, and CH3. LThe light chain constant region consists of one domain, C L V H Area and V L The regions can be further subdivided into hypervariable regions (called complementarity-determining regions (CDRs)), interspersed with more conserved regions called framework regions (FRs). H and V L Each antibody consists of three CDRs and four FRs, arranged from the amino terminus to the carboxy terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain binding domains that interact with antigens. The constant regions of the antibody mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system, such as effector cells (NK cells, T cells, macrophages, and dendritic cells) and the first component (C1q) of the classical complement system.
[0029] The term "operably linked" is intended to mean that the antibody gene is ligated into a vector such that transcriptional and translational control sequences within the vector perform their intended function of regulating the transcription and translation of the antibody gene.
[0030] "K a ” is the association rate of a specific antibody-antigen interaction, whereas “K d The symbol "K" is the dissociation rate of a particular antibody-antigen interaction. D ” is the affinity rate constant, K a K d It can be measured using surface plasma resonance techniques well known in the art.
[0031] The terms "monoclonal antibody" or "monoclonal antibody composition" as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
[0032] The term "bispecific antibody" refers to a homogeneous antibody population involved in the highly specific recognition and binding of two different antigenic determinants or epitopes.
[0033] The term "recombinant antibody," as used herein, includes all antibodies that are prepared, expressed, created, or isolated by recombinant means. However, in certain embodiments, such recombinant antibodies may be obtained by in vitro mutagenesis, and therefore, the V of the recombinant antibodies described herein may be modified. H Area and V L The amino acid sequence of the region is one that may not naturally occur in the human antibody germline repertoire in vivo.
[0034] The term "human antibody" includes antibodies having variable and constant regions, if present, derived from human immunoglobulin sequences, preferably human germline sequences.
[0035] The term "chimeric antibodies and antigen-binding fragments thereof," as used herein, includes portions from two or more different species (e.g., mouse and human). Chimeric antibodies can be generated using mouse variable regions of desired specificity fused to human constant regions (e.g., as described in U.S. Pat. No. 4,816,567). In this manner, non-human antibodies can be modified to make them more suitable for clinical application in humans (e.g., methods for treating or preventing complement-mediated disorders in subjects).
[0036] "Humanized" forms of non-human (e.g., murine) antibodies, as used herein, are chimeric antibodies containing minimal sequence derived from non-human immunoglobulin. Humanized antibodies are largely human immunoglobulins (recipient antibodies) in which residues from the recipient's hypervariable regions are replaced by residues from a hypervariable region of a non-human species (donor antibody) (e.g., mouse, rat, rabbit, or non-human primate) possessing the desired specificity, affinity, and capacity. In some cases, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies can include residues that are not found in the recipient antibody or the donor antibody. These modifications are made to further refine antibody performance. In general, humanized antibodies comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
[0037] The term "pharmaceutical formulation" means a preparation in which the biological activity of an active ingredient is clearly effective. The terms "pharmaceutical formulation" or "pharmaceutical composition" or "composition" can be used interchangeably.
[0038] The term "excipient" refers to an agent that can be added to a pharmaceutical formulation to regulate and maintain the osmolality and pH of the pharmaceutical composition and to stabilize the active drug substance in the formulated form. Non-limiting examples of commonly used excipients include sugars, polyols, amino acids, surfactants, and polymers. A "pharmaceutically acceptable" excipient is one that can be reasonably administered to provide an effective dose of the active ingredient used to a mammalian subject.
[0039] The terms "treatment" or "therapy," as used herein, refer to any treatment of disease in a mammal, particularly a human, including (a) preventing the disease in a subject prone to or at risk for the disease but not yet diagnosed with the disease; (b) inhibiting the disease, i.e., halting its progression; and (c) palliating the disease, i.e., causing regression of the disease.
[0040] The terms "patient" and "subject" are used interchangeably and in their usual sense to refer to living beings suffering from or prone to a condition that can be prevented or treated by administering the compositions of the present invention, including both humans and non-human animals. Non-limiting examples of subjects include humans, chimpanzees, and other apes and monkeys; livestock (such as cows, sheep, pigs, goats, and horses); domesticated mammals (such as dogs and cats); laboratory animals (including rodents such as mice, rats, and guinea pigs); and birds (including domesticated, wild, and game birds, including chickens, turkeys and other galliformes, ducks, geese, and the like). The terms do not imply a particular age. Thus, adult, pre-adult, and fetal individuals are of interest.
[0041] [Table 1]
[0042] Other abbreviations used in this application ADCC: Antibody-dependent cytotoxicity aHUS: Atypical hemolytic uremic syndrome CDC: Complement-dependent cytotoxicity CDR: Complementarity determining region CH: Heavy chain constant region CL: Light chain constant region DEPC: diethyl pyrocarbonate EDTA: Ethylenediaminetetraacetic acid EGTA: Ethylene glycol bis(β-aminoethyl ether)-N,N,N',N"-tetraacetic acid FcRn: fetal Fc receptor FR: Framework area HCVR: heavy chain variable region HC: Heavy chain IPTG: Isopropyl β-D-1-thiogalactopyranoside iv: intravenous K a : Association constant K d :Dissociation constant K D :equilibrium dissociation constant LCVR: light chain variable region LC: light chain LPS: lipopolysaccharide mAb: monoclonal antibody MAC: membrane attack complex NHS: normal human serum OD: optical density P20: Polysorbate 20 PBS: phosphate buffered saline PF buffer: Periplasmic fraction buffer Pfx: proofreading DNA polymerase, Pfx™ from Invitrogen PNH: Paroxysmal nocturnal hemoglobinuria RBC: red blood cell RPM: Revolutions per minute RPMI: Roswell Park Memorial Institute sc: subcutaneous scFv: single chain fragment variable SEQ / seq: Sequence SPR: surface plasmon resonance TMA: Thrombotic microangiopathy TMB: 3,3',5,5'-tetramethylbenzidine V H : Heavy chain variable region V L :Light chain variable region
[0043] Embodiments of the present invention
[0044] The present disclosure relates to novel anti-properdin antibodies that can be used for therapeutic purposes.
[0045] In one embodiment, an anti-properdin antibody or binding portion thereof of the invention binds to human properdin with high affinity.
[0046] In one embodiment, the present invention provides an anti-properdin antibody or antigen-binding portion thereof, (a) General formula (I): GYX 1a -X 2a -X 3a -X 4a -X 5a -X 6a -X 7a CDRH1; (b) General formula (II):X 1b -IX 2b -X 3b -X 4b -X 5b -X 6b -X 7b CDRH2; (c) General formula (III):X 1c -X 2c -X 3c -X 4c -X 5c -X 6c -X 7c- X 8c -X 9c -X 10c -X 11c -X 12c -X 13c -X 14c CDRH3; (d) General formula (IV):X 1d -X 2d -X 3d -X 4d -X 5d -X 6d -X 7d- X 8d -X 9d -X 10d -X 11d -X 12d -X 13d -X 14d -X 15d -X 16d -X17d CDRL1; (e) General formula (V):X 1e -X 2e -X 3e -X 4e -X 5e -X 6e -X 7e CDRL2; and (f) General formula (VI):X 1f -X 2f -X 3f -X 4f -X 5f -X 6f -X 7f- X 8f -X 9f -X 10f -X 11f CDRL3 of X 1a is an amino acid selected from serine and threonine; X 2a is an amino acid selected from phenylalanine and isoleucine; X 3a is an amino acid selected from threonine and alanine; X 4a is an amino acid selected from aspartic acid, serine, and histidine; X 5a is an amino acid selected from tyrosine, asparagine, glycine, and threonine; X 6a and X 7a each of which may be present or absent and, when present, is a tyrosine amino acid; X 1b is an amino acid selected from valine, leucine, tyrosine, and glutamic acid; X 2b is an amino acid selected from serine, asparagine, and aspartic acid; X 3b is an amino acid selected from threonine, proline, and tyrosine; X 4b is an amino acid selected from tyrosine, glycine, aspartic acid, and serine; X 5b is an amino acid selected from tyrosine, threonine, glycine, and alanine; X 6b is an amino acid selected from glycine, aspartic acid, and threonine; X 7b is an amino acid selected from aspartic acid, tyrosine, and asparagine; X 1c is an amino acid selected from aspartic acid, glutamic acid, alanine, and arginine; X 2c is an amino acid selected from leucine, aspartic acid, lysine, and glycine; X 3c is an amino acid selected from aspartic acid, tyrosine, serine, and leucine; X 4c is an amino acid selected from glycine, aspartic acid, arginine, tyrosine, leucine, serine, and lysine; X 5c is an amino acid selected from tyrosine, arginine, aspartic acid, and glycine; X 6c is an amino acid selected from glutamic acid, serine, phenylalanine, tyrosine, and asparagine; X 7c is an amino acid selected from serine, proline, aspartic acid, and phenylalanine, or is no amino acid; X 8c is an amino acid selected from methionine, tryptophan, phenylalanine, and valine, or is no amino acid; X 9c is an amino acid selected from aspartic acid and phenylalanine, or is no amino acid; X 10c and X 11c each of which is present or absent and, when present, is an amino acid independently selected from tyrosine and alanine; X 12c, X 13c , and X 14c each of which is present or absent and, when present, is an amino acid independently selected from methionine, aspartic acid, and tyrosine; X 1d is an amino acid selected from arginine, lysine, leucine, serine, tyrosine, and glutamic acid; X 2d is an amino acid selected from proline, serine, alanine, leucine, glycine, and glutamine; X 3d is an amino acid selected from serine, aspartic acid, arginine, and tryptophan; X 4d is an amino acid selected from glutamine, glycine, serine, and leucine; X 5d is an amino acid selected from aspartic acid, serine, threonine, proline, and leucine; X 6d is an amino acid selected from isoleucine, valine, leucine, serine, asparagine, phenylalanine, and glycine; X 7d is an amino acid selected from asparagine, leucine, glycine, proline, isoleucine, lysine, and histidine; X 8d is an amino acid selected from asparagine, aspartic acid, threonine, glycine, arginine, glutamine, and tyrosine; X 9d is an amino acid selected from tyrosine, isoleucine, tryptophan, asparagine, glycine, valine, histidine, and serine; X 10d is an amino acid selected from leucine, asparagine, threonine, lysine, arginine, and serine; X 11d is an amino acid selected from serine, glycine, alanine, tyrosine, proline, aspartic acid, and asparagine; X12d is an amino acid selected from lysine, valine, threonine, alanine, and glutamine, or is no amino acid; X 13d is an amino acid selected from threonine, serine, asparagine, and lysine, or is no amino acid; X 14d , X 15d , X 16d , and X 17d each of which is present or absent and, when present, is an amino acid independently selected from tyrosine, leucine, asparagine, and alanine; X 1e is an amino acid selected from aspartic acid, tryptophan, tyrosine, leucine, and alanine; X 2e is an amino acid selected from asparagine, alanine, threonine, and valine; X 3e is an amino acid selected from asparagine, serine, and threonine; X 4e is an amino acid selected from lysine, threonine, arginine, and serine; X 5e is an amino acid selected from arginine and leucine; X 6e is an amino acid selected from phenylalanine, glutamic acid, histidine, aspartic acid, and alanine; X 7e is an amino acid selected from serine and aspartic acid; In one embodiment, the CDR3 of the light chain of an anti-properdin antibody, or antigen-binding portion thereof, of the invention (hereinafter referred to as CDRL3) comprises X 1f -X 2f -X 3f -X 4f -X 5f -X 6f -X 7f- X 8f -X 9f -X 10f -X 11f It has the amino acid sequence X 1f is an amino acid selected from histidine, glutamine, tryptophan, alanine, glycine, and methionine; X 2f is an amino acid selected from glutamine, alanine, and threonine; X 3f is an amino acid selected from tyrosine, glycine, leucine, arginine, tryptophan, and glutamine; X 4f is an amino acid selected from leucine, asparagine, threonine, tyrosine, glutamine, and aspartic acid; X 5f is an amino acid selected from serine, threonine, histidine, alanine, and glycine; X 6f is an amino acid selected from serine, leucine, phenylalanine, threonine, isoleucine, and tyrosine; X 7f is an amino acid selected from tyrosine, proline, and leucine; X 8f is an amino acid selected from threonine, proline, tyrosine, tryptophan, and arginine; X 9f is an amino acid selected from threonine and glutamic acid, or is no amino acid; X 10f is an amino acid selected from alanine and leucine, or is no amino acid; X 11f is a valine amino acid or no amino acid.
[0047] In one embodiment, the amino acid sequence of the constant region of the anti-properdin antibody is l , IgG2, IgG3, IgG4, IgG2 / G4, IgA, IgE, IgM, or IgD constant regions, preferably IgG l or IgG4.
[0048] In another embodiment, one or more anti-properdin antibodies of the invention have altered, reduced, or no ADCC and / or CDC activity. In one embodiment, an anti-properdin antibody, or antigen-binding portion thereof, has a reduced ability to pose ADCC and CDC safety concerns.
