Triple agonist of GLP-1, GIP, and amylin receptors

Abstract

To provide a more effective medicament which is potent in vitro and potent against weight loss, which at the same time does not result in proportionally increased levels of side effects, which has improved pharmacokinetic properties, which has improved chemical stability, which is suitable for once weekly administration in humans, and / or which is suitable for oral administration.SOLUTION: The present invention relates to a GLP-1- / GIP- / amylin-receptor tri-agonist. This GLP-1- / GIP- / amylin-receptor tri-agonist may have improved pharmacokinetic properties and may be suitable for once weekly administration. The invention also relates to pharmaceutical compositions comprising such a GLP-1- / GIP- / amylin-receptor tri-agonist. The tri-agonist and pharmaceutical compositions comprising it may be used as a medicament for the treatment of subjects with overweight, obesity and associated co-morbidity.SELECTED DRAWING: None

Description

[Technical Field]

[0001] GLP-1 / GIP / amylin receptor triple agonists for use in medicine, and compositions comprising such compounds. [Background technology]

[0002] Overweight and obesity are abnormal or excessive accumulations of body fat that pose a risk to an individual's overall health. The WHO considers body mass index (BMI) to be the most convenient population-level measure of overweight and obesity. In adults, a body mass index (BMI) of 25 or greater is considered overweight, and a BMI of 30 or greater is considered obese. Obesity is further subclassified into Class I (BMI 30-34.9), Class II (BMI 35-39.9), and Class III (BMI > 40).

[0003] Obesity is a major risk factor for numerous serious conditions, including type 2 diabetes and its associated comorbidities, as well as cardiovascular diseases such as heart disease and stroke, and is a leading cause of death worldwide. Obesity is now recognized by the World Health Organization (WHO) as a growing epidemic, even among children. In 2016, 1.9 billion adults worldwide were reported to be obese, and in 2019, 38.3 million children under the age of five worldwide were reported to be obese. According to the WHO, 422 million people worldwide suffer from diabetes, and 1.6 million deaths are directly attributable to diabetes each year. Therefore, there is a strong motivation for individuals and society alike to prevent and / or treat obesity.

[0004] When lifestyle modifications such as diet and exercise alone are not sufficient to reduce the body mass index (BMI) of obese individuals to an acceptable level, treatment with pharmaceuticals such as liraglutide, orlistat, and naltrexone-bupropion has been shown to cause some weight loss.Nevertheless, these weight losses are often not sustained and are too small for individuals with class II and class III obesity.In these cases, bariatric surgery has proven necessary.Although bariatric surgery is currently the most effective treatment in terms of achieving long-term weight loss, it is an invasive procedure that involves high risks and high costs for patients.Therefore, an effective and minimally invasive treatment would be a significant improvement in the treatment of obesity.

[0005] GLP-1 is a 30- or 31-amino acid polypeptide synthesized and secreted from enteroendocrine L cells. GLP-1 is an incretin hormone that reduces blood glucose levels in a glucose-dependent manner by enhancing insulin secretion. Endogenous GLP-1 is rapidly degraded, primarily by dipeptidyl peptidase-4 (DPP-4), resulting in a half-life of <2 minutes.

[0006] Several marketed products containing long-acting GLP-1 receptor agonists as active pharmaceutical ingredients have been approved for the treatment of type 2 diabetes, including dulaglutide (Trulicity®), exenatide (Byetta®, Bydureon®), liraglutide (Victoza®), lixisenatide (Lyxumia®), and semaglutide (Ozempic®).

[0007] Two commercially available products containing GLP-1 receptor agonists as active pharmaceutical ingredients, liraglutide (Saxenda®) and semaglutide (Wegovy®), are approved for use in individuals who are overweight and have at least one weight-related comorbidity, or who are obese. The maximum efficacy achievable with GLP-1 receptor agonists is limited by tolerability. As the dose increases, side effects such as nausea and vomiting become increasingly pronounced.

[0008] Native human GIP is a 42-amino acid polypeptide synthesized in and secreted by specialized enteroendocrine K cells. These cells are primarily concentrated in the duodenum and proximal jejunum, but can also be found throughout the intestine. The primary stimulator of GIP secretion is the ingestion of a carbohydrate- and lipid-rich meal. After ingestion, circulating plasma GIP levels increase 10-20-fold. Like GLP-1, GIP is an incretin hormone and, in healthy humans, appears to be a more potent incretin than GLP-1. However, in individuals living with type 2 diabetes, GIP loses its incretin effect. The half-life of intact GIP is estimated to be approximately 7 minutes in healthy subjects and approximately 5 minutes in those living with type 2 diabetes.

