Methods for detecting cholera toxin

Monoclonal antibodies with specific CDR3 regions enable rapid and sensitive cholera toxin detection in immunochromatography, addressing the limitations of existing methods by providing high specificity and sensitivity.

JP7751834B2Active Publication Date: 2025-10-09NAT INST OF BIOMEDICAL INNOVATION HEALTH & NUTRITION +1
View PDF 6 Cites 0 Cited by

Patent Information

Application Number
JP2022005375
Authority / Receiving Office
JP · JP
Patent Type
Patents
Current Assignee / Owner
Filing Date
2022-01-17
Publication Date
2025-10-09
Estimated Expiration
2042-01-17

AI Technical Summary

Technical Problem

Existing methods for detecting cholera toxin are complex, time-consuming, and lack sufficient sensitivity, requiring specialized laboratories and equipment, and often fail to distinguish between cholera toxin and its homologue, Escherichia coli heat-labile enterotoxin.

Method used

Development of monoclonal antibodies with specific CDR3 regions that are used in immunochromatography for rapid and sensitive detection of cholera toxin, achieving high specificity and sensitivity with results in under an hour.

Benefits of technology

The method allows for easy, quick, and highly sensitive detection of cholera toxin with a sensitivity of up to 1 ng/mL, distinguishing it from Escherichia coli heat-labile enterotoxin at high concentrations, suitable for medical settings and food contamination sites.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 0007751834000001
    Figure 0007751834000001
  • Figure 0007751834000002
    Figure 0007751834000002
  • Figure 0007751834000003
    Figure 0007751834000003
Patent Text Reader

Abstract

To perform simple, quick and high-sensitive detection of a cholera toxin (CTx).SOLUTION: An antigen liquid is inoculated into BALB / c mice, the antigen liquid including cholera toxin B subunit gene recombinant protein (CTxB) and an adjuvant. After the inoculation, splenocytes or lymph node cells of the mice were fused with P3U1 to prepare hybridomas. Out of these hybridomas, hybridomas that produce monochlonal antibodies showing high reactivity to CTx were selected, and four hybridomas that produce antibodies showing excellent reactivity to CTx were acquired. Then, detection of CTx was performed based on immunochromatography, using these monochlonal antibodies, thereby, a result was acquired, in which CTx was detectable with high sensitivity.SELECTED DRAWING: Figure 1
Need to check novelty before this filing date? Find Prior Art

Description

[Technical Field]

[0001] The present invention relates to a method for detecting cholera toxin, an antibody used in the method, and a kit for use in the method. [Background technology]

[0002] Vibrio cholerae is a gram-negative bacillus of the genus Vibrio in the family Vibrionaceae. It is classified into many serotypes based on its surface antigen (O antigen), but only bacteria that exhibit either the O1 or O139 serotype and produce cholera toxin are considered to be cholera. Cholera is transmitted by oral ingestion of food or water contaminated with V. cholerae in the feces of patients or carriers. Serotype O1 cholera has caused seven global pandemics since 1817. Many of these outbreaks were imported infections among travelers from India, Southeast Asia, and other endemic countries. However, outbreaks have declined in areas with improved sanitation. The majority of reported cases in developed countries are still transmitted by travelers to developing countries where cholera is endemic, or through food or drink brought in from developing countries. The number of reported cases of cholera in Japan has been decreasing year by year. In the early 2000s, there were around 50 to 100 cases per year, but in recent years, the number has often fallen to less than 10 cases per year.

[0003] Cholera toxin (also known as cholera toxin or CT) is an oligomeric protein with a molecular weight of approximately 84 kDa, consisting of one A subunit molecule with a molecular weight of approximately 27 kDa and five B subunit molecules with a molecular weight of approximately 11.6 kDa. Details of the amino acid sequence and mechanism of action of cholera toxin have already been studied (Patent Document 1, Non-Patent Document 1).

[0004] A definitive diagnosis of cholera requires isolating Vibrio cholerae by stool culture, confirming that the serotype is O1 or O139, and further verifying whether toxin production or the toxin gene is present. A commercially available kit for detecting Vibrio cholerae is, for example, Denka Corporation's Vibrio cholerae AD "Seiken." Methods for detecting Vibrio cholerae include common bacterial detection methods such as isolation and culture tests and PCR tests, as well as methods using anti-Vibrio cholerae monoclonal antibodies (Patent Documents 2-4) and oligonucleotides for detecting Vibrio cholerae (Patent Documents 5 and 6). However, isolation and culture tests require specialized laboratories, are complex procedures, and require time-consuming culture and outsourcing. Furthermore, PCR methods require specialized equipment, are complex procedures, and require time-consuming outsourcing.

[0005] A commercially available kit for detecting cholera toxin is, for example, the VET-RPLA "Seiken" manufactured by Denka Corporation. The common method for detecting cholera toxin is the reversed passive latex agglutination test (RPLA method), which is also used in the VET-RPLA "Seiken." However, because the test detects cholera toxin from cultured bacteria, it requires a day of testing time and has a minimum detection sensitivity of 1-2 ng / mL. Furthermore, as stated in the package insert for the VET-RPLA "Seiken," there is also the problem that the Escherichia coli heat-labile enterotoxin (LT), a homologue of cholera toxin, is also detected with the same sensitivity. [Prior art documents] [Patent documents]

[0006] [Patent Document 1] Japanese Patent Application Publication No. 58-222033 [Patent Document 2] Japanese Patent Application Publication No. 62-265993 [Patent Document 3] Japanese Patent Application Publication No. 62-265994 [Patent Document 4] Japanese Patent Publication No. 62-265998 [Patent Document 5] Japanese Patent Application Publication No. 5-276996 [Patent Document 6] Japanese Patent Application Publication No. 7-8279 [Non-patent literature]

[0007] [Non-Patent Document 1] R.-G. Zhang, DL Scott, ML Westbrook, S. Nance, BD Spangler, GG Shipley and EM Westbrook. 1995 The three-dimensional crystal structure of cholera toxin. Journal of Molecular Biology 251563-573 Summary of the Invention [Problem to be solved by the invention]

[0008] The problem to be solved by the present invention is to perform simple, rapid and highly sensitive detection of cholera toxin (CT), which is required in various situations such as medical settings, food contamination sites and laboratories. [Means for solving the problem]

[0009] The present inventors conducted extensive research to solve the above-mentioned problems. First, BALB / c mice were inoculated with an antigen solution containing the B subunit of cholera toxin (CTxB) and an adjuvant. After inoculation, the mouse splenocytes or lymph node cells were fused with P3U1 to produce hybridomas. From these, hybridomas producing monoclonal antibodies highly reactive to CTxB were selected, and four hybridomas producing antibodies highly reactive to CTxB were successfully isolated.

[0010] These monoclonal antibodies were then used to detect CTxB and full-length cholera toxin (CTx) by immunochromatography, and showed high sensitivity in detecting CTxB and CTx, respectively.

[0011] In a first aspect, the present invention provides a method for detecting cholera toxin in a sample by immunochromatography (hereinafter abbreviated as the detection method of the present invention), which is characterized in that the method uses the same or two different antibodies selected from the following group (hereinafter abbreviated as the antibody group of the present invention) as a labeled antibody and a capture antibody, respectively: 1) 2G6 antibody having at least the amino acid sequence of SEQ ID NO: 9 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 12 as the VL CDR3 region; 2) 3F7 antibody having at least the amino acid sequence of SEQ ID NO: 19 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 22 as the VL CDR3 region; 3) 4E6 antibody having at least the amino acid sequence of SEQ ID NO: 29 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 32 as the VL CDR3 region; 4) the 8A5 antibody, having at least the amino acid sequence of SEQ ID NO: 39 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 42 as the VL CDR3 region; and 5) An antibody having one or two amino acid mutations in each of the VH CDR3 region and / or VL CDR3 region of the antibody of 1) to 4) above.

[0012] The antibodies belonging to the antibody group of the present invention are preferably isolated antibodies. The antibodies belonging to the antibody group of the present invention may be either polyclonal or monoclonal, but are preferably monoclonal in order to prevent erroneous detection due to non-specific reactions.

[0013] More preferably, the antibody belonging to the group of antibodies of the present invention has a titer of 5.0x10 against cholera toxin. -9 M or less, preferably 1.0x10 -9 M or less, more preferably 5.0x10 -10It has an equilibrium dissociation constant KD less than or equal to M.

[0014] In the antibody of 5) above, the amino acid mutation may be any of substitution, deletion, or insertion of an amino acid residue, but substitution is preferred, and conservative amino acid substitution is particularly preferred from the viewpoint of maintaining immunological specificity.

[0015] In further preferred embodiments, the antibodies of the present invention have the following characteristics: 1) 2G6 antibody having at least the amino acid sequence of SEQ ID NO: 7 as a VH CDR1 region, the amino acid sequence of SEQ ID NO: 8 as a VH CDR2 region, the amino acid sequence of SEQ ID NO: 9 as a VH CDR3 region, the amino acid sequence of SEQ ID NO: 10 as a VL CDR1 region, the amino acid sequence of SEQ ID NO: 11 as a VL CDR2 region, and the amino acid sequence of SEQ ID NO: 12 as a VL CDR3 region; 2) a 3F7 antibody having at least the amino acid sequence of SEQ ID NO: 17 as a VH CDR1 region, the amino acid sequence of SEQ ID NO: 18 as a VH CDR2 region, the amino acid sequence of SEQ ID NO: 19 as a VH CDR3 region, the amino acid sequence of SEQ ID NO: 20 as a VL CDR1 region, the amino acid sequence of SEQ ID NO: 21 as a VL CDR2 region, and the amino acid sequence of SEQ ID NO: 22 as a VL CDR3 region; 3) a 4E6 antibody having at least the amino acid sequence of SEQ ID NO: 27 as a VH CDR1 region, the amino acid sequence of SEQ ID NO: 28 as a VH CDR2 region, the amino acid sequence of SEQ ID NO: 29 as a VH CDR3 region, the amino acid sequence of SEQ ID NO: 30 as a VL CDR1 region, the amino acid sequence of SEQ ID NO: 31 as a VL CDR2 region, and the amino acid sequence of SEQ ID NO: 32 as a VL CDR3 region; 4) 8A5 antibody having at least the amino acid sequence of SEQ ID NO: 37 as the VH CDR1 region, the amino acid sequence of SEQ ID NO: 38 as the VH CDR2 region, the amino acid sequence of SEQ ID NO: 39 as the VH CDR3 region, the amino acid sequence of SEQ ID NO: 40 as the VL CDR1 region, the amino acid sequence of SEQ ID NO: 41 as the VL CDR2 region, and the amino acid sequence of SEQ ID NO: 42 as the VL CDR3 region; and 5) An antibody having one or two amino acid mutations in each of the VH CDR1 region, VH CDR2 region, VH CDR3 region, VL CDR1 region, VL CDR2 region and / or VL CDR3 region of the antibody of 1) to 4) above.