[0049] In one embodiment, one or more anti-properdin antibodies of the invention have reduced or no ADCP activity.
[0050] In one embodiment, the anti-properdin antibody or antigen-binding portion thereof of the present invention has a 10 -8 M or less, preferably 10 -10 K below M D K D The value is a measure of the binding affinity of an antibody towards its target antigen.
[0051] In one embodiment, an anti-properdin antibody, or antigen-binding portion thereof, of the invention cross-reacts with properdin from a species other than human.
[0052] In one embodiment, the anti-properdin antibodies or antigen-binding portions thereof of the invention have greater specificity for human properdin.
[0053] In one embodiment, the anti-properdin antibody, or antigen-binding portion thereof, of the invention has an extended half-life in a subject compared to an anti-properdin antibody with a conventional Fc fragment.
[0054] In one embodiment, an anti-properdin antibody, or antigen-binding portion thereof, of the invention blocks the function of properdin in mediating alternative complement pathway activation.
[0055] In one embodiment, an anti-properdin antibody, or antigen-binding portion thereof, of the invention blocks properdin from binding to a target cell.
[0056] In one embodiment, an anti-properdin antibody, or antigen-binding portion thereof, of the invention can block increased binding of C3b to the surface of target cells.
[0057] In one embodiment, an anti-properdin antibody, or antigen-binding portion thereof, of the invention modulates MAC formation on the surface of a target cell, thereby preventing cell lysis.
[0058] In one embodiment, an anti-properdin antibody, or antigen-binding portion thereof, of the invention can minimize the formation of anaphylatoxins C3a and C5a.
[0059] In one embodiment, an anti-properdin antibody, or antigen-binding portion thereof, of the invention prevents complement-mediated lysis of a target cell.
[0060] In one embodiment, the anti-properdin antibody, or antigen-binding portion thereof, of the invention has an improved circulating half-life.
[0061] In another embodiment, an anti-properdin antibody or antigen-binding portion thereof can bind to simian properdin, thereby facilitating drug development by providing an animal model of relevant pharmacology and toxicology.
[0062] In one embodiment, the invention provides a composition comprising an anti-properdin antibody that specifically binds to human properdin (factor P) and an acceptable carrier.
[0063] In another embodiment, the anti-properdin antibodies or antigen-binding portions thereof of the present invention can be used to treat diseases in which properdin activity is detrimental, such as infectious diseases, various cancers, autoimmune disorders, and other disorders in which complement activity is amplified, such as PNH and aHUS. DETAILED DESCRIPTION OF THE INVENTION
[0064] In one embodiment, an anti-properdin antibody, or antigen-binding portion thereof, of the invention binds to human properdin with high affinity.
[0065] Amino acid sequence of anti-properdin antibody
[0066] In one embodiment, the CDR1 of the heavy chain of an anti-properdin antibody, or antigen-binding portion thereof, of the invention (hereinafter referred to as CDRH1) has the general formula (I): GYX 1a -X 2a -X 3a -X 4a -X 5a -X 6a -X 7a It has an amino acid sequence of X 1a is an amino acid selected from serine and threonine; X 2a is an amino acid selected from phenylalanine and isoleucine; X 3a is an amino acid selected from threonine and alanine; X 4a is an amino acid selected from aspartic acid, serine, and histidine; X 5a is an amino acid selected from tyrosine, asparagine, glycine, and threonine; X 6a and X 7a Each of may be present or absent and, when present, is a tyrosine amino acid.
[0067] In one embodiment, the CDR2 of the heavy chain of an anti-properdin antibody, or antigen-binding portion thereof, of the invention (hereinafter referred to as CDRH2) comprises X 1b -IX 2b -X 3b -X 4b -X 5b -X 6b -X 7b It has an amino acid sequence of X 1b is an amino acid selected from valine, leucine, tyrosine, and glutamic acid; X 2bis an amino acid selected from serine, asparagine, and aspartic acid; X 3b is an amino acid selected from threonine, proline, and tyrosine; X 4b is an amino acid selected from tyrosine, glycine, aspartic acid, and serine; X 5b is an amino acid selected from tyrosine, threonine, glycine, and alanine; X 6b is an amino acid selected from glycine, aspartic acid, and threonine; X 7b is an amino acid selected from aspartic acid, tyrosine, and asparagine.
[0068] In one embodiment, the CDR3 of the heavy chain of an anti-properdin antibody, or antigen-binding portion thereof, of the invention (hereinafter referred to as CDRH3) comprises X 1c -X 2c -X 3c -X 4c -X 5c -X 6c -X 7c- X 8c -X 9c -X 10c -X 11c -X 12c -X 13c -X 14c It has an amino acid sequence of X 1c is an amino acid selected from aspartic acid, glutamic acid, alanine, and arginine; X 2c is an amino acid selected from leucine, aspartic acid, lysine, and glycine; X 3c is an amino acid selected from aspartic acid, tyrosine, serine, and leucine; X 4c is an amino acid selected from glycine, aspartic acid, arginine, tyrosine, leucine, serine, and lysine; X 5cis an amino acid selected from tyrosine, arginine, aspartic acid, and glycine; X 6c is an amino acid selected from glutamic acid, serine, phenylalanine, tyrosine, and asparagine; X 7c is an amino acid selected from serine, proline, aspartic acid, and phenylalanine, or is no amino acid; X 8c is an amino acid selected from methionine, tryptophan, phenylalanine, and valine, or is no amino acid; X 9c is an amino acid selected from aspartic acid and phenylalanine, or is no amino acid; X 10c and X 11c each of which is present or absent and, when present, is an amino acid independently selected from tyrosine and alanine; X 12c , X 13c , and X 14c Each of is present or absent and, when present, is an amino acid independently selected from methionine, aspartic acid, and tyrosine.
[0069] In one embodiment, the CDR1 (hereinafter referred to as CDRL1) of the light chain of an anti-properdin antibody, or antigen-binding portion thereof, of the invention comprises X 1d -X 2d -X 3d -X 4d -X 5d -X 6d -X 7d- X 8d -X 9d -X 10d -X 11d -X 12d -X 13d -X 14d -X 15d -X 16d -X 17d It has an amino acid sequence of X 1dis an amino acid selected from arginine, lysine, leucine, serine, tyrosine, and glutamic acid; X 2d is an amino acid selected from proline, serine, alanine, leucine, glycine, and glutamine; X 3d is an amino acid selected from serine, aspartic acid, arginine, and tryptophan; X 4d is an amino acid selected from glutamine, glycine, serine, and leucine; X 5d is an amino acid selected from aspartic acid, serine, threonine, proline, and leucine; X 6d is an amino acid selected from isoleucine, valine, leucine, serine, asparagine, phenylalanine, and glycine; X 7d is an amino acid selected from asparagine, leucine, glycine, proline, isoleucine, lysine, and histidine; X 8d is an amino acid selected from asparagine, aspartic acid, threonine, glycine, arginine, glutamine, and tyrosine; X 9d is an amino acid selected from tyrosine, isoleucine, tryptophan, asparagine, glycine, valine, histidine, and serine; X 10d is an amino acid selected from leucine, asparagine, threonine, lysine, arginine, and serine; X 11d is an amino acid selected from serine, glycine, alanine, tyrosine, proline, aspartic acid, and asparagine; X 12d is an amino acid selected from lysine, valine, threonine, alanine, and glutamine, or is no amino acid; X 13dis an amino acid selected from threonine, serine, asparagine, and lysine, or is no amino acid; X 14d , X 15d , X 16d , and X 17d and each of X is present or absent, and when present, is an amino acid independently selected from tyrosine, leucine, asparagine, and alanine. In one embodiment, the CDR2 of the light chain of an anti-properdin antibody, or antigen-binding portion thereof, of the invention (hereinafter referred to as CDRL2) comprises X 1e -X 2e -X 3e -X 4e -X 5e -X 6e -X 7e It has an amino acid sequence of X 1e is an amino acid selected from aspartic acid, tryptophan, tyrosine, leucine, and alanine; X 2e is an amino acid selected from asparagine, alanine, threonine, and valine; X 3e is an amino acid selected from asparagine, serine, and threonine; X 4e is an amino acid selected from lysine, threonine, arginine, and serine; X 5e is an amino acid selected from arginine and leucine; X 6e is an amino acid selected from phenylalanine, glutamic acid, histidine, aspartic acid, and alanine; X 7e is an amino acid selected from serine and aspartic acid
[0070] In one embodiment, the CDR3 of the light chain of an anti-properdin antibody, or antigen-binding portion thereof, of the invention (hereinafter referred to as CDRL3) comprises X 1f -X 2f -X 3f -X 4f -X5f -X 6f -X 7f- X 8f -X 9f -X 10f -X 11f It has an amino acid sequence of X 1f is an amino acid selected from histidine, glutamine, tryptophan, alanine, glycine, and methionine; X 2f is an amino acid selected from glutamine, alanine, and threonine; X 3f is an amino acid selected from tyrosine, glycine, leucine, arginine, tryptophan, and glutamine; X 4f is an amino acid selected from leucine, asparagine, threonine, tyrosine, glutamine, and aspartic acid; X 5f is an amino acid selected from serine, threonine, histidine, alanine, and glycine; X 6f is an amino acid selected from serine, leucine, phenylalanine, threonine, isoleucine, and tyrosine; X 7f is an amino acid selected from tyrosine, proline, and leucine; X 8f is an amino acid selected from threonine, proline, tyrosine, tryptophan, and arginine; X 9f is an amino acid selected from threonine and glutamic acid, or is no amino acid; X 10f is an amino acid selected from alanine and leucine, or is no amino acid; X 11f is either a valine amino acid or no amino acid
[0071] In one embodiment, CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 of an anti-properdin antibody, or antigen-binding portion thereof, of the invention are selected from the amino acid sequences provided in Table 2 below.
[0072] [Table 2]
[0073] Thus, in another embodiment, the present invention provides an anti-properdin antibody, or antigen-binding portion thereof, comprising a heavy chain variable region comprising the sequences of CDRH1, CDRH2, and CDRH3, and a light chain variable region comprising the sequences of CDRL1, CDRL2, and CDRL3; An anti-properdin antibody or antigen-binding portion thereof is provided, wherein: (a) the heavy chain variable region CDRH3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 13, 14, 15, 16, 17, and 18, and conservative modifications thereof; and (b) the light chain variable region CDRL3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 35, 36, 37, 38, 39, 40, 41, 42, and 43, and conservative modifications thereof.
[0074] In another preferred embodiment, a heavy chain variable region CDRH2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 7, 8, 9, 10, and 11, and conservative modifications thereof; and a light chain variable region CDRL2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 31, 32, 33, and 34, and conservative modifications thereof.
[0075] In another preferred embodiment, a heavy chain variable region CDRH1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 2, 3, 4, and 5, and conservative modifications thereof; and a light chain variable region CDRL1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, and 29, and conservative modifications thereof.
[0076] In another embodiment, the present invention provides an antibody or antigen-binding portion thereof comprising: (a) a heavy chain variable region CDRH1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 2, 3, 4, and 5; (b) a heavy chain variable region CDRH2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 7, 8, 9, 10, and 11; (c) a heavy chain variable region CDRH3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 13, 14, 15, 16, 17, and 18; (d) a light chain variable region CDRL1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, and 29; (e) a light chain variable region CDRL2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 31, 32, 33, and 34; and (f) an antibody or antigen-binding portion thereof comprising a light chain variable region CDRL3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 35, 36, 37, 38, 39, 40, 41, 42, and 43, wherein the antibody specifically binds to properdin, preferably human properdin.
[0077] In another embodiment, the HCVRs and LCVRs of an anti-properdin antibody, or antigen-binding portion thereof, of the invention are selected from the amino acid sequences provided in Table 3 below.
[0078] [Table 3-1] [Table 3-2]
[0079] In one embodiment, the variable region of the heavy chain of an anti-properdin antibody of the invention, or an antigen-binding portion thereof, comprises CDRH1, CDRH2, and CDRH3 comprising amino acid sequences selected from Table 4 below.
[0080] [Table 4]
[0081] In one embodiment, the variable region of the light chain of an anti-properdin antibody, or antigen-binding portion thereof, of the invention has a combination of CDRL1, CDRL2, and CDRL3 amino acid sequences selected from Table 5 below.
[0082] [Table 5]
[0083] Therefore, according to the present invention, an anti-properdin antibody or an antigen-binding portion thereof comprising a heavy chain variable region and a light chain variable region is (a) the heavy chain variable region comprises an amino acid sequence at least 80% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, and 55; (b) an anti-properdin antibody or antigen-binding portion thereof is provided, wherein the light chain variable region comprises an amino acid sequence that is at least 80% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOs: 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, and 83.