[0009] Long-acting (or sustained-release) GIP analogs have been shown to reduce body weight and improve glycemic control. With regard to weight loss, this effect is relatively less than that of long-acting GLP-1 analogs in rodent models (Non-Patent Document 1). Furthermore, GIP analogs induce weight loss through additive / synergistic interactions with long-acting GLP-1 analogs in dual administration (Non-Patent Document 2, Non-Patent Document 3), and therefore represent suitable candidates for amplifying GLP-1-based pharmacological actions. As shown in preclinical animal models, GIPR agonism can also be included as a partner to GLP-1 receptor agonism as a single-molecule coagonist to amplify GLP-1-driven weight loss and improved glycemic control (Non-Patent Document 4, Non-Patent Document 5). Two different peptides with high potency against both GLP-1R and GIPR (MAR709 and LY3298176, the latter known as tirzepatide) have been tested in multiple-dose clinical trials. Clinical results have demonstrated improvements in glycemic control and body weight that exceed those achieved by comparable administration of benchmark GLP-1 specific agonists (Non-Patent Document 6, Non-Patent Document 7), demonstrating the translational aspects and therapeutic benefits of co-targeting GLP-1 and GIP receptors.

[0010] Recently, this concept of co-targeting the GLP-1 and GIP receptors using GLP-1 / GIP coagonists has been proven, as the compound tirzepatide was approved in 2022 for the treatment of diabetes. Furthermore, tirzepatide is also useful for the treatment of obesity, as a high dose of tirzepatide (15 mg) resulted in a mean loss of 20.9% of patient body weight after 72 weeks of treatment, including a 20-week dose-escalation period (Non-Patent Document 8). Tirzepatide was recently approved (trade name: Zepbound®) for weight management in people with a BMI > 30 or BMI > 27 and at least one weight-related comorbidity.

[0011] Besides tirzepatide, which is described in U.S. Patent No. 5,613,299, GLP-1 / GIP coagonists and their potential medical uses have been described in several patent applications, such as U.S. Patent No. 5,613,299, ... and U.S. Patent No. 5,613,299.

[0012] Amylin is a 37-amino acid polypeptide hormone produced in pancreatic beta (β) cells, where it is co-secreted with insulin. Amylin has a half-life of 15–20 minutes. It acts primarily through amylin receptors 1–3 (AMYR1–3) to produce its effects in several different organ systems. Amylin inhibits glucagon secretion, delays gastric emptying, conveys satiety, and suppresses appetite; it is an important regulator of energy metabolism in health and disease. Other amylin effects have also been reported, including on the cardiovascular system and bone.

[0013] Clinical trials have shown that amylin receptor agonists may be useful in treating overweight, obesity, type 1 diabetes, and / or type 2 diabetes. Currently, one product (Symlin®) containing an amylin receptor agonist (pramlintide acetate) as the active pharmaceutical ingredient is commercially available. Symlin®, a liquid pharmaceutical composition for subcutaneous administration, is approved for use in patients with type 1 or type 2 diabetes who are using basal and prandial insulin and are unable to achieve desired glycemic control despite optimal insulin therapy. Pramlintide has also been investigated for use in people living with overweight and obesity. Pramlintide has a short half-life (less than 1 hour) and requires three doses per day. As a result, there are large diurnal differences in pramlintide plasma levels.

[0014] Amylin receptor agonist therapy is limited by the similar tolerability (and by similar side effects such as nausea and vomiting) as GLP-1 receptor agonist therapy.There is a similar desire to be able to prolong the action of amylin, and the co-targeting of amylin receptor and GLP-1 receptor has also been described.Amylin receptor agonist and their potential medical use are described in some patent applications, such as Patent Document 15, Patent Document 16, Patent Document 17, Patent Document 18 or Patent Document 19.