[0016] In a more preferred embodiment, the antibodies of the present invention have the following characteristics: 1) 2G6 antibody having the amino acid sequence of SEQ ID NO: 3 as the VH region and the amino acid sequence of SEQ ID NO: 5 as the VL region; 2) 3F7 antibody having the amino acid sequence of SEQ ID NO: 13 as the VH region and the amino acid sequence of SEQ ID NO: 15 as the VL region; 3) 4E6 antibody having the amino acid sequence of SEQ ID NO: 23 as the VH region and the amino acid sequence of SEQ ID NO: 25 as the VL region; 4) 8A5 antibody having the amino acid sequence of SEQ ID NO: 33 as the VH region and the amino acid sequence of SEQ ID NO: 35 as the VL region; and 5) An antibody having 80% or more sequence identity with the antibodies of 1) to 4) above.

[0017] In a second aspect, the present invention provides an antibody for detecting cholera toxin, which is any one antibody selected from the above-mentioned group of antibodies of the present invention, or a combination of two or more identical or different antibodies. The antibody combination is, for example, a combination of two identical or different antibodies used for detecting cholera toxin by immunochromatography. More preferably, it is a combination of the same antibody, which is the 8A5 antibody of 4) above or an antibody derived from the 8A5 antibody of 4) among the antibodies of 5), and most preferably a combination of the same antibody, which is the 8A5 antibody of 4) above.

[0018] In a third aspect, the present invention provides an immunochromatography kit for detecting cholera toxin, comprising any one of antibodies or a combination of antibodies selected from the above-described group of antibodies of the present invention. The kit includes, for example, the 8A5 antibody of 4), which is sensitized with gold colloid to form a labeled antibody, and the 8A5 antibody of 4) is immobilized linearly on a solid phase to form a capture antibody. [Effects of the Invention]

[0019] By using the present invention, cholera toxin, the cause of food poisoning, can be detected easily (e.g., by preparing a kit, a special laboratory is not required), quickly (test time: less than 1 hour, preferably less than 30 minutes, e.g., 15 minutes), and with high sensitivity (detection sensitivity: up to 1 ng / mL, preferably up to 0.25 ng / mL) even in medical settings. Furthermore, antibodies belonging to the antibody group of the present invention can detect the B subunit of Escherichia coli heat-labile enterotoxin (LTB), a homologue of cholera toxin, only at a high concentration of 100 ng / mL, and are therefore considered to have high specificity for detecting cholera toxin. [Brief explanation of the drawings]

[0020] [Figure 1] 1 shows a scheme for producing hybridomas to obtain the antibody group of the present invention. [Figure 2] This shows the CTxB reactivity of 10 candidate antibodies. The left bar shows the OD450 measured by ELISA using the antigen CTxB, and the right bar shows the OD450 measured by ELISA using killed Enterobacterium cells as a negative control. [Figure 3] The reactivity of six purified candidate antibodies to CTxB is shown. The left bar shows the OD450 in ELISA when the antigen CTxB was used at a concentration of 1.0 μg / mL, and the right bar shows the OD450 when the antigen was used at a concentration of 0.1 μg / mL. [Figure 4] The reactivity of six purified candidate antibodies to CTx is shown. The left bar shows the OD450 in ELISA when the antigen CTx was used at a concentration of 1.0 μg / mL, and the right bar shows the OD450 when the antigen was used at a concentration of 0.1 μg / mL. [Figure 5] The affinity of six purified candidate antibodies for CTxB determined by surface plasmon resonance is shown. [Figure 6] Immunochromatographs are shown for each combination of gold colloid-sensitized candidate antibody and candidate antibody used for the test line, using water, PBS alone, or CTxB at 0.1, 1, 10, and 100 ng / mL. [Figure 7]Immunochromatographs are shown for each combination of gold colloid-sensitized candidate antibody and candidate antibody used for the test line, in 1% PBS alone, CTxB 10 ng / mL, and LTB 10 ng / mL. [Figure 8] CTx (0, 0.25, 0.5, 1.0, or 10 ng / mL), CTxB (0, 0.25, 0.5, 1.0, or 10 ng / mL), or LTB (0, 0.25, 0.5, 1.0, 10, or 100 ng / mL) was prepared and suspended in 1% NP40-PBS developing solution, and immunochromatography was performed using gold colloid-sensitized: 8A5 and test line: 8A5 immunochromatography reagents. [Figure 9] CTx (0, 1.0, or 10 ng / mL), CTxB (0, 1.0, or 10 ng / mL), or LTB (0, 1.0, 10, or 100 ng / mL) was suspended in healthy human feces in 1% NP40-PBS as a developing solution, and the suspension was developed using the immunochromatography reagents gold colloid sensitization: 8A5 and test line: 8A5. DETAILED DESCRIPTION OF THE INVENTION

[0021] The present invention is described in detail below. The terms used in this specification are understood according to their general definitions in the fields of microbiology, biochemistry, molecular biology, medicine, and pharmacology. However, for terms specifically explained or defined in this specification, the explanations or definitions in this specification take precedence. Furthermore, the literature cited in this specification is incorporated herein by reference.

[0022] In a first aspect, the present invention provides a method for detecting cholera toxin in a sample by immunochromatography, as described above. Immunochromatography is understood to be an immunoassay method that detects an antigen using a labeled antibody and a capture antibody. Typically, the immunochromatographic process involves contacting a sample with a labeled antibody, applying the sample to a sample application portion of a solid phase, developing the labeled antibody-antigen conjugate in the sample, and capturing the labeled antibody-antigen conjugate with a capture antibody immobilized on a determination portion to form a labeled antibody-antigen-capture antibody conjugate, which is then determined visually or by an appropriate measurement device. Therefore, the detection method of the present invention typically includes the steps of: 1) contacting the sample with a labeled antibody; 2) developing the sample contacted with the labeled antibody on a solid phase having a determination portion to which a capture antibody is immobilized; and 3) confirming the determination portion.

[0023] In the detection method of the present invention, the specimen may be any specimen used in food poisoning tests, such as feces, wastewater, beverages, or food, and may be a specimen diluted or suspended in water, a buffer solution, etc. The term "specimen" also encompasses not only specimens or specimen dilutions or suspensions, but also mixtures of these with labeled antibodies.

[0024] In the detection method of the present invention, the labeled antibody is a labeled antibody selected from the group of antibodies of the present invention. The labeling method may be any method commonly used in the art, and typically includes, but is not limited to, binding a metal colloid, a fluorescent dye, magnetic latex beads, or the like to the antibody, such as sensitizing the antibody to gold colloid particles as a metal colloid.

[0025] In the detection method of the present invention, the capture antibody is an antibody that binds to the same antigen as the labeled antibody, i.e., cholera toxin. Typically, the capture antibody is immobilized on a solid layer on which a sample is developed. The antigen bound to the labeled antibody, i.e., the labeled antibody-bound cholera toxin, is captured on the solid layer by the capture antibody. Typically, the capture antibody is immobilized on a portion of the solid layer, for example, in a line perpendicular to the direction of electrophoresis, to form a test area.

[0026] In the detection method of the present invention, the solid layer may be any solid layer commonly used in immunochromatographic assays, including, but not limited to, a solid layer made of a microporous material such as glass fiber, nylon, nitrocellulose, polyvinylidene difluoride, cellulose acetate, etc. Furthermore, functionally, the solid layer includes a sample application portion, an electrophoresis portion, and a determination portion.

[0027] In the detection method of the present invention, the method of developing the sample is appropriately selected depending on the solid layer. For example, the development may be based on capillary action in the solid layer or on electrophoresis with the application of an external force such as electricity. Electrophoresis utilizing capillary action in the solid layer is preferred because it requires less equipment and is simpler.

[0028] In the detection method of the present invention, the determination or confirmation of the determination portion is appropriately selected depending on the labeled antibody. For example, such determination or confirmation of the determination portion includes visual inspection as well as measurement using a fluorescence measurement device. Visual inspection is preferred because it requires less equipment, but fluorescence measurement has the advantage of enabling quantitative measurement based on fluorescence intensity.

[0029] Cholera toxin, which is the target of detection in the detection method of the present invention, is composed of an A subunit consisting of the amino acid represented by SEQ ID NO: 1 and a B subunit consisting of five amino acids represented by SEQ ID NO: 2. The detailed structure of cholera toxin is registered in public databases (such as GenBank). The amino acid sequences of the A and B subunits of cholera toxin are specifically shown below. Cholera toxin is abbreviated as CT, and when simply referred to as cholera toxin, both the full length and fragments, such as subunits, are implied. In particular, the full length of cholera toxin is referred to as CTx, the A subunit as CTxA, and the B subunit as CTxB. It is to be understood that for all amino acid sequences, the one-letter and three-letter abbreviations can be unambiguously converted into each other.

[0030] Amino acid sequence of CTxA (SEQ ID NO: 1): MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLYDHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLGAYSPHPDEQ EVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGYGLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL

[0031] Amino acid sequence of CTxB (SEQ ID NO: 2): MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

[0032] In the present invention, antibodies may be so-called complete antibodies as well as various structures, such as, but not limited to, antibody fragments, monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies, chimeric antibodies, humanized antibodies, antibody fusions, and fragments of each of these.

[0033] Antibodies are typically tetramers consisting of two pairs of light and heavy chains, with the amino-terminal portion of each chain containing a variable region primarily responsible for antigen recognition. Three loops in the variable region assemble in each V domain of the heavy and light chains (also called VH for the heavy chain and VL for the light chain) to form the antigen-binding site. Each loop is also called a complementarity-determining region (hereinafter also referred to as "CDR"), and this region exhibits the most significant amino acid sequence variation. "Variable" refers to the fact that certain segments of the variable region vary widely among antibody sequences. The variability within the variable region is not uniformly distributed. Instead, V domains consist of relatively invariant structures called framework regions (FRs) of 15 to 30 amino acids separated by short, highly variable regions called "hypervariable regions," each 9 to 15 amino acids long or longer. Each VH and VL consists of three hypervariable regions (also known as "complementarity-determining regions" or "CDRs") and four FRs, which are arranged from the amino terminus to the carboxy terminus in the order FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. Among the CDRs, CDR3 is particularly important for determining complementarity, followed by the other CDRs. FRs contribute little or nothing to determining complementarity. Therefore, when specifying an antibody based on its antigen-binding specificity, it is possible to adequately identify the antibody by specifying only the CDR sequence, for example, the amino acid sequence of CDR2 or the amino acid sequences of CDR1 to CDR3, rather than specifying the entire amino acid sequence of the antibody.

[0034] In one embodiment, the antibody is an antibody fragment. Specific antibody fragments include, but are not limited to, (i) a Fab fragment consisting of the VL, VH, CL, and CH1 domains; (ii) a Fd fragment consisting of the VH and CH1 domains; (iii) a Fv fragment consisting of the VL and VH domains of a single antibody; (iv) a dAb fragment consisting of a single variable region (Ward et al., 1989, Nature 341:544-546, incorporated by reference in its entirety); (v) an isolated CDR region; (vi) a F(ab')2 fragment, which is a bivalent fragment containing two linked Fab fragments; and (vii) a single-chain Fv molecule (scFv), in which the VH and VL domains are linked by a peptide linker that allows the two domains to associate to form an antigen-binding site (Bird et al., 1988, Science 242:423-426, Huston et al., 2002). al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883, incorporated by reference in its entirety); (viii) bispecific single-chain Fvs (WO 03 / 11161, incorporated by reference herein); and (ix) "diabodies" or "triabodies," which are multivalent or multispecific fragments constructed by gene fusion (Tomlinson et al., 2000, Methods Enzymol. 326:461-479; WO 94 / 13804; Holliger et al., 1993, Proc. Natl. Acad. Sci. USA 90:6444-6448, all incorporated by reference in their entirety).