[0084] Preferably, according to the present invention, an anti-properdin antibody or an antigen-binding portion thereof comprising a heavy chain variable region and a light chain variable region is (a) the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, and 55; (b) an anti-properdin antibody or antigen-binding portion thereof, wherein the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, and 83.
[0085] One preferred combination of CDRs of an anti-properdin antibody or antigen-binding portion thereof of the present invention is (a) a heavy chain variable region CDRH1 comprising SEQ ID NO: 1; (b) a heavy chain variable region CDRH2 comprising SEQ ID NO:7; (c) a heavy chain variable region CDRH3 comprising SEQ ID NO: 13; (d) a light chain variable region CDRL1 comprising SEQ ID NO: 20; (e) a light chain variable region CDRL2 comprising SEQ ID NO: 31; and (f) a light chain variable region CDRL3 comprising SEQ ID NO: 37.
[0086] Another preferred combination of CDRs of the anti-properdin antibody or antigen-binding portion thereof of the present invention is (a) a heavy chain variable region CDRH1 comprising SEQ ID NO: 1; (b) a heavy chain variable region CDRH2 comprising SEQ ID NO:7; (c) a heavy chain variable region CDRH3 comprising SEQ ID NO: 13; (d) a light chain variable region CDRL1 comprising SEQ ID NO: 21; (e) a light chain variable region CDRL2 comprising SEQ ID NO: 32; and (f) a light chain variable region CDRL3 comprising SEQ ID NO: 38
[0087] Another preferred combination of CDRs of the anti-properdin antibody or antigen-binding portion thereof of the present invention is (a) a heavy chain variable region CDRH1 comprising SEQ ID NO: 1; (b) a heavy chain variable region CDRH2 comprising SEQ ID NO:7; (c) a heavy chain variable region CDRH3 comprising SEQ ID NO: 13; (d) a light chain variable region CDRL1 comprising SEQ ID NO: 21; (e) a light chain variable region CDRL2 comprising SEQ ID NO: 32; and (f) a light chain variable region CDRL3 comprising SEQ ID NO: 36
[0088] Another preferred combination of CDRs of the anti-properdin antibody or antigen-binding portion thereof of the present invention is (a) a heavy chain variable region CDRH1 comprising SEQ ID NO:2; (b) a heavy chain variable region CDRH2 comprising SEQ ID NO:8; (c) a heavy chain variable region CDRH3 comprising SEQ ID NO: 14; (d) a light chain variable region CDRL1 comprising SEQ ID NO: 20; (e) a light chain variable region CDRL2 comprising SEQ ID NO: 31; and (f) a light chain variable region CDRL3 comprising SEQ ID NO: 36
[0089] Another preferred combination of CDRs of the anti-properdin antibody or antigen-binding portion thereof of the present invention is (a) a heavy chain variable region CDRH1 comprising SEQ ID NO:3; (b) a heavy chain variable region CDRH2 comprising SEQ ID NO: 9; (c) a heavy chain variable region CDRH3 comprising SEQ ID NO: 15; (d) a light chain variable region CDRL1 comprising SEQ ID NO: 22; (e) a light chain variable region CDRL2 comprising SEQ ID NO: 33; and (f) a light chain variable region CDRL3 comprising SEQ ID NO: 39
[0090] Another preferred combination of CDRs of the anti-properdin antibody or antigen-binding portion thereof of the present invention is (a) a heavy chain variable region CDRH1 comprising SEQ ID NO:4; (b) a heavy chain variable region CDRH2 comprising SEQ ID NO: 10; (c) a heavy chain variable region CDRH3 comprising SEQ ID NO: 16; (d) a light chain variable region CDRL1 comprising SEQ ID NO: 23; (e) a light chain variable region CDRL2 comprising SEQ ID NO: 34; and (f) a light chain variable region CDRL3 comprising SEQ ID NO: 40
[0091] Another preferred combination of CDRs of the anti-properdin antibody or antigen-binding portion thereof of the present invention is (a) a heavy chain variable region CDRH1 comprising SEQ ID NO:5; (b) a heavy chain variable region CDRH2 comprising SEQ ID NO: 11; (c) a heavy chain variable region CDRH3 comprising SEQ ID NO: 18; (d) a light chain variable region CDRL1 comprising SEQ ID NO: 29; (e) a light chain variable region CDRL2 comprising SEQ ID NO: 30; and (f) a light chain variable region CDRL3 comprising SEQ ID NO: 41
[0092] Another preferred combination of CDRs of the anti-properdin antibody or antigen-binding portion thereof of the present invention is (a) a heavy chain variable region CDRH1 comprising SEQ ID NO:5; (b) a heavy chain variable region CDRH2 comprising SEQ ID NO: 11; (c) a heavy chain variable region CDRH3 comprising SEQ ID NO: 17; (d) a light chain variable region CDRL1 comprising SEQ ID NO: 29; (e) a light chain variable region CDRL2 comprising SEQ ID NO: 30; and (f) a light chain variable region CDRL3 comprising SEQ ID NO: 41
[0093] Another preferred combination of CDRs of the anti-properdin antibody or antigen-binding portion thereof of the present invention is (a) a heavy chain variable region CDRH1 comprising SEQ ID NO: 1; (b) a heavy chain variable region CDRH2 comprising SEQ ID NO: 6; (c) a heavy chain variable region CDRH3 comprising SEQ ID NO: 12; (d) a light chain variable region CDRL1 comprising SEQ ID NO: 19; (e) a light chain variable region CDRL2 comprising SEQ ID NO: 30; and (f) a light chain variable region CDRL3 comprising SEQ ID NO: 35
[0094] One preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 51; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 63.
[0095] Another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 52; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 64.
[0096] Yet another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 53; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 65.
[0097] Another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 54; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 66.
[0098] Another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 45; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 57.
[0099] Yet another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 45; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 58.
[0100] Another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 45; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 59.
[0101] Yet another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 46; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 57.
[0102] Another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 47; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 60.
[0103] Another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 48; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 61.
[0104] Another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 55; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 79.
[0105] Yet another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 55; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 56.
[0106] Yet another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 50; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 62.
[0107] Another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 44; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 56.
[0108] Yet another preferred combination of HCVR and LCVR of an anti-properdin antibody, or antigen-binding portion thereof, of the invention is (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49; and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 62.
[0109] The antibodies of the present invention can be full-length (e.g., IgG1, IgG4, or IgG2 antibodies) or can contain only the antigen-binding portion (e.g., a Fab fragment, F(ab')2 fragment, or scFv fragment), optionally modified to affect function, e.g., to eliminate residual effector function (e.g., ADCC and CDC activity). Human antibodies can exist in two forms related to hinge heterogeneity. In one form, the antibody comprises a stable four-chain construct of approximately 150-160 kDa, in which dimers are held together by interchain heavy chain disulfide bonds. In the second form, the dimers are not linked by interchain disulfide bonds, forming a molecule of approximately 75-80 kDa consisting of covalently linked light and heavy chains (half antibody). This latter form has proven extremely difficult to separate, even after affinity purification. The frequency of the second form in various full IgG isotypes is due to, but not limited to, structural differences associated with antibody hinge region isotypes. A single amino acid substitution within the hinge region of a human IgG4 hinge can significantly reduce the occurrence of the second form (6), typically to levels observed with a human IgG1 hinge. Full-length antibodies comprising the CDRs or variable regions of the present invention further comprise the single amino acid substitution (i.e., S228P) when developed in the IgG4 format.
[0110] In a further embodiment, the antibody or antigen-binding portion thereof of the invention that targets the properdin antigen is murine, chimeric, human, or humanized in nature, preferably chimeric or human or humanized in nature, and more preferably humanized in nature.
[0111] The antibodies (preferably monoclonal antibodies) of the present application preferably include "humanized" forms of non-human (e.g., murine) antibodies. Humanized or CDR-grafted mAbs are particularly useful as human therapeutics because they are not cleared from the circulation as rapidly as murine antibodies and typically do not provoke an adverse immune response. Generally, humanized antibodies have one or more amino acid residues introduced from a non-human source. Methods for preparing humanized antibodies are generally well known in the art. For example, humanization can be performed essentially according to the method of Winter and coworkers (7, 8, 9, and 10), by replacing rodent framework or CDR sequences with the corresponding sequences of a human antibody. In some embodiments, humanized forms of non-human (e.g., murine) antibodies are human antibodies (recipient antibodies) in which amino acid residues from the CDR regions of a non-human antibody (e.g., a mouse, rat, rabbit, or non-human primate antibody) with desired specificity, affinity, and binding capacity have been grafted onto the framework scaffold of a human antibody.
[0112] In some cases, amino acid residues in one or more framework regions of the human immunoglobulin are also substituted by the corresponding amino acid residues in a non-human antibody (so-called "back mutations"). In addition, phage display libraries can be used to alter amino acids at selected positions within the antibody sequence. The properties of the humanized antibody are also influenced by the choice of human framework. Furthermore, humanized and chimeric antibodies can be modified to include residues that are not found in the recipient or donor antibody, further improving antibody properties (e.g., affinity or effector functions).
[0113] In another aspect, the anti-properdin antibodies of the present invention have increased FcRn binding, extended half-life, and altered, reduced, or absent ADCC and / or CDC activity. Because the anti-properdin antibodies of the present invention have an extended half-life compared to known anti-properdin antibodies, they can be administered to subjects at reduced doses and with better administration regimens. In one embodiment, the anti-properdin antibodies of the present invention have the amino acid sequence of an IgG4 constant region containing the mutations P329G and / or M428L and N434S. The constant region of an anti-properdin antibody containing all three of the above mutations in the IgG4 constant region is referred to herein as IgG4(GLS). In one aspect, the anti-properdin antibodies of the present invention have reduced or no ADCP activity.
[0114] In one embodiment, the anti-properdin antibody of the invention is a monoclonal antibody, a bispecific antibody, or a polyclonal antibody, with monoclonal antibodies being preferred.
[0115] Antibody preparation
[0116] The antibodies of the present invention are generated in mice using standard techniques well known in the art. The monoclonal antibodies of the present invention are converted to humanized versions for therapeutic use. Given the guidance provided herein, the hybridoma cell lines discussed herein can be readily generated by one of skill in the art. An anti-properdin scFv phage display library was developed after amplifying variable heavy (VH) and variable light (VL) genes from splenic RNA of immunized mice. VH and VL genes were generated as described herein. H and V L Both were joined by a peptide linker and cloned into a phage display vector. Panning and screening for specific properdin binders was performed.
[0117] Further modifications within the CDR and framework regions
[0118] The present invention encompasses antibodies with one or more mutations in the CDRs and / or variable regions described herein, which may have similar functional characteristics and biological activity as described for the antibodies presented herein. These mutations are known to those of skill in the art and are well within the scope of the present invention.
[0119] Further modifications within the constant region
[0120] The present invention encompasses antibodies with one or more mutations in the hinge, CH2, or CH3 regions that may be desirable, for example, to improve the circulating half-life of the antibody in a subject, to abolish immune effector function, or to enhance effector function. These mutations are known to those of skill in the art (11, 12).
[0121] Immune complexes and bispecific antibodies
[0122] Immunoconjugates comprising the antibodies of the invention, or antigen-binding portions thereof, linked to another therapeutic agent (such as a cytotoxin or a radioisotope) can also be developed. Bispecific molecules can be developed comprising the antibodies of the invention, or antigen-binding portions thereof, linked to a second functional moiety with a different binding specificity than the antibody or antigen-binding portion thereof. In one embodiment, the second functional moiety of the invention can bind to an antigen selected from C3, C5, C5a, C5b, C3a, C3b, factor B, factor H, and C1q. Methods for making bispecific antibodies are known in the art.
[0123] Nucleic acid molecules, vectors, and host cells encoding anti-properdin antibodies
[0124] In one embodiment, the present invention provides nucleic acid molecules encoding the antibodies or antigen-binding portions thereof, as well as expression vectors containing such nucleic acids and host cells containing such expression vectors. In the present application, the pZRCIII vector is used for cloning and expression of the anti-properdin antibody nucleic acid molecules of the present invention. The pZRCIII vector is described in patent document WO 2012 / 046255A2. The host cells of the present invention can be prokaryotic or eukaryotic cells; preferably, the host cells are E. coli or mammalian cells (e.g., CHO cells).
[0125] Combination of the Antiproperdin of the Present Invention with Other Drugs
[0126] The present invention provides a combination comprising at least two or more antibodies or antigen-binding portions thereof, at least one of which is an anti-properdin antibody of the present invention. The combination of the present invention may comprise a second antibody or antigen-binding portion thereof selected from an anti-C3 antibody, an anti-C5 antibody, an anti-C5a antibody, an anti-C5b antibody, an anti-C3a antibody, an anti-C3b antibody, an anti-factor B antibody, eculizumab, lampalizumab, ravulizumab, or an anti-properdin antibody, in combination with the anti-properdin antibody or antigen-binding portion thereof. In another embodiment, the present invention provides a combination comprising an anti-properdin antibody or antigen-binding portion thereof and a peptide, or a combination comprising an anti-properdin antibody or antigen-binding portion thereof and a cytokine (preferably an interleukin).