[0015] A fixed-dose combination of the amylin receptor agonist caglilintide and the GLP-1 receptor agonist semaglutide is currently under investigation for the treatment of overweight and obesity (Non-Patent Document 9). The drug product being investigated is a separate liquid pharmaceutical composition for subcutaneous use. Clinical trials have demonstrated that the combination of caglilintide and semaglutide induced greater weight loss in people living with obesity than the maximum approved dose of semaglutide monotherapy. No worsening of the side effect profile was observed. GLP-1 receptor and amylin receptor coagonists and their potential medical uses have been described in several patent applications, such as Patent Document 20. Therein, a peptide coagonist of the human GLP-1R receptor and amylin receptor is disclosed that is potent and balanced, i.e., has similar levels of activation of both receptor systems, and exhibits oral bioavailability. Another example is Patent Document 21, which describes a hybrid polypeptide comprising exendin covalently linked to amylin. However, no GLP-1 and amylin receptor coagonists have received market approval to date.

[0016] Finally, Patent Documents 22 and 23 disclose multi-agonist peptides useful as drugs for the treatment and prevention of metabolic diseases and disorders, particularly diabetes and obesity. Patent Document 22 discloses peptides containing two or more component peptides, including amylin, GIP, GLP-1, and / or calcitonin. The specifically disclosed peptides are triple agonists of the GLP-1 receptor, the GIP receptor, and the amylin receptor, which exhibit activity against all three receptors and reduce food intake and body weight in animals.

[0017] While current therapeutic options and investigational agents offer promise, individuals living with overweight, obesity, and / or related comorbidities may currently hope to be treated with injectable pharmaceutical formulations or medicaments that, at best, have some degree of efficacy. There remains a need in the art for more effective medicaments that are potent in vitro and effective for weight loss, while not producing proportionately increased levels of side effects, have improved pharmacokinetic properties, have improved chemical stability, are suitable for once-weekly administration in humans, and / or are suitable for oral administration. [Prior art documents] [Patent documents]

[0018] [Patent Document 1] International Publication No. 2016 / 111971A1 [Patent Document 2] International Publication No. 2006 / 086769 [Patent Document 3] International Publication No. 2010 / 011439 [Patent Document 4] International Publication No. 2013 / 164483 [Patent Document 5] International Publication No. 2014 / 192284 [Patent Document 6] International Publication No. 2015 / 067715 [Patent Document 7] International Publication No. 2015 / 022420 [Patent Document 8] International Publication No. 2015 / 086728 [Patent Document 9] International Publication No. 2015 / 086729 [Patent Document 10] International Publication No. 2016 / 111971 [Patent Document 11] International Publication No. 2020 / 023386 [Patent Document 12] U.S. Patent Publication No. 2014 / 162945 [Patent Document 13] U.S. Patent Publication No. 2014 / 357552 [Patent Document 14] International Publication No. 2022 / 018186 [Patent Document 15] International Publication No. 2012 / 168432 [Patent Document 16] U.S. Patent Publication No. 2016 / 034604 [Patent Document 17] International Publication No. 2022 / 129254 [Patent Document 18] International Publication No. 2022 / 063925 [Patent Document 19] U.S. Patent Publication No. 2022 / 0288168 [Patent Document 20] International Publication No. 2022 / 129526A1 [Patent Document 21] International Publication No. 2007 / 022123 [Patent Document 22] International Publication No. 2023 / 288313 [Patent Document 23] International Publication No. 2024 / 015922 [Non-patent literature]

[0019] [Non-Patent Document 1] Mroz et al,Mol Metab,2019,20:51-62 [Non-patent document 2] Finan et al,Sci Transl Med,2013,5(209):209ra151 [Non-patent document 3] Norregaard et al, Diabetes Obes Metab, 2018, 20(1): 60-68 [Non-patent document 4] Finan et al,Sci Transl Med,2013,5(209):209ra151 [Non-patent document 5] Coskun et al,Mol Metab,2018,18:3-14 [Non-patent document 6] Frias et al,Cell Metab,2017,26(2):343-352 [Non-Patent Document 7] Frias et al, Lancet, 2018, 392(10160):2180-2193 [Non-patent document 8] AM Jastreboff, LJ Aronne, NN Ahmad, et al., N Engl J Med 2022;387:205-216 [Non-Patent Document 9] Lancet 2021;397:1736-48 Summary of the Invention

[0020] The present invention provides GLP-1 / GIP / amylin receptor triple agonists, comprising a peptide according to formula I, which contains one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, L1 is a peptide linker, Z2 is a C-terminal amide and a group of formula III (SEQ ID NO: 2): This invention relates to GLP-1 / GIP / amylin receptor triple agonists, which are peptides containing up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III).