[0035] In some embodiments, the antibodies may be a mixture of different species, e.g., chimeric and / or humanized antibodies, etc. That is, in the present invention, CDR sets may be used with framework and constant regions other than those specifically set forth by sequence herein.

[0036] In general, both "chimeric antibody" and "humanized antibody" refer to antibodies that combine regions from two or more species. For example, a "chimeric antibody" traditionally contains variable region(s) from a mouse (or in some cases, a rat) and constant region(s) from a human. A "humanized antibody" typically refers to a non-human antibody that has variable domain framework regions swapped for sequences found in a human antibody. Generally, in a humanized antibody, the entire antibody, except for the CDRs, is encoded by a polynucleotide of human origin or is identical to such an antibody except within its CDRs. The CDRs, some or all of which are encoded by nucleic acid from a non-human organism, are grafted onto the beta-sheet framework of a human antibody variable region to create an antibody whose specificity is determined by the grafted CDRs. The production of such antibodies is described, for example, in WO92 / 11018, Jones, 1986, Nature 321:522-525, Verhoeyen et al., 1988, Science 239:1534-1536, all of which are incorporated herein by reference in their entireties.

[0037] In one embodiment, the antibody is a minibody. A minibody is a minimized antibody-like protein that contains an scFv linked to a CH3 domain (Hu et al., 1996, Cancer Res. 56:3055-3061, incorporated by reference in its entirety). In some cases, the scFv may be linked to an Fc region and may include some or the entire hinge region.

[0038] The antibodies of the present invention are typically isolated or recombinant. "Isolated," as used to describe the various polypeptides disclosed herein, refers to a polypeptide that has been identified and separated and / or recovered from a cell or cell culture in which the polypeptide is expressed. Typically, an isolated polypeptide is prepared by at least one purification step. An "isolated antibody" refers to an antibody that is substantially free of other antibodies with different antigen specificities. For example, an isolated antibody that specifically binds to cholera toxin is substantially free of antibodies that specifically bind to antigens other than cholera toxin.

[0039] Multiple isolated monoclonal antibodies can be used in combination in the detection method of the present invention, for example, in the case of immunochromatography, by labeling one to form a labeled antibody and immobilizing the other on a solid phase to form a capture antibody.

[0040] An antibody selected from the group of antibodies of the present invention specifically binds to cholera toxin. "Specific binding" or "specifically binds," or "specific" for a particular antigen or antigen fragment, refers to binding that is measurably different from non-specific interactions. Specific binding can be measured, for example, by determining the binding of a molecule compared to the binding of a control molecule, which is usually a molecule of similar structure that does not have binding activity. For example, specific binding can be determined by competition with a control molecule that is similar to the target.

[0041] Specific binding to a particular antigen or antigen fragment may be, for example, at least about 1.0x10 -1 , at least about 5.0x10 -2 or preferably at least about 1.0x10 -2 This is demonstrated by an antibody having a Kd (1 / s) for an antigen or antigen fragment of 20, 50, 100, 500, 1000, or 5,000 times or more higher than a control molecule for the antigen or antigen fragment. Here, Kd refers to the dissociation rate constant of a specific antibody-antigen interaction. Typically, an antibody that specifically binds to an antigen has a Kd that is 20, 50, 100, 500, 1000, or 5,000 times higher than a control molecule for the antigen or antigen fragment.

[0042] Furthermore, specific binding to a particular antigen or antigen fragment is exhibited by an antibody having an association rate constant Ka (1 / Ms) for the antigen or antigen fragment that is at least 20, 50, 100, 500, 1000, or 5,000 times higher than that for the antigen or antigen fragment relative to a control, where Ka refers to the association rate of a particular antibody-antigen interaction.

[0043] Furthermore, the binding characteristics of a specific antibody to an antigen or antigen fragment that specifically binds to the antibody are expressed as the equilibrium dissociation constant KD (M), calculated by Kd / Ks. The equilibrium dissociation constant is also called affinity. High binding characteristics are expressed as a low KD value. For example, the antibody used in the detection method of the present invention has an affinity of 5.0 x 10 for cholera toxin at 25°C. -9 M or less, preferably 1.0x10 -9 M or less, more preferably 5.0x10 -10 KD of 1.0 x 10 at 37°C or less -9 M or less, preferably 5.0x10 -10 M or less, more preferably 1.0x10 -10 Has a KD of M or less.

[0044] The binding rate constant, dissociation rate constant, and equilibrium dissociation constant between an antibody and an antigen can all be easily determined by techniques known in the art, including, but not limited to, the so-called surface plasmon resonance method, which includes an antigen cross-linking method, an antibody cross-linking method, and a capture method.

[0045] In a second aspect, the present invention provides a group of antibodies that specifically bind to cholera toxin. The antibodies included in the group of antibodies of the present invention can be used alone or in combination of two or more. Furthermore, any one antibody selected from the group of antibodies of the present invention can be used in combination with another antibody from the group of antibodies of the present invention, for example, another antibody that binds to cholera toxin.

[0046] In the most preferred embodiment, antibody 1) 2G6 of the present invention has a VH having the amino acid sequence shown in SEQ ID NO: 3 and a VL having the amino acid sequence shown in SEQ ID NO: 5. Furthermore, the gene encoding the VH of antibody 1) has the nucleotide sequence shown in SEQ ID NO: 4, and the gene encoding the VL of antibody 1) is shown in SEQ ID NO: 6. The amino acid sequence of antibody 1) and the nucleotide sequence of the gene encoding it are specifically shown below.

[0047] Amino acid sequence of VH of antibody 1) (SEQ ID NO: 3): EGQLQESGAELAKPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGFINPYTGFTEYSQKFKDKATLTADKSSSTAYIQLNSLTSEDSAVYYCSRRFNYGSAYFDFWGQGTTLTVSS

[0048] Nucleotide sequence of the gene encoding VH of antibody 1) (SEQ ID NO: 4): gaggggcagc ttcaggagtc tggggctgaa ctggcaaaac ctggggcctc agtgaagatg tcctgcaagg cttctggcta cacctttact agctactgga tgcactgggt aaaacagagg cctggacagg gtctggaatg gattggattc attaatcctt acactggttt tactgagtac agtcagaagt tcaaggacaa ggccacattg actgcagaca aatcctccag tacagcctac atacaactga acagcctgac atctgaggac tctgcagtct attactgttc aagaaggttt aactacggta gtgcctactt tgacttctgg ggccaaggca ccactctcac agtctcctca

[0049] Amino acid sequence of VL of antibody 1) (SEQ ID NO: 5): DILLTQSPALMAASPGEKVTITCSVSSSISSSNLHWYQQKSETSPKPWIYGTSNLASGVPVRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSNYPLTFGGGTKLEVK

[0050] Nucleotide sequence of the gene encoding VL of antibody 1) (SEQ ID NO: 6): gacattttgc tcactcagtc tccagcactc atggctgcat ctccagggga gaaggtcacc atcacctgta gtgtcagctc aagtataagt tccagcaact tgcactggta ccagcagaag tcagaaacct cccccaaacc ctggatttat ggcacatcca acctggcttc tggagtccct gttcgcttca gtggcagtgg atctgggacc tcttattctc tcacaatcag cagcatggag gctgaagatg ctgccactta ttactgtcaa cagtggagta attacccact cacgttcgga ggggggacca agctggaggt aaaa

[0051] Antibody 1) was further analyzed in detail, and CDRs 1 to 3 of VH and VL were identified. Antibody 1) of the present invention has an amino acid sequence in which VH CDR1 is represented by SEQ ID NO: 7, VH CDR2 is represented by SEQ ID NO: 8, and VH CDR3 is represented by SEQ ID NO: 9, and an amino acid sequence in which VL CDR1 is represented by SEQ ID NO: 10, VL CDR2 is represented by SEQ ID NO: 11, and VL CDR3 is represented by SEQ ID NO: 12. The amino acid sequences of CDRs 1 to 3 of VH and VL are specifically shown below.

[0052] VH CDR1 amino acid sequence of Antibody 1) (SEQ ID NO:7): GYTFTSYWMH VH CDR2 amino acid sequence of Antibody 1) (SEQ ID NO: 8): FINPYTGFTEYSQKFKD VH CDR3 amino acid sequence of Antibody 1) (SEQ ID NO: 9): RFNYGSAYFDF Antibody 1) VL CDR1 amino acid sequence (SEQ ID NO: 10): SVSSSISSSNLH VL CDR2 amino acid sequence of antibody 1) (SEQ ID NO: 11): GTSNLAS VL CDR3 amino acid sequence of antibody 1) (SEQ ID NO: 12): QQWSNYPLT

[0053] In the most preferred embodiment, antibody 2) 3F7 of the present invention has a VH having the amino acid sequence shown in SEQ ID NO: 13 and a VL having the amino acid sequence shown in SEQ ID NO: 15. The gene encoding the VH of antibody 2) has the nucleotide sequence shown in SEQ ID NO: 14, and the gene encoding the VL of antibody 2) is shown in SEQ ID NO: 16. The amino acid sequence of antibody 2) and the nucleotide sequence of the gene encoding it are specifically shown below.

[0054] Amino acid sequence of VH of antibody 2) (SEQ ID NO: 13): QAYLQQSGPELMKPGASVKISCKASGYSFTSYYMHWVRQRHGKSLEWIGYIDPFNGDTRYNQKFKGKATLTVDKSSSTAYMHLSSLTSEDSAVHYCARWAYYDSYYFDYWGQGTTLTVSS

[0055] Nucleotide sequence of the gene encoding VH of antibody 2) (SEQ ID NO: 14): caggcttatc tgcagcagtc tggacctgag ctgatgaagc ctggggcttc agtgaagata tcctgcaagg cttccggtta ctctttcact agctactaca tgcactgggt gaggcagaga catggaaaga gccttgagtg gattggatat attgatcctt tcaatggtga tactaggtac aaccagaaat tcaagggcaa ggccacattg actgtagaca aatcttccag cacagcctac atgcatctca gcagcctgac atctgaggac tctgcagtcc attactgtgc aagatgggct tactacgata gttattattt tgactactgg ggccaaggca ccactctcac agtctcctca

[0056] Amino acid sequence of VL of antibody 2) (SEQ ID NO: 15): DVVVTQTPLSLPVSLGEGQASISCRSSQGFVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCLQGSHVPLTFGAGTKLELK

[0057] Nucleotide sequence of the gene encoding VL of antibody 2) (SEQ ID NO: 16): gatgttgtgg tgacccaaac tccactctcc ctgcctgtca gtcttggaga gcaagcctcc atctcttgca gatctagtca gggctttgta catagtaatg gaaacaccta tttagaatgg tacctgcaga aaccaggcca gtctccaaag ctcctgatct acaaagtttc caaccgattt tctggggtcc cagacaggtt cagtggcagt ggatcaggga cagatttcac actcaagatc agcagagtgg aggctgagga tctgggagtt tattactgtc ttcaaggttc acatgttccg ctcacgttcg gtgctgggac caagctggag ctgaaa

[0058] Antibody 2) was further analyzed in detail, and CDR1 to CDR3 of VH and VL were identified. Antibody 2) of the present invention has an amino acid sequence in which VH CDR1 is represented by SEQ ID NO: 17, VH CDR2 is represented by SEQ ID NO: 18, and VH CDR3 is represented by SEQ ID NO: 19, and an amino acid sequence in which VL CDR1 is represented by SEQ ID NO: 20, VL CDR2 is represented by SEQ ID NO: 21, and VL CDR3 is represented by SEQ ID NO: 22. The amino acid sequences of CDR1 to CDR3 of VH and VL are specifically shown below.