[0127] Pharmaceutical Composition
[0128] Pharmaceutical compositions can be developed containing the monoclonal antibodies, or antigen-binding portions thereof, of the invention formulated with a pharmaceutically acceptable carrier. Such compositions can contain one or a combination of (e.g., two or more different) antibodies, immunoconjugates, or bispecific molecules of the invention. For example, pharmaceutical compositions of the invention can contain a combination of antibodies (or immunoconjugates or bispecifics) that bind to different epitopes on a single target antigen, or to different epitopes on different target antigens, or that have complementary activities.
[0129] Therapeutic uses
[0130] The anti-properdin antibodies or antigen-binding portions thereof or combinations of the invention, or the bispecific antibodies or immunoconjugates of the invention can be used in therapeutic methods to treat diseases mediated directly or indirectly by a component of the alternative complement pathway and / or by a factor produced after activation of the alternative complement pathway.
[0131] In one embodiment of the present invention, the antibodies can be used to inhibit alternative pathway complement activation in vivo in subjects (including humans) suffering from diseases, non-limiting examples of which are blood disorders, chronic kidney disease, inflammatory eye disorders, various cancers, autoimmune diseases, and inflammation.
[0132] In one embodiment of the invention, the antibodies can be used to inhibit complement activation via the alternative pathway in a subject (including a human) suffering from a disease or disorder, non-limiting examples of which include atypical hemolytic uremic syndrome, hematopoietic stem cell (HSC) transplantation-associated TMA (TA-TMA); pregnancy-associated HELLP (hemolysis, elevated liver enzymes, low platelets) syndrome; infection-associated TMA or drug-associated TMA, atherosclerosis, paroxysmal nocturnal hemoglobinuria, ischemia-reperfusion (I / R) organ injury, age-related macular degeneration (AMD), geographic atrophy, ischemia-reperfusion after acute myocardial infarction, Henoch-Schonlein purpura nephritis, immune complex vasculitis, rheumatoid arthritis, arteritis, aneurysm, stroke, cardiomyopathy, sepsis-associated inflammation, hemodialysis-induced inflammation, C3 glomerulopathy, hemorrhagic shock, crush injury, multiple organ failure, hypovolemic shock and intestinal ischemia, and transplant rejection. abortion, cardiac surgery, percutaneous transluminal coronary angioplasty (PTCA), spontaneous abortion, nerve damage, severe acute respiratory syndrome (such as coronavirus disease 2019 (COVID-19)), Middle East respiratory syndrome, viral pneumonia, spinal cord injury, myasthenia gravis, Huntington's disease, amyotrophic lateral sclerosis, multiple sclerosis, Guillain-Barré syndrome, Parkinson's disease, Alzheimer's disease, acute respiratory distress syndrome, asthma, chronic obstructive pulmonary disease, transfusion-associated acute lung injury, These include acute lung injury, Goodpasture's disease, myocardial infarction, inflammation after cardiopulmonary bypass, organ transplantation, periodontal disease, cardiopulmonary bypass, septic shock, transplant rejection, xenotransplantation, burns, systemic lupus erythematosus, membranous nephritis, Buerger's disease, psoriasis, pemphigoid, dermatomyositis, antiphospholipid syndrome, inflammatory bowel disease, hemodialysis, leukapheresis, plasma exchange, heparin-derivative extracorporeal membrane oxygenation, LDL sedimentation, extracorporeal membrane oxygenation, and macular degeneration. In vivo inhibition of alternative complement pathway activation is achieved by administering an antibody to a subject.
[0133] The present invention is illustrated by the following non-limiting examples, which should not be construed in any way as limiting the scope of the invention. [Example]
[0134] The following examples are presented to provide those of skill in the art with a disclosure and description of how to implement the methods and antibodies described herein. These examples are purely illustrative and are not intended to limit the scope of the disclosure. Other antibodies of the present invention can be developed by utilizing the methods described in the provided examples with appropriate modifications. Such modifications are well known to those of skill in the art.
[0135] Example 1: Immunization of mice with human properdin antigen for binder generation
[0136] Four healthy female BALB / c mice were used in the immunization study. Two of them served as placebo controls and were immunized with PBS alone. The other two mice were immunized with human properdin. To demonstrate that the antigen preparation could induce anti-properdin antibodies in a highly susceptible species, one rabbit was used as a separate control, immunized with the same antigen preparation, and the immune response was monitored at various stages of the immunization process. All animals were acclimated for two days in the animal research facility before the immunization study began. Commercially available human properdin protein (Quidel catalog no. A412) was used for immunization. A protein emulsion was made by mixing 400 μg of human properdin (containing 400 μL of PBS) with 400 μL of complete Freund's adjuvant (CFA) in a siliconized 5 mL glass vial with a screw cap to a total volume of 800 μL, and then stirring the mixture for 10–15 minutes to form an emulsion. On day 0, a single dose of 100 μg of emulsified protein in a volume of 200 μl (0.5 μg / μL) was injected subcutaneously at four sites on the back of each mouse.
[0137] At the same time, on day 0, 400 μL containing 200 μg of protein emulsion (0.5 μg / μL) was injected subcutaneously at four sites on the back of the rabbits.
[0138] Incomplete Freund's adjuvant (IFA) was used for subsequent immunizations (boosters). After each immunization, animals received four boosters at 15-day intervals. A protein emulsion was made by mixing 200 μg of properdin (containing 400 μL of PBS) with 400 μL of incomplete Freund's adjuvant (IFA). This mixture was stirred for 10–15 minutes in a siliconized 5 mL screw-cap glass vial to form the emulsion. Each booster dose in mice was administered as a single 200 μL dose containing 50 μg of protein emulsion. Each booster dose in rabbits was administered as a 400 μL dose containing 100 μg of protein. The health of mice and rabbits was monitored daily. Blood was collected from rabbits 4–5 days before each booster to determine the titer of antibodies generated against the human properdin antigen. Serum was prepared from the blood and used in an ELISA to reveal human properdin-specific antibodies. Mice were euthanized 15 days after the fourth booster dose and spleens were harvested for hybridoma generation or preparation of total RNA for phage library generation.
[0139] Example 2: Generation of anti-properdin binders after mouse immunization
[0140] Hybridoma generation
[0141] After four boosters, mice were euthanized, and spleens were removed, minced into small pieces, and passed through a cell strainer. Cells were then resuspended in cold RPMI (Roswell Park Memorial Institute) 1640 containing 10% FBS and centrifuged at 300 g for 5 minutes. The cell pellet was resuspended in RPMI 1640 containing 1% FBS, filtered through a 50 μM syringe filter (BD #340603), and collected by centrifugation.
[0142] Hybridomas were fused as previously described using a polyethylene glycol-based protocol (13, 14). Single-cell suspensions were prepared from the spleens of immunized mice as described above and used for fusion with Sp2 / 0 bone marrow cells (ATCC). Sp2 / 0 cells and spleen cells (1:5 ratio) were fused using polyethylene glycol (MW 1500, Sigma). After fusion, to select hybridomas, cells were cultured at a concentration of 0.5 × 10 in RPMI medium (Sigma) supplemented with 10% fetal bovine serum (Gibco) and 1 × hypoxanthine-aminopterin-thymidine medium (HAT) (Sigma). 6 The cell concentration was adjusted to 100 cells / mL. 200 microliters of this cell suspension was added to each well of a 96-well culture plate to generate minipools. After approximately 10 days, the culture supernatants were tested for binding to purified native human properdin by ELISA. Properdin-reactive minipools were further expanded in 24-well and 6-well plates and T-flasks. Anti-properdin antibody samples from the culture supernatants of selected minipools were tested for binding to human properdin by ELISA.
[0143] Based on the results of human properdin reactivity in the ELISA, 11 minipools were further refined and subjected to single-cell limiting dilution. To perform limiting dilution, the minipools were seeded into 96-well culture plates at a dilution of 1 cell / well in RPMI medium supplemented with 10% fetal bovine serum. The cells were further expanded in 24-well and 6-well plates and T-flasks. The binding of the culture supernatant to human properdin was again examined by ELISA. 104 selected hybridoma clones were grown in serum-free production medium (BD Cell mAb Medium, Quantum Yield; BD Bioscience), and the culture supernatant was collected and the antibodies were purified by protein A affinity chromatography. The binding affinity of these purified antibody candidates was further examined using an SPR-based assay. 103B2(V H SEQ ID NO: 54; V L SEQ ID NO: 66), 124F9(V H SEQ ID NO: 53; VL SEQ ID NO: 65), 137D4(V H SEQ ID NO: 52; V L SEQ ID NO: 64), and 149F8 (V H SEQ ID NO: 51; V L An anti-properdin clone derived from four hybridomas, designated SEQ ID NO: 63, was found to be the best performing clone from the entire panel.
[0144] All four of these clones were found to exhibit excellent affinity for human properdin in the nM range (Table 6). The anti-properdin hybridoma mAbs 103B2, 124F9, 137D4, and 149F8, as well as other anti-properdin binders from the phage display library, were further humanized and are described in Example 6.
[0145] [Table 6]
[0146] ScFv library generation by phage display
[0147] To generate the ScFv library, the immunization protocol described in Example 1 was followed. The spleen was collected from one mouse euthanized 15 days after the fourth boost and transferred directly into 10 mL of normal saline in a 50 mL polypropylene tube. The spleen was then weighed into a 1.6 mL centrifuge tube treated with diethyl pyrocarbonate (DEPC). Total RNA was isolated using the Trizol method as follows: While maintaining a temperature of 4°C, the spleen was first minced in a Petri dish with a scalpel until a uniform suspension of splenocytes was formed. Two mL of Trizol was added to 90–130 mg of spleen, followed by mixing by pipetting and vortexing. The mincing process was repeated until a homogenous mixture of splenocytes and Trizol was formed. Chloroform (200 μL) was then added to the homogenate, mixed, and incubated at room temperature for 5 minutes. The homogenate was then centrifuged, the supernatant was collected, and an equal volume of isopropyl alcohol was added to precipitate the RNA. The RNA suspension was centrifuged again, and the pellet was washed with ice-cold 70% ethanol. After three washes, the pellet containing the total RNA was resuspended in DEPC-treated water and left to dissolve overnight at 4°C.
[0148] mRNA was then isolated from the total RNA according to the manufacturer's instructions (PolyATtract® mRNA Isolation Systems, Cat: Z5300, Promega). The isolated mRNA was used to prepare cDNA using the SuperScript™ III First-Strand Synthesis System (Cat: 18080051, Invitrogen) according to the manufacturer's instructions.
[0149] V H and V L Amplification of heavy and light chain variable regions was performed using PCR from cDNA using a primer set (Mouse IgG Library Primer Set, Catalog Number: F2010, Progen) according to the manufacturer's instructions. H and V LThe fragments were analyzed on an agarose gel and purified from the gel using a QIAquick Gel Extraction Kit (Qiagen Cat. No. 28706).
[0150] Next, purified V H and V L were cloned sequentially into a phagemid vector (pSEX81, Cat. No. PR3005, Progen). H Both the fragment and the vector were digested with NcoI and HindIII, gel purified, and ligated together. The ligation product was transformed into electrocompetent TG1 cells (Cat. No. 60502-1, Lucigen). L Fragment and V H The vector DNA containing the fragments was again digested with the restriction enzymes MluI and NotI, purified, and ligated together. H Fragment and V L Electrocompetent cells were transformed with a vector containing both fragments. The transformed cells were plated on 2xYT agar plates containing ampicillin (100 μg / mL). The resulting library of transformants was scraped off the agar plates and stored in 50% glycol at -80°C until further use.
[0151] Example 3: Production of scFv phages from an scFv library and their purification
[0152] Incubate cells from the glycerol stocks of the above libraries in flasks containing 2xYT medium containing carbenicillin or ampicillin (100 μL / mL) at an initial concentration of 0.06 OD 600 The culture was incubated at 37°C with shaking at 250 rpm until OD 600The cultures were grown until their chromatin density reached approximately 0.4–0.6. Next, helper phage VCSM13 (Agilent, catalog no. 200251) or M13KO7 (GE Healthcare, catalog no. 27152401) was added to the cultures at a multiplicity of infection (MOI) of 20 and incubated at 37°C for 40 minutes without shaking, followed by another 40 minutes at 37°C with shaking. Kanamycin was then added to the medium, and the cultures were grown overnight at 26°C and 150 rpm. The overnight phage cultures were centrifuged at 4000 g, and the cell pellet was discarded. A PEG (20%) / NaCl (2.5 M) solution (1:5 ratio) was added to the supernatant to precipitate the phage. The resuspended solution was incubated on ice for 20 minutes, followed by centrifugation at 14,000 g for 15 minutes at 4°C. The supernatant was discarded and the pellet was resuspended in 1 mL of sterile PBS containing 0.01% sodium azide. The phage were stored at 4°C until further use.