[0021] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula X (SEQ ID NO: 161): X 21 X 22 X 23 GTFTSDYSX 24 LLEEX 25 AAX 26 EFIX 27 WLX 28 X 29 GGPSX 30 X 31 (X) (In the formula, X 21 represents His (H) or Tyr (Y), X 22 represents Aib, X 23 represents Glu(E) or His(H), X 24 represents Ile (I) or Lys (K), X 25 represents Gln(Q) or Ile(I), X 26 represents Arg(R) or Gln(Q), X 27 represents Ala (A), Glu (E), or Gln (Q); X 28represents Leu (L) or I (Ile), X 29 represents Ala (A) or Gln (Q), X 30 represents Arg (R), Gly (G), Lys (K), or Ser (S); X 31 represents Gly (G), Glu (E), or Lys (K), L1 is a peptide linker, Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XII (SEQ ID NO: 164): AX 32 X 33 LSTAX 34 X 35 X 36 RLSAX 37 LHX 38 LX 39 X 40 X 41 PX 42 TETGSGX 43 P (XII) (In the formula, X 32 represents Gly (G) or Ser (S), X 33 represents Gln(Q), Glu(E), His(H), or Lys(K); X 34 represents Ala (A) or Gln (Q), X 35 represents Gln(Q), Leu(L), or Thr(T), X 36 represents Ala (A), Gly (G), or Gln (Q); X 37 represents Glu(E) or Lys(K), X 38represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 39 represents Ala (A) or Lys (K), X 40 represents Asp (D) or Thr (T), X 41 represents Leu (L) or Glu (E), X 42 represents Arg (R) or Lys (K); X 43 represents Ala (A) or Ser (S)).

[0022] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), Lys (K), or Ser (S); X5 represents Gly (G) or Lys (K), L1 is a peptide linker, Z2 comprises a C-terminal amide, Formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S)).

[0023] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R) or Gln(Q), X 54 represents Ala (A), Glu (E), or Gln (Q); X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A) or Gln (Q), X 57 represents Gly (G) or Glu (E), L1 is a peptide linker, Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64PRTETGSGSP(XIIa) (In the formula, X 58 represents Gly (G) or Ser (S), X 59 represents Gln(Q), Glu(E), or His(H); X 60 represents Ala (A) or Gln (Q), X 61 represents Leu (L) or Thr (T), X 62 represents Ala (A), Gly (G), or Gln (Q); X 63 represents Gln(Q), Glu(E), or Lys(K); X 64 represents Leu (L) or Glu (E)).

[0024] In some embodiments, the GLP-1 / GIP / amylin receptor triple agonist is YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPGASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 62), or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPGASHLSTAQTQRLSAKLHRLATLPRTETGSGSP (SEQ ID NO: 65), or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPLASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 68), or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSRGEASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 78), or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPLASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 87), or HXHGTFTSDYSILLEEQAAREFIEWLLAGGPSKGAPPPSGGGEASHLSTAQTARLSAELHQLATLPRTETGSGSP (SEQ ID NO: 111), or YXEGTFTSDYSILLEEIAAREFIEWLLAGGPSSGAGQAPGQAPGASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 170), where in each amino acid sequence, X represents Aib.

[0025] GLP-1 / GIP / amylin receptor triple agonists have an amino acid sequence according to Formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) (In the formula, X1 represents Ala (A), Glu (E), or Gly (G), X2 represents Gln(Q), Glu(E), Gly(G), Leu(L), Pro(P), or is absent; X3 represents Ala (A), Gln (Q), Glu (E), Gly (G), Pro (P), or is absent; X4 represents Ala (A), Gln (Q), Glu (E), Gly (G), Pro (P), or is absent; X5 represents Glu(E), Gly(G), Pro(P), Ser(S), Thr(T) or is absent; X6 represents Glu(E), Gly(G), Leu(L), Gln(Q), or is absent; X7 represents Ala (A), Gln (Q), Glu (E), Gly (G), Phe (F), or is absent; X8 represents Ala (A), Gln (Q), Glu (E), Gly (G), Thr (T), Pro (P), Val (V), or is absent; X9 represents Glu(E), Asn(N), Pro(P), Thr(T) or is absent; X 10 represents Alal(A), Gln(Q), Glu(E), Gly(G), Leu(L), Pro(P), Ser(S), Val(V), or is absent; X 11 represents Ala (A) or is absent, X 12 represents Gln(Q) or is absent, X 13 represents Thr(T) or is absent, X 14 represents Leu (L) or is absent).