[0059] VH CDR1 amino acid sequence of antibody 2) (SEQ ID NO: 17): GYSFTSYYMH VH CDR2 amino acid sequence of antibody 2) (SEQ ID NO: 18): YIDPFNGDTRYNQKFKG VH CDR3 amino acid sequence of antibody 2) (SEQ ID NO: 19): WAYYDSYYFDY Antibody 2) VL CDR1 amino acid sequence (SEQ ID NO: 20): RSSQGFVHSNGNTYLE VL CDR2 amino acid sequence of antibody 2) (SEQ ID NO: 21): KVSNRFS VL CDR3 amino acid sequence of antibody 2) (SEQ ID NO: 22): LQGSHVPLT

[0060] In the most preferred embodiment, antibody 3) 4E6 of the present invention has a VH having the amino acid sequence shown in SEQ ID NO: 23 and a VL having the amino acid sequence shown in SEQ ID NO: 25. The gene encoding the VH of antibody 3) has the nucleotide sequence shown in SEQ ID NO: 24, and the gene encoding the VL of antibody 3) is shown in SEQ ID NO: 26. The amino acid sequence of antibody 3) and the nucleotide sequence of the gene encoding it are specifically shown below.

[0061] Amino acid sequence of VH of antibody 3) (SEQ ID NO: 23): EVRLQQSGPELVRPGASMKISKASGYSFTGYTMNWVKQSHGKNLDWIGLIHPYNGRTTYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYYCAKEYDWYFDVWGAGTTVTVSS

[0062] Nucleotide sequence of the gene encoding VH of antibody 3) (SEQ ID NO: 24): gaggttcggc tgcaacagtc tggacctgag ctggtgaggc ctggagcttc aatgaagata tcctgcaagg cttctggtta ctcattcact ggctacacca tgaactgggt gaaacagagc catggaaaga accttgactg gattggactt attcatcctt acaatggtcg tactacctac aaccagaagt tcaagggcaa ggccacatta actgtagaca agtcatccag cacagcctac atggagctcc tcagtctgac atctgaggac tctgcagtct attactgtgc aaaagagtac gactggtact tcgatgtctg gggcgcaggg accacggtca ccgtctcctc a

[0063] Amino acid sequence of VL of antibody 3) (SEQ ID NO: 25): DIQMTQSPSSLSASLGDTITITCHASQNINIWLSWYQQKPGNIPKLLIYQASNLHTGVPSRFSGSGSGTGFKLTIRSLQPEDIATYYCQQGQSYPRTFGGGTKLEIK

[0064] Nucleotide sequence of the gene encoding VL of antibody 3) (SEQ ID NO: 26): gacatccaga tgacacagtc tccatccagt ctgtctgcat cccttggaga cacaattacc atcacttgcc atgccagtca gaacattaat atttggttaa gctggtacca gcagaaacca ggaaatattc ctaaactatt gatctatcag gcttccaact tgcacacagg cgtcccatca aggtttagtg gcagtggatc tggaacaggt ttcaaattaa ccatccgcag cctgcagcct gaagacattg ccacttacta ctgtcaacag ggtcaaagtt atcctcggac gttcggtgga ggcaccaagc tggaaatcaa a

[0065] Antibody 3) was further analyzed in detail, and CDR1 to 3 of VH and VL were identified. Antibody 3) of the present invention has an amino acid sequence in which VH CDR1 is represented by SEQ ID NO: 27, VH CDR2 is represented by SEQ ID NO: 28, and VH CDR3 is represented by SEQ ID NO: 29, and an amino acid sequence in which VL CDR1 is represented by SEQ ID NO: 30, VL CDR2 is represented by SEQ ID NO: 31, and VL CDR3 is represented by SEQ ID NO: 32. The amino acid sequences of CDR1 to 3 of VH and VL are specifically shown below.

[0066] VH CDR1 amino acid sequence of antibody 3) (SEQ ID NO: 27): GYSFTGYTMN VH CDR2 amino acid sequence of antibody 3) (SEQ ID NO: 28): LIHPYNGRTTYNQKF VH CDR3 amino acid sequence of antibody 3) (SEQ ID NO: 29): EYDWYFDV Antibody 3) VL CDR1 amino acid sequence (SEQ ID NO: 30): HASQNINIWLS Antibody 3) VL CDR2 amino acid sequence (SEQ ID NO: 31): QASNLHT VL CDR3 amino acid sequence of antibody 3) (SEQ ID NO: 32): QQGQSYPRT

[0067] In the most preferred embodiment, antibody 4) 8A5 of the present invention has a VH having the amino acid sequence shown in SEQ ID NO: 33 and a VL having the amino acid sequence shown in SEQ ID NO: 35. The gene encoding the VH of antibody 4) has the nucleotide sequence shown in SEQ ID NO: 34, and the gene encoding the VL of antibody 4) is shown in SEQ ID NO: 36. The amino acid sequence of antibody 4) and the nucleotide sequence of the gene encoding it are specifically shown below.

[0068] Amino acid sequence of VH of antibody 4) (SEQ ID NO: 33): QVQLQQSAAELARPGASVKMSCKASGFTFTSYTLHWVKQRPGQGLEWIGYINPRGYTEYHQKFKDKTTLTADKSSSTAYIQLNSLTSEDSAVYYCARYDGFFLYALDYWGQGTSVTVSS

[0069] Nucleotide sequence of the gene encoding VH of antibody 4) (SEQ ID NO: 34): caggtccaac tgcagcagtc tgcagctgaa ctggcaagac ctggggcctc agtgaagatg tcctgcaagg cttctggctt cacctttact agctacacgt tacactgggt aaaacagagg cctggacagg gtctggaatg gattggatac attaatcccc gtggatatac tgagtaccat cagaagttca aggacaagac cacattgact gcagacaaat cctccagcac agcctacata caactgaaca gcctgacatc tgaggactct gcggtctatt actgtgcaag atatgatggt ttcttcctct atgctttgga ctattggggt caaggaacct cagtcaccgt ctcctca

[0070] Amino acid sequence of VL of antibody 4) (SEQ ID NO: 35): DIQMTQSPSSMYASLGERVTITCKASQDINSNLSWFQQKPGKSPKTLIYRASRLVHGVPSRFSGSGSGQDYSLTISSLEYEDMGIYSCLQYDEFPYTFGGGTKLEIK

[0071] Nucleotide sequence of the gene encoding VL of antibody 4) (SEQ ID NO: 36): gacatccaga tgacacagtc tccatcttcc atgtatgcat ctctaggaga gagagtcact atcacttgca aggcgagtca ggacattaat agcaatttaa gctggttcca gcagaaacca gggaaatctc ctaagaccct gatctatcgt gcaagcagat tggtacatgg ggtcccatca aggttcagtg gcagtggatc tgggcaagat tattctctca ccatcagcag cctggagtat gaagatatgg gaatttattc ttgtctacag tatgatgagt ttccgtacac gttcggaggg gggaccaagc tggaaataaa a

[0072] Antibody 4) was further analyzed in detail, and CDR1 to CDR3 of VH and VL were identified. Antibody 4) of the present invention has an amino acid sequence in which its VH CDR1 is represented by SEQ ID NO: 37, its VH CDR2 is represented by SEQ ID NO: 38, and its VH CDR3 is represented by SEQ ID NO: 39, and its VL CDR1 is represented by SEQ ID NO: 40, its VL CDR2 is represented by SEQ ID NO: 41, and its VL CDR3 is represented by SEQ ID NO: 42. The amino acid sequences of CDR1 to CDR3 of VH and VL are specifically shown below.

[0073] VH CDR1 amino acid sequence of antibody 4) (SEQ ID NO: 37): GFTFTSYTLH VH CDR2 amino acid sequence of antibody 4) (SEQ ID NO: 38): YINPRGYTEYHQKFKD VH CDR3 amino acid sequence of antibody 4) (SEQ ID NO: 39): YDGFFLYALDY VL CDR1 amino acid sequence of antibody 4) (SEQ ID NO: 40): KASQDINSNLS VL CDR2 amino acid sequence of antibody 4) (SEQ ID NO: 41): RASRLVH VL CDR3 amino acid sequence of antibody 4) (SEQ ID NO: 42): LQYDEFPYT

[0074] The present invention also provides mutant antibodies, i.e., the antibodies of the present invention may have a number of modifications, including, but not limited to, amino acid modifications in the CDRs (affinity maturation), amino acid modifications in the Fc region, glycosylation variants, and other types of covalent modifications.

[0075] As used herein, a "variant" refers to a polypeptide sequence that differs from that of a parent polypeptide by at least one amino acid modification, which may include substitutions, insertions, and deletions, with substitutions, especially conservative substitutions, being preferred in many cases.

[0076] Generally, as described herein, variants may include any number of modifications as long as the functionality of the antibody is still present, i.e., in the case of amino acid variants made in the CDRs of any of the antibodies of the invention, the antibody should still specifically bind to CTx, for example.

[0077] In general, however, since the goal in most cases is to alter function with the minimum number of modifications, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions are typically utilized. In some cases, 1-5 modifications are present, and many embodiments also recognize the use of 1-2, 1-3, and 1-4 modifications.

[0078] It should be noted that the number of amino acid modifications may be within the range of a functional domain: for example, it may be desirable to have 1 to 5 modifications in the Fc region of a wild-type or variant protein, e.g., 1 to 5 modifications in the Fv region. Preferably, the variant polypeptide sequence has at least about 80%, 85%, 90%, 95%, or up to 98 or 99% identity with the parent sequence (e.g., the variable region, constant region, and / or heavy and light chain sequences of any antibody selected from the group of antibodies of the present invention). It should be noted that the percentage of identity is determined by the number of amino acids, although this depends on the sequence size.

[0079] As used herein, "amino acid substitution" or "substitution" refers to the replacement of an amino acid at a specific position in a parent polypeptide sequence with another amino acid. For example, the substitution S100A refers to a mutant polypeptide in which the serine at position 100 is replaced with an alanine. As used herein, "amino acid insertion" or "insertion" refers to the addition of an amino acid at a specific position in a parent polypeptide sequence. As used herein, "amino acid deletion" or "deletion" refers to the removal of an amino acid at a specific position in a parent polypeptide sequence.

[0080] As used herein, "parent polypeptide," "parent protein," "precursor polypeptide," or "precursor protein" refers to an unmodified polypeptide that is subsequently modified to generate a variant. Typically, the parent polypeptide herein is any antibody selected from the group of antibodies of the present invention. The parent polypeptide may refer to the polypeptide itself, a composition comprising the parent polypeptide, or the amino acid sequence encoding it. Thus, as used herein, "parent Fc polypeptide" refers to an Fc polypeptide that is modified to generate a variant, and as used herein, "parent antibody" refers to an antibody that is modified to generate a variant antibody.