[0153] Example 4: Biopanning of phage expressing anti-properdin scFv
[0154] The scFv library (1 × 10) prepared in Example 3 12 pfu) were screened for anti-properdin binders. The first round of panning against properdin antigen was performed using antigen-immobilized Immunotubes (Quidel, USA) prepared by overnight incubation at 4°C with 5 μg / mL of properdin solution in carbonate buffer (0.1 M, pH 9.6). The Immunotubes were washed three times with PBS and then incubated with phage in PBS at 25°C for 2 hours with constant rotation. The Immunotubes were washed 10 times with 4 mL of PBS containing Tween 20 (0.1%), followed by 10 washes with PBS. Bound phage were eluted with glycine-HCl pH 2.1 (0.1 M). The eluted phage were rescued by infecting TG1 E. coli cells, plated, and phage were generated as described in Example 3.
[0155] First round of panning (1 x 10 11 CFU) and the second (1 × 10 10 Second and third rounds of panning were performed on Immunotubes coated with properdin antigen, with the output phage from the first (CFU) round of panning used as input phage for the second and third rounds of panning, respectively. Phage after the third round of panning were infected into TG1 cells as described above, and phagemid DNA was isolated for cloning of scFvs into appropriate expression vectors.
[0156] Example 5: Screening of individual scFv clones as soluble antibody fragment proteins
[0157] The scFv genes from the enriched library generated after three rounds of panning were cloned into the expression vector pOPE101 (Progen, Germany) so that individual scFv clones were generated as HIS-tagged fusion products. Both the vector DNA (pOPE101) and the phagemid DNA were digested with restriction enzymes (NcoI and NotI) to isolate the vector and scFv gene, respectively. The digested vector and scFv gene were ligated and transformed into TG1 electrocompetent cells. The transformed cells were plated on 2xYT agar plates containing carbenicillin antibiotic. Individual clones were picked from the 2xYT agar plates and cultured overnight at 32°C at 200 rpm in 15 mL tubes with 5 mL of 2xYT medium containing carbenicillin or ampicillin (100 μL / mL). The next day, the culture was reinoculated into fresh 2xYT medium containing carbenicillin (100 μg / mL) and glucose (0.1%) at a volume ratio of 1:200. The culture was incubated at OD 600The culture was grown until its RI reached approximately 0.6-0.8. 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG) was then added to the culture and grown overnight at 30°C and 200 rpm. The overnight culture was spun at 10,800 g for 15 minutes, and the supernatant was removed. The cell pellet was resuspended in a buffer containing 1 / 20 the volume of the original culture (30 mM Tris-Cl, pH 7.0, 20% sucrose, and 1 mM EDTA) and incubated on ice for 30 minutes. The resuspended pellet was centrifuged at 10,800 g for 15 minutes, and the supernatant was collected as the periplasmic fraction containing the soluble His-tagged scFv. This periplasmic fraction was used in an immunoassay to study properdin binding.
[0158] Properdin antigen was coated onto polystyrene plates overnight at 4°C (100 ng / 100 μL / well). After washing the plates twice, periplasmic fraction (1 / 10 v / v) was added and incubated for 1 hour at 25°C. After washing the plates four times with PBST, 100 μL (1:5000 v / v) of mouse anti-HIS antibody (GE Healthcare, catalog no. 27471001) was added for 1 hour. The plates were washed again as above, and HRP-conjugated goat anti-mouse antibody (Santa Cruz Biotech, catalog no. SC-2031) was added (1:5000) and incubated for an additional hour at 25°C. At the end of this incubation, the plates were washed four times before the addition of the substrate 3,3',5,5'-tetramethylbenzidine (TMB). Absorbance at 450 nm was measured 5 minutes after color development using a TECAN INFINITE® M1000pro. Individual clones were considered positive if the OD signal was at least 3-fold greater than background (blank wells) (i.e., a signal-to-background ratio of 3 or greater).
[0159] Example 6: Humanization of murine anti-properdin monoclonal antibodies derived from hybridoma and phage display libraries
[0160] The mouse binder was humanized by CDR grafting, replacing the framework regions (FR1-4) from the mouse antibody with the FR regions of a human antibody. Prior to grafting, the FRs from the human antibody were identified based on having the mouse protein sequence closest to the human germline antibody. In the present invention, the V of the mouse binder was H and V L (SEQ ID NOS: 49 and 62) were humanized and then recombined with the IgG4 constant region to obtain a full-length humanized antibody. A few amino acid residues within the FR were then mutated back to the original amino acids present in the mouse sequence to regain its functional activity (SEQ ID NOS: 55 and 56). (15, 16)
[0161] Similarly, V of other mouse antibodies H (SEQ ID NOs: 50, 51, 52, 53, and 54) and V L (SEQ ID NOs: 63, 64, 65, and 66) were humanized by CDR grafting using their best matching human FR templates in the human germline database, and the humanized V H (SEQ ID NOs: 44, 45, 46, 47, and 48) and V L (SEQ ID NOs: 57, 58, 60, and 61) were obtained.
[0162] Example 7: Construction of the double assembly pZRCIII hyg anti-properdin IgG4 vector
[0163] Chemically synthesized genes (including three kappa light chain genes [P13 (SEQ ID NO: 84); P14 LC (SEQ ID NO: 85); P15 LC (SEQ ID NO: 86)]; and one lambda light chain gene [E12 LC (SEQ ID NO: 87)] with XhoI and KpnI overhangs) and five variable regions of the heavy chain with SalI and ApaI overhangs [P12HC (SEQ ID NO: 88), P13HC (SEQ ID NO: 89), P14HC (SEQ ID NO: 90), P15HC (SEQ ID NO: 91), and E12HC (SEQ ID NO: 92)] cloned into pMA / pMK vectors were obtained from Geneart, Germany.
[0164] After digestion with XhoI and KpnI, all four light chain genes (SEQ ID NOs: 84, 85, 86, and 87) were isolated from these constructs. The pZRCIIIHyg-IgG4 cloning vector was digested with XhoI and KpnI, and the linearized vector was individually ligated to the digested LC genes. The pZRCIII vector, carrying the IgG4 constant region, was prepared as described in patent document WO 2012 / 046255A2. The ligation products were transformed into E. coli Top10F', and the transformants were scored based on antibiotic resistance. Clones were analyzed by restriction digestion and DNA sequencing by the Sanger method. These intermediate vectors containing the light chain genes in transcription assembly 1 were designated pZRCIIIHygP13LC, pZRCIIIHygP14LC, pZRCIIIHygP15LC, and pZRCIIIHygE12LC.
[0165] Plasmid DNA prepared from the intermediate LC vectors pZRCIII Hyg P13LC, pZRCIII Hyg P14LC, pZRCIII Hyg P15LC, and pZRCIII Hyg E12LC was digested with SalI and ApaI to allow for cloning of the heavy chain variable region in frame with the IgG4 constant region (SEQ ID NO:93) already present in the vector. Heavy chain variable region containing pMA / pMK plasmid DNA obtained from Geneart was digested with SalI and ApaI. These digested heavy chain variable regions were ligated with SalI- and ApaI-digested intermediate vectors in the following combinations: The ligation products were transformed into E. coli Top10F' and transformants were scored for kanamycin resistance. Clones were confirmed by restriction digestion and Sanger sequencing and transformed into pZRCIII Hyg P13LC-P12HC(V H and V L the corresponding amino acid sequences of pZRCIII Hyg P13LC-P13HC (V H and V L corresponding amino acid sequences of SEQ ID NOs: 46 and 57, respectively; referred to herein as P13), pZRCIII Hyg P14LC-P14HC (V H and V L corresponding amino acid sequences of SEQ ID NOs: 47 and 60, respectively; referred to herein as P14), pZRCIII Hyg P15LC-P15HC (V H and V L The corresponding amino acid sequences of pZRCIII Hyg E12LC-E12HC (V H and V L The corresponding amino acid sequences of the two proteins were designated as SEQ ID NOs: 44 and 56, respectively; herein referred to as P11.
[0166] Example 8: Preparation of dual vectors with IgG4 (GLS) modified constant regions
[0167] It was predicted that ADCC or CDC effector functions were not required for anti-properdin mAbs. To minimize these effector functions, three mutations, namely, P329G, M428L, and N434S, were incorporated into the anti-properdin mAb constructs prepared in the above examples. The mAb candidates contained all three of the above mutations incorporated into the IgG4 constant region and were designated IgG4(GLS). The constant region of the pZRCIII hyg P15LC-P15HC vector construct described in the above examples was replaced with IgG4(GLS) (SEQ ID NO: 94). To prepare the IgG4(GLS) constant region fragment (SEQ ID NO: 96), three mutations, namely, P329G, M428L, and N434S, were incorporated into the IgG4 constant region by mutagenic PCR. This purified PCR fragment (SEQ ID NO: 94), approximately 976 base pairs long with an ApaI overhang at the 5' end and a NotI overhang at the 3' end, and pZRCIII Hyg P15 LC-P15HC were digested with the restriction enzymes ApaI and NotI. Digestion of the vector with ApaI and NotI released a larger fragment of approximately 12,174 bp containing the approximately 976 bp IgG4 constant region and the remainder of the vector elements. The approximately 12,174 bp fragment was gel extracted and purified. Similarly, the digested PCR product was purified and ligated with the purified vector fragment. The ligation product was transformed into E. coli Top10F'. Transformants were scored for kanamycin resistance. The ligation product was transformed into E. coli Top10F'. Transformants were scored for kanamycin resistance. Clones were confirmed by restriction digestion and Sanger screening and cloned into pZRCIII Hyg P15LC-P15HC(IgG4GLS)[V H and V L the corresponding amino acid sequence of the Fc region: SEQ ID NO: 96; and referred to herein as P15(GLS)].
[0168] Example 9: Generation of CHO-S cell lines expressing humanized anti-properdin antibodies (IgG4 vector)
[0169] This example describes the generation of a transfected pool expressing a full-length humanized anti-properdin antibody. The following vector constructs were used for transfection:
[0170] IgG4 mammalian vector constructs
[0171] The plasmids were: pZRCIII Hyg P13LC-P12HC, pZRCIII Hyg P13LC-P13HC, pZRCIII Hyg P14LC-P14HC, pZRCIII Hyg P15LC-P15HC, pZRCIII Hyg E12LC-E12HC, and pZRCIII Hyg P15LC-P15HC (IgG4 GLS). The plasmids were linearized with AscI restriction enzyme before transfection. Chinese hamster ovary is a suitable host for expressing monoclonal antibodies. Suspension CHO-S cells (Invitrogen) were used as hosts for transfection. Cells (0.5 million cells / mL) were seeded approximately 24 hours before transfection to obtain exponential-phase cells. Transfection was performed by electroporation using the Neon Transfection System (Invitrogen) according to the manufacturer's instructions. After transfection, cells were seeded into 24-well cell culture plates containing 1 mL of prewarmed ProCHO5 serum-free medium (Lonza, Switzerland). Cells were incubated at 37°C in a humidified incubator with 5% CO2. These transfected pools were selected in 24-well culture plates in ProCHO5 medium in the presence of 600 μg / mL hygromycin (Invitrogen). During the selection process, cell numbers in all pools were monitored regularly, and the medium was replaced periodically. Once selection was complete, cells were further expanded in culture plates, T-flasks, and culture tubes (TPP).
[0172] For recombinant protein production of all anti-properdin antibody candidates, fed-batch cultures were performed for all selected pools in shake flasks (Corning). Cells were cultured at 0.3 × 10 in Power CHO-2 CD production medium (Lonza). 6 The cells were seeded at a density of 100 cells / mL. The flasks were incubated in a humidified Kuhner shaker at 37°C, 5% CO2, and a shaking rate of 110 RPM. During culture, a fixed daily feeding schedule was followed for all pools, utilizing a chemically defined feed from Hyclone, GE. Feeding began after 72 hours of culture and continued until the batch was harvested.
[0173] Culture supernatants were collected and antibodies were purified by Protein A affinity chromatography. These purified antibody candidates were further investigated in vitro.
[0174] Example 10: Determination of the rate constant for binding of anti-properdin candidates to properdin using surface plasmon resonance
[0175] The binding rate constants of anti-properdin candidates to native human purified properdin (Quidel; Catalog No. A412) were determined by surface plasmon resonance-based measurements using a ProteOn XPR36 (Bio-Rad). All binding measurements were performed in PBS (pH 7.4, 0.005% Surfactant P20) at 25°C. To measure the binding rate constant of properdin to mAb, human properdin was immobilized on the surface of a GLC sensor chip using amine coupling chemistry. Five dilutions of the affinity-purified mAb were prepared and injected into the flow cell at a flow rate of 100 μL / min. Data in the form of sensograms were analyzed using a data fitting program built into the ProteOn system. D The binding affinities, expressed as values, are shown in Table 7 for the antibodies tested.
[0176] [Table 7]
[0177] Example 11: Determination of the rate constant of anti-properdin antibodies to recombinant human fetal Fc receptor (rhFcRn)
[0178] The rate constants for antibody binding to recombinant human fetal Fc receptor (rhFcRn) were determined by surface plasmon resonance-based measurements using ProteOn XPR36 (Bio-Rad). Recombinant rhFcRn receptor (Sino Biologics) was immobilized on the surface of a GLC chip according to the manufacturer's instructions. The association rate constant (k a ) and the dissociation rate constant (k d To measure the K , five dilutions of affinity-purified antibody were prepared and injected at a flow rate of 100 μL / min with an association time of 180 seconds and a dissociation time of 600 seconds. Reactions were carried out in PBS (pH 6.0, 0.005% Surfactant P20) at 25°C. After each sample run, the chip surface was regenerated with PBS, pH 7.4. Data in the form of sensograms were analyzed using a data fitting program within the ProteOn system. The rate constants for rhFcRn binding to the P15 and P15(GLS) antibodies are shown in Table 8. P15(GLS) has a greater affinity (K ) for rhFcRn. D ) was observed.
[0179] [Table 8]
[0180] Example 12: Measurement of binding of mouse anti-properdin mAb to native human properdin by ELISA
[0181] Wells of an F16 Maxisorp Immunomodule (Nunc) 96 microplate were coated overnight in a humidified chamber at 4°C with 100 μL of purified human P factor (Quidel) at 250 ng / mL. After quickly flicking the plate to remove the coating solution, 300 μL of blocking solution containing 5% nonfat dry milk in PBST (PBS containing 0.05% Tween 20) was added to each well for 1 hour to block nonspecific sites. After 1 hour, the wells were washed with wash buffer (PBST containing 0.5% nonfat dry milk). Fifty microliters of culture supernatant was collected from each fusion well and diluted with ELISA assay diluent (PBS containing 0.5% nonfat dry milk). After 1 hour of incubation, the wells were washed with wash buffer. Bound mouse antibodies were then detected by reacting with horseradish peroxidase (HRP)-conjugated goat anti-mouse IgG (Santa Cruz Biotechnology, Inc.) diluted 1:5000 in assay diluent. After washing four times with PBST, peroxidase substrate solution containing 0.1% 3,3,5,5 tetramethylbenzidine (Sigma) and 0.0003% hydrogen peroxide (Sigma) was added to the wells for 30 minutes to develop the color. The reaction was stopped by adding 100 μL of 1 M H2SO4. The OD at 450 nm of the reaction mixture was read using an ELISA reader (Tecan Lifesciences).
[0182] Example 13: Measurement of binding of humanized anti-properdin mAb to native human properdin by ELISA
[0183] After humanization, antibody genes were synthesized, transfected, expressed, and purified as previously described in Examples 7 and 9. The purified antibody protein candidates, i.e., P13, P14, and P15, were examined for binding specificity to the human properdin antigen. Briefly, to examine the binding of anti-properdin antibodies to native human properdin, plates were coated with human properdin antigen (Quidel catalog no. A412) at a concentration of 50 ng / 50 μL / well in carbonate buffer (0.1 M, pH 9.6). After overnight incubation at 4°C, the plates were washed and blocked with 5% nonfat dry milk (1× PBS, pH 7.4). After washing the blocked plates with 1× PBS, purified mAbs were added to the antigen-coated wells (0.5-1 μg / 100 μL / well) and incubated at 37°C for 1 hour under shaking. The plate was washed three times with PBST (1x PBS containing 0.1% Tween 20, pH 7.4). Horseradish peroxidase (HRP)-conjugated goat anti-human IgG (SantaCruz, catalog no. sc2453) was added to each well at a dilution of 1:10,000 (100 μL / well) and then incubated at 37°C for 1 hour with shaking. The plate was washed with PBST (1x PBS containing 0.1% Tween 20, pH 7.4) and then twice with 1x PBS. o-Phenylenediamine dihydrochloride (OPD) / H2O2 (100 μL / well) was then added to the wells. After 15 minutes, the reaction was stopped with 100 μL of 1N H2SO4, and the plate was read at 450 nm. Clones were considered positive for properdin binding (Figure 1) if the signal-to-background ratio was greater than 3. Positive clones were examined for their affinity by SPR (surface plasmon resonance) and functional activity was compared in a hemolytic assay.
[0184] Example 14: Antihemolytic assay of narrowed down properdin antibody candidates to determine functional activity of individual mAbs
[0185] The ability of anti-properdin antibody candidates to inhibit the alternative complement pathway was examined using a rabbit erythrocyte lysis assay (in which the classical complement pathway was blocked with EGTA, and lysis of rabbit RBCs occurred exclusively via the alternative pathway in NHS, which involves the formation of MAC on the surface of rabbit RBCs (17)). Desired anti-properdin antibody candidates are expected to inhibit this alternative pathway to varying degrees depending on their affinity for properdin and its binding site. Therefore, anti-properdin antibody candidates developed according to the present invention are expected to prevent lysis of rabbit RBCs in the presence of human serum. The percent inhibition of hemolysis at a given antibody dilution / concentration for a given monoclonal antibody was calculated for each antibody and every dilution tested and compared between individual candidates.
[0186] Fresh rabbit RBCs were collected in Alsever's solution and washed five times with assay buffer (150 mM NaCl, 20 mM HEPES, 25 mM MgCl2, and 20 mM EGTA). The washed RBCs were resuspended in assay buffer at the required concentration. Each anti-properdin antibody sample (humanized anti-properdin antibodies - NBE003-3, P11, P13, P14, and P15, and mouse anti-properdin antibodies - 124F9, 149F8, and 103B20) was incubated with human serum (25%) at different concentrations for 30 minutes at 37°C. These were then added to a fixed number of rabbit red blood cells and incubated for an additional 50 minutes at 37°C. The treated cells were then centrifuged, and the released hemoglobin in the supernatant was measured by measuring the absorbance at 405 / 595 wavelengths. The percentage reduction in released hemoglobin in the presence of the anti-properdin antibody of the present invention or a negative antibody control (IgG2) was calculated relative to the hemolysis obtained by incubating rabbit RBCs with human serum without any test antibody. This lysis was considered 100%. As shown in Figure 2a (for the humanized anti-properdin monoclonal antibody) and Figure 2b (for the mouse anti-properdin monoclonal antibody), all of the anti-properdin mAbs tested inhibited human serum-mediated hemolysis of rabbit RBCs in a dose-dependent manner. These results indicate that the anti-properdin monoclonal antibody of the present invention can significantly inhibit the alternative complement pathway.
[0187] Example 15: Cross-reactive hemolytic assay of selected anti-properdin candidates against monkey sera
[0188] The ability of anti-properdin antibody candidates to cross-react with monkey properdin by blocking complement activity in monkey serum was examined in a rabbit RBC lysis assay. The functional assay was performed essentially as described in Example 14, using monkey serum instead of NHS. Anti-properdin mAbs of the present invention capable of cross-reacting with monkey properdin are expected to inhibit rabbit RBC lysis by preventing MAC formation mediated by the alternative complement pathway.
[0189] Fresh rabbit RBCs were collected in Alsever's solution and washed five times with assay buffer (150 mM NaCl, 20 mM HEPES, 25 mM MgCl2, and 20 mM EGTA). The washed RBCs were resuspended in assay buffer at the required concentration. Different concentrations of anti-properdin antibody mAbs (NBE003-3, P14, and P15) were incubated with monkey serum (25%) at 37°C for 30 minutes. These were then added to a fixed number of rabbit red blood cells and incubated at 37°C for an additional 50 minutes. The treated cells were then centrifuged, and the released hemoglobin was measured in the supernatant by measuring the absorbance at 405 / 595 wavelengths. The percentage reduction in released hemoglobin in the presence of the anti-properdin antibodies of the present invention was calculated relative to the red blood cell lysis observed in the presence of monkey serum without any antibody. This lysis was considered 100%. As shown in Figure 3a, the anti-properdin antibody of the present invention prevented hemolysis of rabbit RBCs in the presence of monkey serum.
[0190] The ability of the anti-properdin antibody candidate P15(GLS) to block complement activity in six different monkey sera was also examined. Functional assays were performed as described above using rabbit RBCs and sera from six different monkeys. Lysis inhibition was performed using P15(GLS) at concentrations ranging from 10 to 0.17 μg / ml. As shown in Figure 3b, the anti-properdin antibody P15(GLS) of the present invention blocks hemolysis of rabbit RBCs in the presence of monkey sera. These results confirmed the cross-reactivity of the monoclonal antibody with monkey properdin in monkey sera. The antibodies of the present invention can also be used directly in animal pharmacology and toxicology studies required during drug development, eliminating the need for surrogate antibodies.
[0191] Example 16: LPS AP assay on selected candidates to determine the function of anti-properdin antibodies
[0192] The alternative complement pathway in serum can be activated by lipopolysaccharide (LPS) from Salmonella typhi (18). Purified LPS can be used to induce alternative complement pathway-mediated MAC formation on the surface of ELISA plates (19, 20). The ability of the anti-properdin antibody of the present invention to inhibit such MAC formation was examined using this assay system.
[0193] Microtiter plates (Nunc) were coated with lipopolysaccharide (LPS) from Salmonella typhi (Sigma, catalog no. L6386) in PBS at 2 μg / 50 μL / well. Plates were then incubated overnight at 4°C. After washing, plates were washed twice with 1x PBS and blocked with 1% BSA (300 μL / well) at 37°C for 1 hour. Meanwhile, NHS (12.5% in 20 mM HEPES buffer containing 150 mM NaCl, 20 mM MgCl2, and 6.25 mM EGTA) was preincubated with either anti-properdin mAb (P14, P15, or P15(GLS)) or an isotype control antibody for 1 hour at 37°C under shaking conditions. This preincubated mixture of serum and antibody was then transferred to the washed LPS-coated plate and incubated for 1 hour to allow for activation of the alternative complement pathway and MAC formation. The plate was washed three times with 1x PBS, and mouse anti-human MAC antibody was added at a dilution ratio (volume) of 1:5000 and incubated for 60 minutes at 37°C. The plate was washed three times again with 1x PBS, and 100 μL (1:10000 v / v) of HRP-conjugated anti-mouse IgG (Santa Cruz, catalog number sc-58935) was added to each well and incubated for 60 minutes at 37°C. The plate was finally washed six times with 1x PBS, and the ELISA color was developed for 15 minutes after the addition of TMB / H2O2. The reaction was stopped with 100 μL / well of 1N H2SO4, and the OD was measured at 450 nm.
[0194] This assay (Figure 4) demonstrated that the anti-properdin mAbs of the present invention (P14, P15, and P15(GLS)) inhibited components of the LPS-mediated complement pathway in NHS that remained functional in the presence of EGTA; this was observed in a dose-dependent manner.
[0195] Example 17: Human RBC lysis inhibition assay using anti-CD55 and anti-CD59
[0196] In normal, healthy individuals, serum does not induce RBC lysis. This is possible despite the constitutively active nature of the alternative complement pathway because of the presence of natural complement inhibitors both in serum (e.g., factor H) and on the surface of cells in contact with plasma (e.g., CD55 and CD59). The absence of these inhibitors is known to cause serious pathologies (e.g., PNH and aHUS).
[0197] A hemolytic assay using RBCs and serum obtained from normal, healthy individuals was set up similar to that described above for the rabbit RBC lysis assay, except that modulation of the complement pathway was inhibited by the addition of anti-CD55 and anti-CD59 antibodies. In the presence of these inhibitors, serum from otherwise normal, healthy volunteers was able to lyse its own RBCs in vitro, as inhibition and activation of the complement pathway was ablated.
[0198] Studies demonstrating a similar mechanism of complement regulation have been reported (21), which were followed with minor modifications for the experiments described here. Briefly, normal human RBCs (25 million cells per reaction) were incubated with Mg 2+The RBCs were added to a solution (final volume 100 μL) consisting of gelatin veronal buffer (GVB++) (Sigma-Aldrich) supplemented with (25 mM)-EGTA (20 mM) and anti-human CD55 (clone BRIC216) and anti-human CD59 (clone MEM-43) antibodies (final concentration: 10 μg / mL; AbD Serotec, as shown in Figure 5 ) and incubated for 1 hour at room temperature. NHS (75 μL) was added to the RBCs along with a control mAb or the anti-properdin antibody of the present invention (both 5 μg / mL) to a final reaction volume of 200 μL and incubated for 4 hours at 37°C. The reaction mixture was centrifuged (1500 rpm for 5 minutes) to pellet unlysed red blood cells. The extent of RBC lysis was measured by the OD at 405 / 595 nm of an aliquot of the collected supernatant. The lysis inhibition rate was calculated by normalizing the OD value to that of lysed red blood cells (pre-incubated with anti-CD55 and anti-CD59 antibodies) in the presence of NHS. This lysis without any anti-properdin or control antibody was considered as 100% lysis. The humanized antibodies of the present invention (P14, P15, and P15(GLS)) were able to significantly inhibit the lysis of human RBCs under PNH-like conditions, as shown in Figure 5.