[0081] As used herein, "wild-type" or "WT" or "native" refers to an amino acid sequence or nucleotide sequence found in nature, including allelic variations. A WT protein, polypeptide, antibody, immunoglobulin, IgG, etc., has an amino acid sequence or nucleotide sequence that has not been intentionally modified.

[0082] As used herein, a "variant Fc region" refers to an Fc sequence that differs from that of a wild-type Fc sequence by virtue of at least one amino acid modification. An Fc variant may refer to the Fc polypeptide itself, a composition comprising the Fc variant polypeptide, or the amino acid sequence.

[0083] In some embodiments, one or more amino acid modifications are made in one or more CDRs of antibody.Generally, only one or two amino acids are substituted in any single CDR, and usually 3, 4, 5, 6, 7, 8, 9 or 10 or more changes are not made in a set of CDRs.However, in any CDR, any combination of no substitution, one or two, or three or more substitutions can be made, and any other substitutions can be independently and optionally combined.

[0084] In some cases, amino acid modifications in the CDRs are referred to as "affinity maturation." An "affinity matured" antibody has one or more changes in one or more CDRs that result in improved affinity of the antibody for the antigen compared to a parent antibody that does not have those changes. In some cases, although rare, it may be desirable to reduce the affinity of an antibody for its antigen, but this is generally not preferred.

[0085] Affinity maturation can be performed to increase the binding affinity of an antibody for an antigen by at least about 10%, 50%, 100%, 150%, or 1-5 times compared to the "parent" antibody. Preferred affinity-matured antibodies have nanomolar or even picomolar affinities for the target antigen. Affinity-matured antibodies are produced by known procedures. See, for example, Marks et al., 1992, Biotechnology 10:779-783, which describes affinity maturation by heavy chain variable (VH) and light chain variable (VL) domain shuffling. Methods for random mutagenesis of CDR and / or framework residues are described, for example, in Barbas, et al. 1994, Proc. Nat. Acad. Sci. USA 91:3809-3813; Shier et al., 1995, Gene 169:147-155; Yelton et al., 1995, J. Immunol. 155:1994-2004; Jackson et al., 1995, J. Immunol. 154(7):3310-9; and Hawkins et al., 1992, J. Mol. Biol. 226:889-896.

[0086] Alternatively, amino acid modifications can be made in one or more CDRs of an antibody of the invention that are "silent" or "conservative," e.g., that do not significantly alter the affinity of the antibody for antigen. These can be made for a variety of reasons, including to optimize expression (which can be made to a nucleic acid encoding an antibody of the invention).

[0087] It is well known in the art that a certain amino acid can be substituted with another amino acid having a similar hydrophobicity index and still produce a protein having a similar biological function (e.g., a protein equivalent in enzymatic activity; hereinafter, "bioisequence"). In such amino acid substitutions, the hydrophobicity index is preferably within ±2, more preferably within ±1, and even more preferably within ±0.5. It is understood in the art that such amino acid substitutions based on hydrophobicity are efficient. The hydrophilicity index is also taken into consideration in creating bioisosteres. As described in U.S. Patent No. 4,554,101, the following hydrophilicity indices are assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartic acid (+3.0±1); glutamic acid (+3.0±1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5±1); alanine (-0.5); histidine (-0.5); cysteine ​​(-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4). In such amino acid substitutions, the hydrophilicity index is preferably within ±2, more preferably within ±1, and even more preferably within ±0.5.

[0088] Therefore, in the present invention, polypeptides may be subjected to mutations or conservative substitutions. Such mutations may be substitutions, insertions, or deletions. Methods for such mutations are well known in the art and are not limited to any particular method. A conservative substitution refers to a substitution in which the hydrophilicity index and / or hydrophobicity index of the original amino acid and the substituted amino acid are similar as described above, and is a typical example of a silent modification. Examples of such conservative substitutions are well known to those skilled in the art, and include, but are not limited to, substitutions within the following groups: arginine and lysine; glutamic acid and aspartic acid; serine and threonine; glutamine and asparagine; valine, leucine, and isoleucine.

[0089] Thus, variant CDRs and antibodies are included within the definition of the CDRs and antibodies of the invention; i.e., the antibodies of the invention may comprise amino acid modifications in one or more CDRs. Furthermore, as outlined below, amino acid modifications may optionally be made independently in any region outside the CDRs (including framework and constant regions).

[0090] In some embodiments, a mutant antibody specific for CTx is described. The antibody comprises six CDRs, each of which may independently differ from the amino acid sequence described above by 0, 1, or 2 amino acid substitutions. In contrast, the amino acid sequence of the FR region may be more extensively mutated, for example, to achieve approximately 80%, 85%, or 90% identity with the parent FR region sequence, since its amino acid sequence does not significantly affect the binding specificity of the antibody.

[0091] In addition to the modifications outlined above, other modifications can be made. For example, the molecule can be stabilized by the incorporation of disulfide bridges linking the VH and VL domains (Reiter et al., 1996, Nature Biotech. 14:1239-1245, incorporated by reference in its entirety). Furthermore, there are a variety of covalent modifications of antibodies that can be made, as outlined below.

[0092] Covalent modifications of antibodies are included within the scope of this invention and are usually, but not always, done post-translationally. For example, several types of covalent antibody modifications are introduced into the molecule by reacting specific amino acid residues of the antibody with organic derivatizing agents capable of reacting with selected side chains or with the N- or C-terminal residues.

[0093] Cysteinyl residues most commonly are reacted with α-haloacetates (and corresponding amines), such as chloroacetic acid or chloroacetamide, to give carboxymethyl or carboxyamidomethyl derivatives. Cysteinyl residues may also be derivatized by reaction with bromotrifluoroacetone, α-bromo-β-(5-imidozoyl)propionic acid, chloroacetylphosphate, N-alkylmaleimides, 3-nitro-2-pyridyl disulfide, methyl 2-pyridyl disulfide, p-chloromercuribenzoate, 2-chloromercuri-4-nitrophenol, or chloro-7-nitrobenzo-2-oxa-1,3-diazole, and the like.

[0094] Histidyl residues are derivatized by reaction with diethylpyrocarbonate at pH 5.5-7.0 because this agent is relatively specific for the histidyl side chain. Para-bromophenacyl bromide is also useful; the reaction is preferably performed in 0.1 M sodium cacodylate at pH 6.0.

[0095] Lysinyl and amino-terminal residues are reacted with succinic or other carboxylic acid anhydrides. Derivatization with this agent has the effect of reversing the charge of the lysinyl residues. Other suitable agents for derivatizing α-amino-containing residues include imidoesters such as methyl picolinimidate, pyridoxal phosphate, pyridoxal, chloroborohydrides, trinitrobenzenesulfonic acid, O-methylisourea, 2,4-pentanedione, and aminotransferase-catalyzed reactions with glyoxylic acid.

[0096] Arginyl residues are modified by reaction with one or more conventional reagents, among them phenylglyoxal, 2,3-butanedione, 1,2-cyclohexanedione, and ninhydrin. Derivatization of arginine residues requires that the reaction be performed under alkaline conditions because of the high pKa of the guanidine functional group. Furthermore, these reagents may react with lysine groups and the arginine epsilon-amino group.

[0097] The specific modification of tyrosyl residues, where there is particular interest in introducing spectral labels into tyrosyl residues, may be made by reaction with aromatic diozonium compounds or tetranitromethane. Most commonly, N-acetylimidazole and tetranitromethane are used to form O-acetyltyrosyl species and 3-nitro derivatives, respectively. Tyrosyl residues are iodinated with 125I or 131I to prepare labeled proteins for use in radioimmunoassay, the chloramine T method (described above as suitable).

[0098] Carboxyl side groups (aspartyl or glutamyl) are selectively modified by reaction with carbodiimides (R'-N=C=N-R'), where R and R' are optionally different alkyl groups, such as 1-cyclohexyl-3-(2-morpholinyl-4-ethyl)carbodiimide and 1-ethyl-3-(4-azonia-4,4-dimethylpentyl)carbodiimide. Further, aspartyl and glutamyl residues are converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.

[0099] Derivatization with bifunctional agents is useful for crosslinking antibodies to water-insoluble support matrices or surfaces, for use in a variety of methods in addition to those described below. Commonly used crosslinking agents include, for example, 1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, such as esters with 4-azidosalicylic acid, homobifunctional imidoesters (including disuccinimidyl esters such as 3,3'-dithiobis(succinimidyl propionate)), and bifunctional maleimides (such as bis-N-maleimido-1,8-octane). Derivatization agents such as methyl-3-[(p-azidophenyl)dithio]propioimidate produce photoactivatable intermediates that can form crosslinks in the presence of light. Alternatively, reactive water-insoluble matrices and reactive substrates such as cynomolgusogen bromide-activated carbohydrates (as described in U.S. Patent Nos. 3,969,287; 3,691,016; 4,195,128; 4,247,642; 4,229,537; and 4,330,440, all of which are incorporated by reference) are used for protein immobilization.

[0100] Glutaminyl and asparaginyl residues are frequently deamidated to the corresponding glutamyl and aspartyl residues, respectively. Alternatively, these residues are deamidated under mildly acidic conditions. Both forms of these residues are within the scope of this invention.

[0101] Other modifications include hydroxylation of proline and lysine, phosphorylation of the hydroxyl group of seryl or threonyl residues, methylation of the α-amino groups of lysine, arginine, and histidine side chains (Tecreighton, Proteins: Structure and Molecular Properties, W.H. Freeman & Co., San Francisco, pp. 79-86

[1983] , incorporated by reference in its entirety), acetylation of N-terminal amines, and amidation of C-terminal carboxyl groups.

[0102] Additionally, as will be appreciated by those skilled in the art, labels (including fluorescent, enzymatic, magnetic, radioactive, etc.) can all be added to antibodies (and other compositions of the invention).

[0103] The present invention provides numerous antibodies, each with a specific set of CDRs (including some amino acid substitutions, as outlined above). As outlined above, antibodies can be defined by a set of six CDRs, a variable region, or full-length heavy and light chains (including constant regions). Furthermore, amino acid substitutions can be made, as outlined above. Generally, in the context of changes within a CDR, amino acid modifications are typically described in terms of the number of amino acid modifications that can be made due to the relatively short length of the CDRs. While this also applies to discussing the number of amino acid modifications that can be introduced into a variable, constant, or full-length sequence, it is also appropriate to define these changes in terms of "% identity" in addition to the number of changes. Thus, as described herein, antibodies encompassed within the present invention are 80, 85, 90, 95, 98, or 99% identical to the sequences set forth in the SEQ ID NOs listed herein.

[0104] The present invention further provides methods for producing any antibody selected from the group of antibodies of the present invention. These methods include culturing host cells containing one or more isolated nucleic acids encoding an antibody of the present invention. As will be understood by those skilled in the art, this can be performed in a variety of ways depending on the characteristics of the antibody. In some embodiments, when the antibody of the present invention is a full-length conventional antibody, e.g., a heavy chain variable region and a light chain variable region, the method is performed under conditions that allow the antibody to be produced and isolated.

[0105] Generally, nucleic acids encoding the antibodies of the present invention are provided. Such polynucleotides encode both the variable and constant regions of the heavy and light chains, respectively, although other combinations are contemplated by the present invention in accordance with the compositions described herein. The present invention also contemplates oligonucleotide fragments derived from the disclosed polynucleotides and nucleic acid sequences complementary to these polynucleotides.

[0106] Polynucleotides may be in the form of RNA or DNA. Polynucleotides in the form of DNA, cDNA, genomic DNA, nucleic acid analogs, and synthetic DNA are within the scope of the present invention. The DNA may be double-stranded or single-stranded, and if single-stranded, may be the coding (sense) strand or non-coding (antisense) strand. The coding sequence encoding a polypeptide may be identical to the coding sequence provided herein, or it may be a different coding sequence that, as a result of redundancy or degeneracy in the genetic code, encodes the same polypeptide as the DNA provided herein.

[0107] In some embodiments, one or more nucleic acids encoding an antibody of the present invention are incorporated into an expression vector, which can be designed to be extrachromosomal or integrated into the genome of the host cell into which it is introduced. Expression vectors can contain any number of appropriate regulatory sequences (including, but not limited to, transcriptional and translational regulatory sequences, promoters, ribosomal binding sites, enhancers, origins of replication, etc.) or other elements (such as selection genes), all operably linked as is well known in the art. In some cases, two nucleic acids can be used, each in a different expression vector (e.g., the heavy chain in a first expression vector and the light chain in a second expression vector) or in the same expression vector. It will be understood by those skilled in the art that the design of one or more expression vectors, including the selection of regulatory sequences, can depend on factors such as the choice of host cell and the desired level of protein expression.

[0108] Generally, nucleic acids and / or expression vectors are introduced into a suitable host cell such that one or more nucleic acids are operably linked to one or more expression control elements (e.g., in a vector, in a construct produced by a cellular process, integrated into the genome of the host cell) using any method appropriate for the host cell selected (e.g., transformation, transfection, electroporation, infection, etc.) to produce a recombinant host cell. The resulting recombinant host cell can be maintained under conditions appropriate for expression (e.g., in the presence of an inducer, in a suitable non-human animal, in media supplemented with appropriate salts, growth factors, antibiotics, nutritional supplements, etc.), thereby producing one or more encoded polypeptides. In some cases, the heavy chain is produced in one cell and the light chain is produced in another cell.

[0109] Mammalian cell lines available as hosts for expression are known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC), Manassas, VA, including, but not limited to, Chinese hamster ovary (CHO) cells, HEK 293 cells, NSO cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), and numerous other cell lines. Non-mammalian cells, including, but not limited to, bacteria, yeast, insects, and plants, can also be used to express recombinant antibodies. In some embodiments, antibodies can be produced in transgenic animals, such as cows and chickens.

[0110] General methods of antibody molecular biology, expression, purification and screening are described, for example, in Antibody Engineering, edited by Kontermann & Dubel, Springer, Heidelberg, 2001 and 2010; Hayhurst & Georgiou, 2001, Curr Opin Chem Biol 5:683-689; Maynard & Georgiou, 2000, Annu Rev Biomed Eng 2:339-76; and Morrison, S. (1985) Science 229:1202.

[0111] The present invention also provides an immunochromatography kit for detecting cholera toxin, comprising any one antibody or combination of antibodies selected from the antibody group of the present invention. One embodiment of this kit comprises a detection section, on a matrix made of a porous material such as a nitrocellulose membrane, where a capture antibody is immobilized linearly, and a labeled reagent zone, upstream of the detection section, where a labeled detection antibody (labeled antibody) is carried. Typically, the labeled reagent zone is composed of a porous pad carrying the labeled detection antibody. A developer tank containing a developer solution is provided at the upstream end of the matrix. Furthermore, typically, downstream of the detection zone, a development confirmation section, on which an anti-labeled antibody is immobilized linearly to confirm the development of the labeled antibody, and further downstream of that, a developer absorption section, equipped with a porous absorbent pad for absorbing the developer solution, is provided. Furthermore, if the label is an enzyme label, a substrate zone carrying a substrate for the labeling enzyme is provided upstream of the labeled reagent zone.

[0112] During use, a sample is added to the labeled reagent zone, and the developer pad is inserted into the developer tank by applying pressure to the pusher and moving the protrusion, and developer is supplied to the matrix through the developer pad. As the developer passes through the substrate zone, the substrate is dissolved into the developer, causing the developer containing the substrate to flow. As the developer passes through the labeled reagent zone, the labeled antibody and sample are dissolved into the developer, causing the developer containing the substrate, labeled antibody, and sample to flow. If the sample contains CTX, the CTX and labeled antibody bind via an antigen-antibody reaction. When they reach the detection zone, the immobilized antibody and CTX bind via an antigen-antibody reaction in the detection zone. As a result, the labeled antibody is immobilized in the detection zone via the CTX. CTX is detected by measuring the label in the detection zone. If the sample does not contain CTX, the labeled antibody does not immobilize in the detection zone and moves further downstream, resulting in no label being detected in the detection zone. In addition, since the anti-labeled antibody is immobilized in the developer confirmation section downstream of the detection zone, the labeled antibody is fixed to the developer confirmation section. Therefore, if the label is detected in the developer confirmation section, it means that the developer has been properly developed. The developer is finally absorbed by the absorbent pad downstream.

[0113] The present invention also provides a kit for use in the method of the present invention, which comprises at least the monoclonal antibody of the present invention or a combination thereof.

[0114] When using a method that uses the sandwich method as the detection principle, at least one of the immobilized antigen capture antibody and the detection antibody, preferably both, is the monoclonal antibody of the present invention. Furthermore, standard specimen reagents (various concentrations), control reagents, sample dilutions, dilution cartridges, washing solutions, etc. can be combined. When an enzyme label is used, a substrate or reaction stop solution necessary for detecting the label can be included. When the detection antibody is not labeled, for example, a labeled substance that binds to the detection antibody can be included in the kit.

[0115] When immunochromatography is used as the sandwich method, the kit can include a device equipped with a membrane carrier on which an antigen-capturing antibody is immobilized in the detection zone and a pad carrying a labeled detection antibody. The device can also include other components suitable for immunochromatography, such as a developer pad and an absorbent pad.

[0116] The kit of the present invention may further include instructions for use of the kit. [Example]

[0117] The present invention will be described in more detail below based on examples, but the present invention is not limited to the following examples.

[0118] 1. Antibody Production The following media were used: FBS(-) medium: DMEM (Nacalai) 500 mL, 100 mM sodium pyruvate 5 mL, MEM non-essential amino acid solution (NEAA) (Nacalai) 5 mL, 2-mercaptoethanol 0.5 mL, penicillin-streptomycin mixed solution (Nacalai) 5 mL FBS(+) medium: FBS(-) medium supplemented with 10% FBS (Invitrogen); HAT medium: 250 mL of FBS(+) medium, 5 mL of HAT (×50 conc. MP Bio), 10 ng / mL of IL-6 (PeproTech recombinant mouse IL-6); HT D-MEM medium: 500 mL of DMEM (Nacalai, high glucose), 5 mL of 100 mM sodium pyruvate, 5 mL of MEM non-essential amino acid solution (NEAA) (Nacalai), 0.5 mL of 2-mercaptoethanol, 50 mL of FBS (Invitrogen), 5 mL of IL-6 or BM Condimed H, 5 mL of HT (x50 conc. MP Bio), 5 mL of penicillin-streptomycin mixed solution (Nacalai) HyColne LM, ADCF Mab: HyColne LM ADCF MAb 1000 mL, penicillin-streptomycin mixed solution (Nacalai) 10.1 mL (100x)

[0119] 1-1.Cell fusion BALB / c mice were immunized twice, two weeks apart, with an antigen solution containing cholera toxin B subunit CTxB mixed with Sigma Adjuvant system in the footpad (Figure 1). Lymph nodes and spleens were harvested from the mice and added to FBS(+) medium. The tissues were placed in a 5-cm-diameter Petri dish containing 5 mL of FBS(+) medium. After removing any attached fat, splenocytes or lymph node cells were strained using a 100 μm cell strainer and a disposable syringe plunger. Splenocytes or lymph node cells were mixed with mouse myeloma cells P3U1, and the fused cells were diluted in HAT medium and seeded at 200 μL per well in a 96-well plate. The cells were cultured at 37°C in 10% CO2, with 100 μL of HAT medium replaced every 2–3 days, until colonies appeared and proliferated. Ten hybridomas were obtained. The 10 hybridomas were designated as 2G6, 3C3, 3F3, 3F7, 4E6, 5F2, 8A5, 8B3, 10B8, and 19F5, and the antibodies obtained from each hybridoma were designated as well. The scheme is shown in Figure 1.

[0120] 1-2. Primary screening (ELISA) The antigen, CTxB, was diluted with PBS, and lyophilized mouse intestinal bacteria (negative control) was dissolved in carbonate-bicarbonate buffer (killed mouse intestinal bacteria: 1.0 mg / mL, CTxB: 5.0 μg / mL). The antigen and killed mouse intestinal bacteria were added to a 96-well plate at 100 μL per well and allowed to stand overnight at 4°C for immobilization. 170 μL of 1% BSA-PBS was added to each well and allowed to stand at room temperature for 2 hours for blocking. The plate was then washed three times with 250 μL of PBS-T. 50 μL of each hybridoma culture supernatant was added to each well and allowed to stand at room temperature for 2 hours, after which the plate was washed three times with 250 μL of PBS-T. Next, 100 μL / well of anti-mouse IgG (whole molecule)-HRP (1031-05, Southern Biotech) diluted in 1% BSA-PBS-T was added, incubated at 37°C for 1 hour, and washed three times with 250 μL PBS-T. Then, 100 μL / well of TMB (KPL 50-76-03 TMB Microwell Peroxidase Substrate System) was added. After exactly 2 minutes at room temperature, 50 μL / well of 0.5 N HCl was added, and the absorbance at 450 nm was measured using a spectrophotometer. The results are shown in Figure 2. For each hybridoma, the left bar indicates the absorbance of CTxB, and the right bar indicates the absorbance of killed enterobacterial cells. Five antibodies, 2G6, 3F7, 4E6, 5F2, and 8A5, showed extremely high reactivity with CTxB compared to killed enterobacterial cells, with 19F5 being the second most positive.

[0121] 1-3. Cloning (limiting dilution method) Six hybridoma lines were cloned by limiting dilution, diluted in HAT medium to 0.5, 1, or 2 cells / 200 μL / well, and seeded into 96-well plates. The supernatant (100 μL / well) was used for screening (ELISA). If a single colony was found in a positive well, the culture was scaled up in HT medium to prepare a frozen stock. Large-scale antibody preparations were made from the culture supernatant or mouse ascites fluid as needed. If a single colony was not found, the cloning was repeated.