[0199] Example 18: Lysis inhibition assay of human RBCs treated with pronase
[0200] Natural regulation of complement by regulatory factors expressed on the cell surface of normal cells can also be abolished by treating the cells with proteases such as pronase (22). Previously, proteases were used to convert normal human RBCs into complement-sensitive PNH-like cells. Hemolysis assays were performed using pronase-treated normal human RBCs as previously described. Pronase treatment activates the alternative complement pathway, resulting in lysis of normal human RBCs and their own serum.
[0201] Normal human red blood cells (25 million cells per reaction) were 2+The RBCs were added to a solution (final volume 100 μL) consisting of gelatin veronal buffer (GVB++) (Sigma-Aldrich) supplemented with (25 mM)-EGTA (20 mM). These RBCs were treated with pronase enzyme (5 mg / mL) for 30 min at 37°C. NHS (50 μL), pre-incubated for 30 min with or without anti-properdin antibody at different concentrations (5, 2.5, and 1.25), was added to the pronase-treated RBCs to a final reaction volume of 200 μL and incubated for 4 h at 37°C. The reaction mixture was centrifuged (1500 rpm) for 5 min to pellet unlysed RBCs. The extent of RBC lysis was measured by measuring the OD at 405 / 595 nm of an aliquot of the collected supernatant. The percent lysis inhibition was calculated by normalizing the OD value to that of RBCs lysed in the presence of NHS (treated with pronase). This lysis without any anti-properdin or control antibody was considered 100% lysis. The anti-properdin mAbs of the present invention (P14, P15, and P15(GLS)) were able to inhibit complement-mediated lysis of pronase-treated human RBCs in the presence of NHS, as shown in Figure 6.
[0202] Example 19: Determining the efficacy of anti-properdin in a mouse model of LPS-induced lung injury
[0203] Intratracheal LPS instillation is known to induce lung injury and is associated with an increase in cytokines in bronchoalveolar lavage (BAL) fluid. A reduction in cytokines due to the administration of any therapeutic treatment is considered effective. Balb / c mice were weighed and randomized for the experiment. The mice were randomly divided into four groups. One group served as a sham control to assess any increase in cytokine levels due to the intratracheal instillation procedure. Another group received anti-properdin surrogate (rabbit anti-mouse properdin) serum intravenously at a concentration of 400 μg per 20 g mouse. The rabbit anti-mouse properdin antibody used herein is referred to as ZAP surrogate. For the vehicle control (disease control), placebo alone was administered intravenously at a volume similar to that of the anti-properdin surrogate serum. One group of animals without any disease induction was also examined to determine any changes in basal cytokine levels. After administration of surrogate anti-properdin serum or placebo, LPS (Sigma) was instilled intratracheally into each mouse. Six hours after LPS instillation, the mice were humanely euthanized, and BAL lavage fluid was collected from each mouse. TNF-α and IL-6 levels were assessed using ELISA. Anti-properdin mAb (ZAP surrogate) was able to reduce inflammatory cytokines in the bronchoalveolar lavage (BAL) fluid, as shown in Figures 7 and 8. These results indicate that anti-properdin treatment is effective in treating lung injury. For both TNF-α (Product No. 555268) and IL-6 (Product No. 555240), kits manufactured by BD Biosciences were used. The procedures described in the kit instructions were followed. Absorbance was read at 450 nm and corrected for absorbance at 570 nm.
[0204] List of nucleotide and amino acid sequences used in the present invention
[0205] SEQ ID NO: 84: P13 light chain ATGGGCTGGTCCTGCATCATTCTGTTTCTGGTGGCTACCGCCACCGGCGTGCACTCTGATATCGTGATGACCCAGTCTCCTGACAGCCTGGCTGTGTCTCTGGGCGAGAGAGCCACCATCAACTGCAAGTCCTCTCAGTCCCTGCTGTACTCCTCCAACCAGAAGAACTACCTGGCCTGGTATCAGCAGAAGCCCGGACAGCCTCCTAAGCTGCTGATCTACTGGGCCTCCACCAGAGAATCTGGCGTGCCAGATAGATTCTCCGGCTCTGGCTCTGGCACCGACTTTACCCTGACAATCAGCTCTCTGCAGGCCGAGGATGTGGCCGTGTACTACTGCCAGCAGTACTACAGCTACCCCTACACCTTTGGCGGAGGCACCAAGCTGGAAATCAAGAGAACCGTGGCCGCTCCTTCCGTGTTCATCTTCCCACCATCTGACGAGCAGCTGAAGTCCGGCACAGCTTCTGTCGTGTGCCTGCTGAACAACTTCTACCCTCGGGAAGCCAAGGTGCAGTGGAAGGTGGACAATGCCCTGCAGTCCGGCAACTCCCAAGAGTCTGTGACCGAGCAGGACTCCAAGGACTCTACCTACAGCCTGTCCTCCACACTGACCCTGTCTAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGTGAAGTGACCCACCAGGGACTGTCTAGCCCCGTGACCAAGTCTTTCAACAGAGGCGAGTGCTAATGA
[0206] Sequence number 85: P14 light chain ATGGGCTGGTCCTGCATCATTCTGTTTCTGGTGGCTACCGCCACCGGCGTGCACTCTGATATCGTGATGACCCAGTCTCCTCTGAGCCTGTCTGTGACACCTGGCCAGCCTGCCTCCATCTCTTGCAAGTCATCTCAGTCCCTGCTGGACATCAACGGCAAGACCTACCTGAACTGGTATCTGCAGAAGCCCGGCCAGTCTCCACAGCTGCTGATCTACCTGGTGTCCAAGCTGGATTCTGGCGTGCCCGACAGATTTTCCGGCTCTGGCTCTGGCACCGACTTCACCCTGAAGATTTCCAGAGTGGAAGCCGAGGACGTGGGCGTGTACTACTGTTGGCAGGGCACCCACTTTCCATACACCTTCGGCCAGGGCACCAAGGTGGAAATCAAGAGAACCGTGGCCGCTCCTTCCGTGTTCATCTTCCCACCATCTGACGAGCAGCTGAAGTCCGGCACAGCTTCTGTCGTGTGCCTGCTGAACAACTTCTACCCTCGGGAAGCCAAGGTGCAGTGGAAGGTGGACAATGCCCTGCAGTCCGGCAACTCCCAAGAGTCTGTGACCGAGCAGGACTCCAAGGACTCTACCTACTCTCTGTCCTCCACACTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGTGAAGTGACCCACCAGGGACTGTCTAGCCCCGTGACCAAGTCTTTCAACAGAGGCGAGTGCTAATGA
[0207] Sequence number 86: P15 light chain ATGGGCTGGTCCTGCATCATTCTGTTTCTGGTGGCTACCGCCACCGGCGTGCACTCTGATATCCAGATGACCCAGTCTCCTTCCAGCCTGTCTGCCTCTGTGGGCGACAGAGTGACCATCACCTGTCTGGCTTCTCAGACCATCGGCACCTGGCTGGCCTGGTATCAGCAGAAGCCTGGAAAGGCCCCTAAGCTGCTGATCTACGCTGCCACATCTCTGGCCGATGGCGTGCCATCTAGATTCTCTGGCTCTGGCTCCGGCACCGACTTTACCCTGACAATCAGTTCCCTGCAGCCTGAGGACTTCGCCACCTACTACTGCCAGCAGCTGTACTCTACCCCTTGGACCTTTGGCGGAGGCACCAAGCTGGAAATCAAGAGAACCGTGGCCGCTCCTTCCGTGTTCATCTTCCCACCATCTGACGAGCAGCTGAAGTCTGGCACCGCTTCTGTCGTGTGCCTGCTGAACAACTTCTACCCTCGGGAAGCCAAGGTGCAGTGGAAGGTGGACAATGCCCTGCAGTCCGGCAACTCCCAAGAGTCTGTGACCGAGCAGGACTCCAAGGACTCTACCTACAGCCTGTCCTCCACACTGACCCTGTCTAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGTGAAGTGACCCACCAGGGACTGTCTAGCCCCGTGACCAAGTCTTTCAACAGAGGCGAGTGCTAATGA
[0208] Sequence number 87: E12 light chain ATGGGCTGGTCCTGCATCATTCTGTTTCTGGTGGCTACCGCCACCGGCGTGCACTCTCAGTCTGTTTTGACTCAGCCTCCTTCCGTGTCTGCCGCTCCTGGCCAGAAAGTGACCATCTCTTGCTCCGGCTCCTCCTCCAACATCGGCAACAACTATGTGTCTTGGTACGTGCAGCTGCCCGGCACAGCTCCTAAGCTGCTGATCTACGACAACAACAAGCGGTTCTCCGGCGTGCCCGACAGATTCTCTGGCTCTAAGTCTGGCACCAGCGCTACCCTGGGAATCACAGGATTGCAGACAGGCGACGAGGCCGATTACTACTGTGGCGCTTGGGACGGCTCTCTGAGGGAAGCTGTTTTTGGCGGAGGCACCAAAGTGACCGTGCTGAGAGCTGCTGGACAGCCTAAAGCCGCTCCTAGCGTGACCCTGTTTCCTCCATCTTCTGAGGAACTGCAGGCCAACAAGGCTACCCTCGTGTGCCTGATCTCTGACTTTTACCCTGGCGCTGTGACCGTGGCCTGGAAGGCTGATAGTTCTCCTGTGAAGGCCGGCGTGGAAACCACCACACCTTCCAAGCAGTCCAACAACAAATACGCCGCCTCCTCCTACCTGTCTCTGACCCCTGAACAGTGGAAGTCCCACCGGTCCTACTCTTGCCAAGTGACCCATGAGGGCTCCACCGTGGAAAAGACAGTGGCCCCTACCGAGTGCTCCTAATGA
[0209] Sequence number 88: P12 heavy chain variable region ATGGGCTGGTCCTGCATCATTCTGTTTCTGGTGGCTACCGCCACCGGCGTGCACTCTCAGGTTCAGTTGCAACAGTCTGGCCCTGAACTCGTCAGACCCGGCGTGTCCGTGAAGATCAGCTGTAAAGGCTCCGGCTACACCTTCACCGACTACGCCATGCACTGGGTCAAGCAGTCTCACGCCGAGTCTCTGGAATGGATCGGCCTGATCTCTACCTACTACGGCGACGCCGGCTACAACCAGAAGTTCAAGGATAAGGCCACAATGACCGTGGACATCTCCTCCTCCACCGCCTACCTGGAACTGGCTAGACTGACCTCTGAGGACTCCGCCATCTACTACTGCGCCAGAGCCGACTCCTCTGGCAACTTCTTTGATTACTGGGGCCAGGGCACCCTGGTCACCGTTTCTAGTGCTTCCACAAAGGGCCC[[ID=憨 1]]
[0210] Accession number 89: P13 heavy chain variable region ATGGGCTGGTCCTGCATCATTCTGTTTCTGGTGGCTACCGCCACCGGCGTGCACTCTGAAGTTCAGTTGCAGCAGTCTGGCCCCGAGCTTGTGAAACCTGGCGCCTCTGTGAAGATGTCCTGCAAGGCCTCTGGCTACACCTTCGCTCACAACTGGATTCACTGGGTCAAGCAGAAGCCAGGCCAGGGACTTGAGTGGATCGGCTACATCAACCCTGGCACCGACTACACCGAGTACTCCCAGAGATTCAAGGGCAAAGCTACCCTGACCTCCGACAAGTCCTCCTCCACCGCTTACATGGAACTGTCCAGCCTGACCTCTGAGGACTCCGCCGTGTACTACTGCGCCAGAAGAAAGCTGTACGGCAACTTCGTGGACTACGCCATGGATTATTGGGGCCAGGGCACCCTGGTTACCGTGTCTGCTGCTTCTACAAAGGGCCC
[0211] Accession number 90: P14 heavy chain variable region ATGGGCTGGTCCTGCATCATTCTGTTTCTGGTGGCTACCGCCACCGGCGTGCACTCTCAGGTTCAGTTGCAAGAGTCTGGCCCTGGCCTGGTCAAGCCTTCTCAGACCCTGTCTCTGACCTGCACCGTGTCCGGCTATTCCATCACCTCCGGCTACTACTGGAACTGGATCAGACAGCACCCCGGCAAAGGCCTGGAATGGATCGGCTACATCTCTTACGACGGCGGCAACAAGTACAACCCCAGCCTGAAGTCCAGAGTGACCATCTCTCGGGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGTCCTCTGTGACCGCTGCCGATACCGCCGTGTACTACTGTGCCCGCGATCTGGATGGCTACGAGTCTATGGATTATTGGGGCCAGGGCACCTCCGTGACCGTGTCCTCTGCTTCTACAAAGGGCCC
[0212] Sequence number 91: P15 heavy chain variable region ATGGGCTGGTCCTGCATCATTCTGTTTCTGGTGGCTACCGCCACCGGCGTGCACTCTCAGGTTCAGTTGCAAGAGTCTGGCCCTGGCCTGGTCAAGCCTTCTCAGACCCTGTCTCTGACCTGCACCGTGTCCGGCTACTCCATCACCTCCACCTACTACTGGAACTGGATCAGACAGCACCCCGGCAAAGGCCTGGAATGGATCGGCTACATCTCCTACGACGGCACCAACAAGTACAACCCCAGCCTGAAGTCCAGAGTGACCATCTCTCGGGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGTCCTCTGTGACCGCTGCCGATACCGCCGTGTACTACTGCGCCAGAGATGACTACGACAGATCCCCTTGGTTTGCCTATTGGGGCCAGGGCACACTGGTCACCGTTTCCAGTGCTTCTACCAAGGGCCC
[0213] Sequence number 92: E12 heavy chain variable region ATGGGCTGGTCCTGCATCATTCTGTTTCTGGTGGCTACCGCCACCGGCGTGCACTCTCAGGTTCAGTTGCAACAGTCTGGCCCTGAACTCGTCAGACCCGGCGTGTCCGTGAAGATCAGCTGTAAAGGCTCCGGCTACACCTTCACCGATTACGCCCTGCACTGGGTCAAGCAGTCTCACGCTGAGTCTCTGGAATGGATCGGCGTGATCTCCACCTACTACGGCGACGCCTCCTACAACCAGAAGTTCAAGGACAAGGCCACAATGACCGTGGACATCTCCTCCTCCACCGCCTACCTGGAACTGGCTAGACTGACCTCTGAGGACTCCGCCATCTACTACTGCGCCAGAGATGGCTACCTGGATTATTGGGGCCAGGGCACACTGGTCACCGTGTCCTCTGCTTCTACAAAGGGCCC
[0214] Sequence number 93: IgG4 heavy chain constant region GGGCCCCTCCGTGTTCCCTCTGGCCCCTTGCTCCCGGTCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTGGTGAAAGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACTCTGGCGCCCTGACCAGCGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCTCCGTGGTGACCGTGCCCTCCTCCAGCCTGGGCACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAGGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCCCCCTGCCCTGCCCCTGAATTTCTGGGCGGACCTTCCGTGTTCCTGTTCCCCCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCCGAAGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCAACTCCACCTACCGGGTGGTGTCTGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAGTACAAGTGCAAGGTGTCCAACAAGGGCCTGCCCTCCAGCATCGAAAAGACCATCTCCAAGGCCAAGGGCCAGCCCCGCGAGCCCCAGGTGTACACCCTGCCCCCTAGCCAGGAAGAGATGACCAAGAACCAGGTGTCCCTGACCTGTCTGGTGAAAGGCTTCTACCCCTCCGATATCGCCGTGGAATGGGAGTCCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTCTCGGCTGACCGTGGACAAGTCCCGGTGGCAGGAAGGCAACGTGTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGAGCCTGGGCAAGTGATGA
[0215] SEQ ID NO: 94: IgG4 (GLS) modified heavy chain constant region GGGCCCCTCCGTGTTCCCTCTGGCCCCTTGCTCCCGGTCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTGGTGAAAGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACTCTGGCGCCCTGACCAGCGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCTCCGTGGTGACCGTGCCCTCCTCCAGCCTGGGCACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAGGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCCCCCTGCCCTGCCCCTGAATTTCTGGGCGGACCTTCCGTGTTCCTGTTCCCCCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCCGAAGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCTAGAGAGGAACAGTTCAACAGCACCTACAGAGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAAGAGTACAAGTGCAAGGTGTCCAACAAGGGCCTGGGCTCCAGCATCGAAAAGACCATCTCCAAGGCTAAGGGCCAGCCTCGGGAACCTCAGGTTTACACCCTGCCTCCAAGCCAAGAGGAAATGACCAAGAATCAGGTGTCCCTGACCTGTCTCGTGAAGGGCTTCTACCCTTCTGATATCGCCGTGGAATGGGAGTCCAACGGCCAGCCTGAGAACAACTACAAGACCACACCTCCAGTGCTGGACTCCGACGGCTCTTTCTTCCTGTATTCCCGCCTGACCGTGGACAAGTCCAGATGGCAAGAGGGCAACGTGTTCTCCTGCAGCGTGCTGCATGAGGCTCTGCACTCCCACTACACCCAGAAGTCTCTGTCTCTGTCCCTGGGCAAGTGATAA
[0216] SEQ ID NO: 95 Protein sequence of P15 IgG4 constant region ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVE VHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
[0217] SEQ ID NO: 96 Protein sequence of P15 (GLS) constant region ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVE VHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLGSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVLHEALHSHYTQKSLSLSLGK
[0218] References incorporated into this application: 1. Harris CL, Pouw RB, Kavanagh D, Sun R, Ricklin D. Developments in anti-complement therapy; from disease to clinical trial. Mol Immunol. 2018; 102: 89-119. 2. Mastellos DC, Ricklin D, Lambris JD. Clinical promise of next-generation complement therapeutics. Nat Rev Drug Discov. 2019; 18: 707-29. 3. Please refer FDA approved product label of Eculizumab. 4. Zelek WM, Xie L, Morgan BP, Harris CL. Compendium of current complement therapeutics. Mol Immunol. 2019; 114: 341-52. 5. Ricklin D, Barratt-Due A, Mollnes TE. Complement in clinical medicine: Clinical trials, case reports and therapy monitoring. Mol Immunol. 2017; 89: 10-21. 6. Angal S, King DJ, Bodmer MW, Turner A, Lawson AD, Roberts G, Pedley B, Adair JR. A single amino acid substitution abolishes the heterogeneity of chimeric mouse / human (IgG4) antibody. Mol Immunol. 1993; 30(1): 105-8. 7. Jones PT, Dear PH, Foote J, Neuberger MS, Winter G. Replacing the complementarity-determining regions in a human antibody with those from a mouse. Nature. 1986; 321(6069): 522-5. 8. Riechmann L, Clark M, Waldmann H, Winter G. Reshaping human antibodies for therapy. Nature.1988; 332(6162): 323-7. 9. Verhoeyen M, Milstein C, Winter G. Reshaping human antibodies: grafting an antilysozyme activity. Science.1988; 239(4847): 1534-6. 10. Almagro JC, Fransson J. Humanization of antibodies. Front Biosci. 2008; 13: 1619-33. 11. Wang X, Mathieu M, Brezski RJ. IgG Fc engineering to modulate antibody effector functions. Protein Cell. 2018; 9(1): 63-73. 12. Schlothauer T, Herter S, Koller CF, Grau-Richards S, Steinhart V, Spick C, Kubbies M, Klein C, Umana P, Mossner E. Novel human IgG1 and IgG4 Fc-engineered antibodies with completely abolished immune effector functions. Protein Eng Des Sel. 2016; 29(10): 457-466. 13. Wood JN. Immunization and fusion protocols for hybridoma production. Methods Mol Biol. 1984; 1: 261-70. 14. Kim HY, Stojadinovic A, Izadjoo MJ. Immunization, hybridoma generation, and selection for monoclonal antibody production. Methods Mol Biol. 2014; 1131: 33-45. 15. Honegger A, Pluckthun A. Yet another numbering scheme for immunoglobulin variable domains: an automatic modeling and analysis tool. J Mol Biol. 2001; 309(3): 657-70. 16. www.vbase2.org 17. Polhill RB Jr, Pruitt KM, Johnston RB Jr. Kinetic assessment of alternative complement pathway activity in a hemolytic system. I. Experimental and mathematical analyses. J Immunol. 1978; 121(1): 363-70. 18. Douglas P. Fine. Activation of the Classic and Alternate Complement Pathways by Endotoxin. J Immunol.1974; 112(2); 763-9. 19. Clardy CW. Complement activation by whole endotoxin is blocked by a monoclonal antibody to factor B. Infect Immun.1994; 62(10): 4549-55. 20. Bansal R, Brunden K, Parent J. Process for inhibiting complement activation via the alternative pathway. US20020015701. 21. Gullipalli D, Zhang F, Sato S, Ueda Y, Kimura Y, Golla M, Miwa T, Wang J, Song WC. Antibody Inhibition of Properdin Prevents Complement-Mediated Intravascular and Extravascular Hemolysis. J Immunol. 2018; 201(3): 1021-29. 22. Yuan FF, Bryant JA, Fletcher A. Protease-modified erythrocytes: CD55 and CD59 deficient PNH-like cells. Immunol Cell Biol. 1995; 73(1): 66-72.
[0219] Incorporation by Reference
[0220] The entire disclosure of each patent document and journal article referred to herein is incorporated by reference for all purposes.
[0221] equivalent
[0222] The present invention may be embodied in other specific forms without departing from its scope or essential characteristics. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting of the invention described herein. The scope of the invention is, therefore, indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and range of equivalents of the claims are intended to be embraced therein.
Claims
1. (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 51 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 63; (b) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 52 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 64; (c) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 53 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 65; (d) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 54 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 66; (e) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 57; (f) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 47 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 60; (g) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 48 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 61; or (h) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 44 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 56; An anti-properdin antibody or antigen-binding portion thereof, comprising a heavy chain variable region and a light chain variable region selected from:
2. The antibody or antigen-binding portion thereof of claim 1 which binds to human properdin.
3. The antibody of claim 1 or 2, which is an IgG isotype.
4. The antibody of any one of claims 1 to 3, which has altered or reduced ADCC and / or CDC activity, or no ADCC and / or CDC activity.
5. The antibody according to any one of claims 1 to 4, which has ADCC and / or CDC activity.
6. The antibody of any one of claims 1 to 5, comprising a single amino acid substitution selected from S228P, P329G, M428L, N434S, and suitable combinations thereof.
7. The following characteristics: (a) cross-reacts with properdin from species other than human; (b) greater binding specificity for human properdin; (c) blocking increased binding of C3b to the surface of target cells; (d) blocking properdin's function in mediating alternative complement pathway activation; (e) inhibiting complement-mediated lysis of target cells; (f) inhibiting cell lysis by modulating the formation of MAC on the surface of target cells; (g) minimizing the formation of the anaphylatoxins C3a and C5a; and (h) Extending the half-life in a subject The antibody or antigen-binding portion thereof according to any one of claims 1 to 6, comprising at least one of:
8. The antibody or antigen-binding portion thereof of any one of claims 1 to 7, which is murine, chimeric, recombinant, or humanized.
9. A composition comprising the antibody or antigen-binding portion thereof according to any one of claims 1 to 8 and a pharmaceutically acceptable carrier.
10. An immunoconjugate comprising the antibody or antigen-binding portion thereof of any one of claims 1 to 8 linked to a therapeutic agent.
11. The immunoconjugate of claim 10, wherein the therapeutic agent is a cytotoxin or a radioisotope.
12. A bispecific molecule comprising the antibody or antigen-binding portion thereof according to any one of claims 1 to 8 linked to a second functional moiety having a binding specificity different from that of the antibody or antigen-binding portion thereof.
13. 13. The bispecific molecule of claim 12, wherein the second functional portion binds to an antigen selected from C3, C5, C5a, C5b, C3a, C3b, factor B, factor H, and C1q.
14. A nucleic acid encoding the antibody or antigen-binding portion thereof according to any one of claims 1 to 8.
15. An expression vector comprising the nucleic acid of claim 14.
16. A host cell comprising the expression vector of claim 15.
17. A combination comprising at least two or more antibodies or antigen-binding portions thereof, at least one of which is an antibody or antigen-binding portion thereof according to any one of claims 1 to 8.
18. The combination of claim 17, further comprising a second antibody or an antigen-binding portion thereof selected from an anti-C3 antibody, an anti-C5 antibody, an anti-C5a antibody, an anti-C5b antibody, an anti-C3a antibody, an anti-C3b antibody, an anti-factor B antibody, eculizumab, lampalizumab, ravulizumab, or an anti-properdin antibody.
19. 9. The antibody or antigen-binding portion thereof of any one of claims 1 to 8, for use in treating cancer, an infectious disease, or an autoimmune disorder, wherein the antibody or antigen-binding portion thereof is administered in combination with a chemically synthesized therapeutic agent or vaccine or chemotherapeutic agent.
20. 9. The antibody or antigen-binding portion thereof of any one of claims 1 to 8, for use in treating a disease, wherein the disease is mediated, directly or indirectly, by a component of the alternative complement pathway and / or by a factor produced after activation of the alternative complement pathway.
Citation Information
Patent Citations
Anti-properdin antibodies and their use
JP2014522845A