[0122] 1-4. Monoclonal antibody purification HT D-MEM medium was warmed to 37°C in an incubator, and the frozen hybridomas were thawed in the incubator at 37°C. The thawed hybridomas were added to 10 mL of HT D-MEM medium. After centrifugation (1,200 rpm, 3 minutes), the supernatant was removed, and the pellet was loosened and suspended in 10 mL of HT D-MEM medium. The cell suspension was added to a 10 cm cell dish and cultured at 37°C. After confirming hybridoma growth, the cells were suspended and added to a flask containing 10 mL of HT D-MEM medium and cultured at 37°C. After confirming hybridoma growth, the cells were suspended and added to a flask containing 40 mL of HT D-MEM medium and cultured at 37°C. After confirming hybridoma growth, the supernatant was removed, the cells were washed twice with 15 mL of PBS, and then 50 mL of ADCF MAb was added and cultured at 37°C. After 2 days of culture, the supernatant was collected, 50 mL of ADCF MAb was added, and the cells were cultured at 37°C. The collected supernatant was stored at 4°C.

[0123] The culture medium was centrifuged (1,200 rpm, 5 minutes) to collect the supernatant, which was then filtered through a 0.45 μm filter. The antibody was purified and isolated by affinity chromatography using Protein G Sepharose. The absorbance (A280) of the purified antibody elution fraction was measured using an ultra-microspectrophotometer (NanoDrop™ Lite, Thermo Fisher Scientific). The pooled collected fractions were added to an Amicon Ultra-15 30K (UFC903024, Merck), and 4–5 mL of PBS was added. After concentration and centrifugation, the absorbance (A280) was measured in the same manner, and the concentration was calculated.

[0124] 1-5. Purified antibody reactivity confirmation test (ELISA) CTxB and CTx were dissolved in carbonate-bicarbonate buffer and adjusted to the desired concentrations (CTxB: 0.1 and 1.0 μg / mL, CTx: 0.1 and 1.0 μg / mL). Each antigen solution was added to a 96-well plate at 100 μL per well and incubated overnight at 4°C for immobilization. The solution was discarded, and 170 μL of 1% BSA-PBS was added to the 96-well plate at 170 μL per well. The plate was then incubated at room temperature for 2 hours for blocking. After washing with PBS-T, 50 μL of hybridoma culture supernatant was added per well and incubated at room temperature for 2 hours, followed by washing with PBS-T. Anti-mouse IgG (whole molecule)-HRP (1031-05, Southern Biotech) diluted in 1% BSA-PBS-T was added at 100 μL per well and incubated at 37°C for 1 hour, followed by washing with PBS-T. TMB (KPL 50-76-03 TMB Microwell Peroxidase Substrate System) was added at 100 μL per well. After exactly 2 minutes at room temperature, 50 μL per well of 0.5 N HCl was added, and the absorbance at 450 nm was measured using a spectrophotometer. The results are shown in Figure 3 (CTxB) and Figure 4 (CTx). For each antibody, the left bar represents the absorbance at 1.0 μg / mL, and the right bar represents the absorbance at 0.1 μg / mL. All antibodies showed high reactivity with CTxB at high concentrations, but their reactivity decreased overall at lower concentrations. 19F5 in particular showed almost no reactivity with CTxB at low concentrations. Furthermore, the low reactivity of 19F5 with CTx was particularly notable.

[0125] 1-6. Cross-reactivity test (ELISA) The following heat-killed bacterial cells were prepared (60°C, 60 minutes) and freeze-dried. C.jejuni, P.aeruginosa, S.liquefaciens, E.coli DH5α, S.Enteritidis, B.vulgatus, L.gasseri, P.mirabilis, C.freundii, E.freundii, K.pneumoniae, K.aerogenes, E.cloacae, E.faecalis Antigens and freeze-dried heat-killed bacterial cells were dissolved and adjusted to a concentration in carbonate-bicarbonate buffer (CTxB: 1.0 μg / mL, CTx: 1.0 μg / mL, various killed bacterial cells: 1.0 mg / mL). 100 μL of each solution was added to a 96-well plate and allowed to stand overnight at 4°C for immobilization. The solution was discarded, and 170 μL of 1% BSA-PBS was added to the 96-well plate at 170 μL / well. The plate was then allowed to stand at room temperature for 2 hours for blocking. After washing with PBS-T, 50 μL of hybridoma culture supernatant was added to the plate and allowed to stand at room temperature for 2 hours, followed by washing with PBS-T. 100 μL of anti-mouse IgG (whole molecule)-HRP (1031-05, Southern Biotech) diluted in 1% BSA-PBS-T was added to the plate and allowed to stand at 37°C for 1 hour, followed by washing with PBS-T. TMB (KPL 50-76-03 TMB Microwell Peroxidase Substrate System) was added at 100 μL per well, and after exactly 2 minutes at room temperature, 0.5N HCl was added at 50 μL per well. The absorbance at 450 nm was measured using a spectrophotometer. Reactivity was observed with the antigens CTxB and CTx, but not with any of the above bacterial cells.

[0126] Sandwich ELISA A sandwich ELISA test for detecting CTxB was performed using various combinations of the six positive antibodies (2G6, 3F7, 4E6, 5F2, 8A5, and 19F5) obtained in sections 1-4 above. First, the antibodies were labeled. The modifier solution in the HRP Conjugation Kit (Abcam AB102890-300) was added to a monoclonal antibody (>1 mg / mL F) solution and mixed (1 μL modifier / 10 μL antibody). The monoclonal antibody with the modifier solution added was then added to the HRP mix and mixed. The antibody-HRP mixed solution was incubated in the dark at 20-25°C for 3 hours to overnight for reaction. Quencher solution was added, and the mixture was incubated in the dark at 20-25°C for 30 minutes (1 μL quencher / 10 μL antibody).

[0127] Next, the capture antibody was immobilized, and the reaction of the labeled antibody was examined. The monoclonal antibody was prepared at a concentration of 2.0 μg / mL in carbonate-bicarbonate buffer. 100 μL / well of the solution was added to a 96-well plate and incubated overnight at 4°C. The plate was washed three times with 300 μL of PBS-T, after which the capture antibody solution was removed. 200 μL / well of 1% BSA-PBS was added to the 96-well plate and incubated for 2 hours at room temperature or overnight at 4°C. 100 μL / well of a solution of the antigen CTxB (0.1 μg / mL) diluted with 1% BSA-PBST was added, and the reaction was allowed to proceed at 37°C for 90 minutes. After removing the solution, the plate was washed three times with 300 μL of PBS-T. 100 μL / well of a 0.5 μg / mL HRP-labeled labeled antibody solution diluted with 1% BSA-PBST was added, and the reaction was allowed to proceed at room temperature for 2 hours. After removing the solution, the plate was washed three times with 300 μL of PBS-T. 100 μL of TMB was added to each well, and after exactly 2 minutes at room temperature, 50 μL of 0.5 N HCl was added to each well. The absorbance at 450 nm was measured using a spectrophotometer.

[0128] When 5F2-HRP and 19F5-HRP were used as the labeled antibody, the antigen was not detectable, regardless of the immobilized antibody. Furthermore, when 5F2 was used as the immobilized antibody or the negative control, the antigen was not detectable at all, regardless of the labeled antibody. When 19F5 was used as the immobilized antibody, the antigen was detectable when 3F7-HRP or 8A5-HRP was used as the labeled antibody, but not when other labeled antibodies were used. Among 2G6, 3F7, 4E6, and 8A5, the antigen was detectable in all combinations, even when the labeled and immobilized antibodies were the same antibody.

[0129] 2. Antibody affinity analysis Antibody affinity was measured by surface plasmon resonance using a Biacore T200 (Cytiva). Anti-mouse IgG antibodies were immobilized on a CM5 chip using a Mouse Antibody Capture Kit (Cytiva), and various anti-CTx monoclonal antibodies were captured. A running buffer containing CTxB (0.1 M HEPES, 1.5 M NaCl, 30 mM EDTA, 0.5% v / v Surfactant P 20) was added at a flow rate of 30 μL / min (association phase), and the running buffer was then passed over the sensor chip (dissociation phase). The association rate constant (Ka), dissociation rate constant (Kd), and equilibrium dissociation constant (KD) were calculated using BIAEvaluation 3.1. The results are shown in Figure 5. All four antibodies, 2G6, 3F7, 4E6, and 8A5, exhibited extremely low KD.

[0130] 3. Immunochromatography 3-1. Preparation of immunochromatography kit Four antibodies, 2G6, 3F7, 4E6, and 8A5, were prepared to the determined concentrations for the coating protein amounts. KH2PO4 at the optimal pH was dispensed, and a 40 nm diameter colloidal gold solution (BB International) was added, stirred, and allowed to stand. 1% PEG20,000 and 10% BSA were added, followed by centrifugation, removal of the supernatant, and ultrasonic dispersion of the precipitate. Gold colloid storage buffer was added, and the centrifugation process was repeated to obtain an antibody-sensitized colloidal gold solution.

[0131] Four antibodies, 2G6, 3F7, 4E6, and 8A5, were prepared for use in the test line and each was applied to a nitrocellulose membrane (150CNPH-N-SS40). After application, the membrane was heat-dried at 50°C for 30 minutes. After drying, blocking and stabilization treatments were performed and the membrane was dried again to obtain an antibody-immobilized membrane. Next, the antibody-sensitized gold colloid solution, DW, and gold colloid application buffer were mixed in a 1:1:2 ratio. The mixture was evenly applied to a Glass Fiber Diagnostic Pad (MILLIPORE) and dried under reduced pressure in a desiccator to obtain a conjugate pad.

[0132] 100 μL each of water alone or CTxB 0.1, 1, 10, and 100 ng / mL aqueous solutions was dropped onto the prototype (full strip), and the color development of the line was confirmed after approximately 20 minutes. The results are shown in Figure 6. For all full strips, clear color development was confirmed at 10 to 100 ng / mL, and slight color development was also confirmed at 1 ng / mL.

[0133] 3-2. Validation of immunochromatography using CTxB and LTB CTxB and Escherichia coli heat-labile enterotoxin B subunit (LTB) were each suspended in 1% NP40-PBS at 10 ng / mL, and 100 μL of each was added to the full strips obtained in the immunochromatography kit preparation described above. After approximately 20 minutes, the color developed. The results are shown in Figure 7. CTxB was detected in both full strips, but LTB was not.

[0134] 3-3. Verification of the developing solution CTxB, CTx, and LTB were prepared and suspended in 1% NP40-PBS developer solution at various concentrations, and 100 μL of each was applied to the immunochromatographic reagent (colloidal gold: 8A5, test line: 8A5) and analyzed after 20 minutes. The results are shown in Figure 8. Furthermore, healthy human feces were suspended in 1% NP40-PBS, and 100 μL of each quasi-sample was prepared by suspending CTxB, CTx, and LTB at various concentrations. 100 μL of each quasi-sample was applied to the immunochromatographic reagent (colloidal gold: 8A5, test line: 8A5) and analyzed after 20 minutes. The results are shown in Figure 9. Bands were observed in both the test line and the control, indicating that the analysis was successful.

[0135] 3-3. Immunochromatographic reagent cross-reactivity test The following bacteria were cultured at a McFarland concentration of 0.5 (approximately 1.0 x 10) in 1% NP40-PBS. 8cfu / mL), and 100 μL was applied to the immunochromatography reagent (colloidal gold: 8A5, test line: 8A5). After 20 minutes, the results were analyzed to verify cross-reactivity. The immunochromatography reagent (colloidal gold: 8A5, test line: 8A5) showed no cross-reactivity with any of the bacteria. C. jejuni, C. coli, S. typhimurium, C. difficile, P. mirabilis, P. aeruginosa B. cereus, C. freundii, S. aureus, K. pneumonia, K. aerogenes, S. liquefaciens, E. cloacae, E. faecalis, E hermannii, S. epidermidis, E coli O114, C tetani

[0136] 4. Amino acid and gene sequence analysis Various hybridomas (10 6 After RNA was extracted from the cells, cDNA was synthesized. Using the cDNA as a template, VH and VL were amplified and cloned using degenerate primers, and the VH and VL gene sequences were analyzed. The results are shown in the sequence tables.

Claims

1. A method for detecting cholera toxin in a sample by immunochromatography, characterized in that two identical or different antibodies selected from the following group are used as a labeled antibody and a capture antibody, respectively: 1) an antibody having at least the amino acid sequence of SEQ ID NO: 9 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 12 as the VL CDR3 region; 2) an antibody having at least the amino acid sequence of SEQ ID NO: 19 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 22 as the VL CDR3 region; 3) an antibody having at least the amino acid sequence of SEQ ID NO: 29 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 32 as the VL CDR3 region; 4) an antibody having at least the amino acid sequence of SEQ ID NO: 39 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 42 as the VL CDR3 region; 5) An antibody having one or two amino acid mutations in each of the VH CDR3 region and / or VL CDR3 region of the antibody of 1) to 4) above.

2. The method of claim 1, wherein the antibody is an isolated antibody.

3. The method of claim 1 or 2, wherein the antibody is a monoclonal antibody.

4. The antibody reacted with cholera toxin at a concentration of 5.0 x 10 -9 The method according to any one of claims 1 to 3, characterized in that the compound has an equilibrium dissociation constant KD of M or less.

5. The antibody reacted with cholera toxin at a concentration of 5.0 x 10 -10 5. The method of claim 4, wherein the compound has an equilibrium dissociation constant KD of M or less.

6. The method according to any one of claims 1 to 5, wherein the amino acid mutation in the antibody of 5) above is a substitution.

7. 7. The method of claim 6, wherein the substitution is a conservative amino acid substitution.

8. The method according to any one of claims 1 to 7, wherein the antibody further has the following characteristics: 1) an antibody having at least the amino acid sequence of SEQ ID NO: 7 as a VH CDR1 region, the amino acid sequence of SEQ ID NO: 8 as a VH CDR2 region, the amino acid sequence of SEQ ID NO: 9 as a VH CDR3 region, the amino acid sequence of SEQ ID NO: 10 as a VL CDR1 region, the amino acid sequence of SEQ ID NO: 11 as a VL CDR2 region, and the amino acid sequence of SEQ ID NO: 12 as a VL CDR3 region; 2) an antibody having at least the amino acid sequence of SEQ ID NO: 17 as a VH CDR1 region, the amino acid sequence of SEQ ID NO: 18 as a VH CDR2 region, the amino acid sequence of SEQ ID NO: 19 as a VH CDR3 region, the amino acid sequence of SEQ ID NO: 20 as a VL CDR1 region, the amino acid sequence of SEQ ID NO: 21 as a VL CDR2 region, and the amino acid sequence of SEQ ID NO: 22 as a VL CDR3 region; 3) an antibody having at least the amino acid sequence of SEQ ID NO: 27 as a VH CDR1 region, the amino acid sequence of SEQ ID NO: 28 as a VH CDR2 region, the amino acid sequence of SEQ ID NO: 29 as a VH CDR3 region, the amino acid sequence of SEQ ID NO: 30 as a VL CDR1 region, the amino acid sequence of SEQ ID NO: 31 as a VL CDR2 region, and the amino acid sequence of SEQ ID NO: 32 as a VL CDR3 region; 4) An antibody having at least the amino acid sequence of SEQ ID NO: 37 as the VH CDR1 region, the amino acid sequence of SEQ ID NO: 38 as the VH CDR2 region, the amino acid sequence of SEQ ID NO: 39 as the VH CDR3 region, the amino acid sequence of SEQ ID NO: 40 as the VL CDR1 region, the amino acid sequence of SEQ ID NO: 41 as the VL CDR2 region, and the amino acid sequence of SEQ ID NO: 42 as the VL CDR3 region; 5) An antibody having one or two amino acid mutations in each of the VH CDR1 region, VH CDR2 region, VH CDR3 region, VL CDR1 region, VL CDR2 region and / or VL CDR3 region of the antibody of 1) to 4) above.

9. The method according to any one of claims 1 to 8, wherein the antibody further has the following characteristics: 1) an antibody having the amino acid sequence of SEQ ID NO: 3 as the VH region and the amino acid sequence of SEQ ID NO: 5 as the VL region; 2) an antibody having the amino acid sequence of SEQ ID NO: 13 as the VH region and the amino acid sequence of SEQ ID NO: 15 as the VL region; 3) an antibody having the amino acid sequence of SEQ ID NO: 23 as the VH region and the amino acid sequence of SEQ ID NO: 25 as the VL region; 4) an antibody having the amino acid sequence of SEQ ID NO: 33 as the VH region and the amino acid sequence of SEQ ID NO: 35 as the VL region; 5) An antibody having a sequence identity of 80% or more with the antibodies of 1) to 4) above.

10. The method according to any one of claims 1 to 9, wherein the antibody is the antibody of 4) or a combination of antibodies of 5) derived from the antibody of 4).

11. An antibody for detecting cholera toxin, 1) an antibody having at least the amino acid sequence of SEQ ID NO: 9 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 12 as the VL CDR3 region; 2) an antibody having at least the amino acid sequence of SEQ ID NO: 19 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 22 as the VL CDR3 region; 3) an antibody having at least the amino acid sequence of SEQ ID NO: 29 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 32 as the VL CDR3 region; 4) an antibody having at least the amino acid sequence of SEQ ID NO: 39 as the VH CDR3 region and the amino acid sequence of SEQ ID NO: 42 as the VL CDR3 region; and 5) An antibody having one or two amino acid mutations in each of the VH CDR3 region and / or VL CDR3 region of the antibody of 1) to 4) above. A single antibody or a combination of two or more identical or different antibodies selected from the group consisting of:

12. 12. The antibody or antibody combination of claim 11, wherein said antibody is an isolated antibody.

13. 13. The antibody or antibody combination of claim 11 or 12, wherein said antibody is a monoclonal antibody.

14. The antibody reacted with cholera toxin at a concentration of 5.0 x 10 -9 The antibody or antibody combination according to any one of claims 11 to 13, characterized in that it has an equilibrium dissociation constant KD of less than or equal to M.

15. The antibody reacted with cholera toxin at a concentration of 5.0 x 10 -10 15. The antibody or antibody combination of claim 14, characterized in that it has an equilibrium dissociation constant KD of less than or equal to M.

16. The antibody or antibody combination according to any one of claims 11 to 15, wherein the amino acid mutation in the antibody of 5) above is a substitution.

17. 17. The antibody or antibody combination of claim 16, wherein said substitutions are conservative amino acid substitutions.

18. The antibody or antibody combination according to any one of claims 11 to 17, characterized in that said antibody further has the following characteristics: 1) an antibody having at least the amino acid sequence of SEQ ID NO: 7 as a VH CDR1 region, the amino acid sequence of SEQ ID NO: 8 as a VH CDR2 region, the amino acid sequence of SEQ ID NO: 9 as a VH CDR3 region, the amino acid sequence of SEQ ID NO: 10 as a VL CDR1 region, the amino acid sequence of SEQ ID NO: 11 as a VL CDR2 region, and the amino acid sequence of SEQ ID NO: 12 as a VL CDR3 region; 2) an antibody having at least the amino acid sequence of SEQ ID NO: 17 as a VH CDR1 region, the amino acid sequence of SEQ ID NO: 18 as a VH CDR2 region, the amino acid sequence of SEQ ID NO: 19 as a VH CDR3 region, the amino acid sequence of SEQ ID NO: 20 as a VL CDR1 region, the amino acid sequence of SEQ ID NO: 21 as a VL CDR2 region, and the amino acid sequence of SEQ ID NO: 22 as a VL CDR3 region; 3) an antibody having at least the amino acid sequence of SEQ ID NO: 27 as a VH CDR1 region, the amino acid sequence of SEQ ID NO: 28 as a VH CDR2 region, the amino acid sequence of SEQ ID NO: 29 as a VH CDR3 region, the amino acid sequence of SEQ ID NO: 30 as a VL CDR1 region, the amino acid sequence of SEQ ID NO: 31 as a VL CDR2 region, and the amino acid sequence of SEQ ID NO: 32 as a VL CDR3 region; 4) An antibody having at least the amino acid sequence of SEQ ID NO: 37 as the VH CDR1 region, the amino acid sequence of SEQ ID NO: 38 as the VH CDR2 region, the amino acid sequence of SEQ ID NO: 39 as the VH CDR3 region, the amino acid sequence of SEQ ID NO: 40 as the VL CDR1 region, the amino acid sequence of SEQ ID NO: 41 as the VL CDR2 region, and the amino acid sequence of SEQ ID NO: 42 as the VL CDR3 region; 5) An antibody having one or two amino acid mutations in each of the VH CDR1 region, VH CDR2 region, VH CDR3 region, VL CDR1 region, VL CDR2 region and / or VL CDR3 region of the antibody of 1) to 4) above.

19. The antibody or antibody combination according to any one of claims 11 to 18, characterized in that said antibody further has the following characteristics: 1) an antibody having the amino acid sequence of SEQ ID NO: 3 as the VH region and the amino acid sequence of SEQ ID NO: 5 as the VL region; 2) an antibody having the amino acid sequence of SEQ ID NO: 13 as the VH region and the amino acid sequence of SEQ ID NO: 15 as the VL region; 3) an antibody having the amino acid sequence of SEQ ID NO: 23 as the VH region and the amino acid sequence of SEQ ID NO: 25 as the VL region; 4) an antibody having the amino acid sequence of SEQ ID NO: 33 as the VH region and the amino acid sequence of SEQ ID NO: 35 as the VL region; 5) An antibody having a sequence identity of 80% or more with the antibodies of 1) to 4) above.

20. An immunochromatographic kit for detecting cholera toxin, comprising the antibody or combination of antibodies according to any one of claims 11 to 19.

21. The kit of claim 20, wherein the combination of antibodies is a combination of antibodies 4), in which the antibody 4) is sensitized with gold colloid to form a labeled antibody, and the antibody 4) is immobilized linearly on a solid phase to form a capture antibody.

Citation Information

Patent Citations

  • Subunit a and b of DNA arrangement, recombined DNA, cholera toxin and medicine

    JP1983222033A

  • Monoclonal antibody against vibrio cholerae, hybridoma producing same and detection of vibrio cholerae using same

    JP1987265993A

  • Monoclonal antibody against vibrio cholerae, hybridoma producing same and detection of vibrio cholerae using same

    JP1987265994A

  • Endoglycosidase assay

    JP1987265998A

  • Oligonucleotide for detecting microorganism capable of producing vibrio cholerae toxin, method for detecting microorganism capable of producing vibrio cholerae toxin and reagent kit for detection

    JP1993276996A