[0026] In some embodiments, the GLP-1 / GIP / amylin receptor triple agonist comprises an extending moiety that allows for an extended half-life.

[0027] Preferred GLP-1 / GIP / amylin receptor triple agonists of the present invention are Compound 52, i.e., [ka] Compound 55, i.e., [ka] Compound 58, i.e., [ka] Compound 68, i.e., [ka] Compound 77, i.e., [ka] Compound 101, i.e., [ka] is.

[0028] In a third aspect, the present invention relates to balanced GLP-1 / GIP / amylin receptor triple agonists that are capable of selectively activating or "agonizing" all three of the GLP-1 receptor, GIP receptor, and amylin receptor to similar levels.

[0029] Also, or alternatively, in a fourth aspect, the present invention relates to GLP-1 / GIP / amylin receptor triple agonists with improved pharmacokinetic properties.

[0030] Also, or alternatively, in a fifth aspect, the present invention relates to a GLP-1 / GIP / amylin receptor triple agonist that is suitable for once-weekly administration.

[0031] Also, or alternatively, in a sixth aspect, the present invention relates to GLP-1 / GIP / amylin receptor triple agonists that are suitable for oral administration.

[0032] Also, or alternatively, in a seventh aspect, the present invention relates to GLP-1 / GIP / amylin receptor triple agonists with improved chemical stability.

[0033] In yet a further aspect, the present invention relates to pharmaceutical compositions comprising such GLP-1 / GIP / amylin receptor triple agonists and one or more pharmaceutically acceptable excipients, as well as to GLP-1 / GIP / amylin receptor triple agonists for use as medicaments, in particular for use in the treatment of subjects with an initial body mass index (BMI) of 27 or greater, such as 30 or greater, optionally in the presence of at least one weight-related comorbidity.

[0034] The present invention may also solve further problems that will become apparent from the disclosure of exemplary embodiments and aspects. [Brief explanation of the drawings]

[0035] [Figure 1]Figure 1 shows the change in body weight (in %) over time in DIO rats compared to vehicle (-●-), Compound 52 at a dose of 3 nmol / kg (-●-), Compound 52 at a dose of 10 nmol / kg (-▼-), Compound 77 at a dose of 3 nmol / kg (-x-), and Compound 77 at a dose of 10 nmol / kg (-▲-). DIO rats received subcutaneous doses once daily according to the titration schedule described in Table 14. [Figure 2] Figure 2 shows daily food intake (in kcal) at baseline (days -4 to 0) and during treatment (days 0 to 28) in the study in DIO rats described in Example 8 comparing vehicle (-●-), Compound 52 at a dose of 3 nmol / kg (-●-), Compound 52 at a dose of 10 nmol / kg (-▼-), Compound 77 at a dose of 3 nmol / kg (-x-), and Compound 77 at a dose of 10 nmol / kg (-▲-). DIO rats received a single subcutaneous dose daily according to the titration schedule described in Table 14. [Figure 3] Figure 3 shows cumulative food intake over time in the study in DIO rats described in Example 8a comparing vehicle (-●-), Compound 52 at a dose of 3 nmol / kg (-●-), Compound 52 at a dose of 10 nmol / kg (-▼-), Compound 77 at a dose of 3 nmol / kg (-x-), and Compound 77 at a dose of 10 nmol / kg (-▲-). DIO rats received subcutaneous doses once daily according to the titration schedule described in Table 14.

[0036] Sequence Listing This application is submitted with an electronic Sequence Listing, the entire contents of which are incorporated herein by reference. SEQ ID NO: 1 represents the amino acid sequence of Formula II of Z1. SEQ ID NO:2 represents the amino acid sequence of Formula III of Z2. SEQ ID NO: 3 represents the amino acid sequence of formula IIa of Z1. SEQ ID NO: 4 represents the amino acid sequence of Formula IIIa of Z2. SEQ ID NO: 5 represents the most comprehensive amino acid sequence of Formula I Z1-L1-Z2. SEQ ID NO: 6 represents the amino acid sequence of Formula V of Z1. SEQ ID NO: 7 represents the amino acid sequence of Formula VI of Z1. SEQ ID NO: 8 represents the amino acid sequence of Formula VII of Z2. SEQ ID NO: 9 represents the amino acid sequence of Formula VIII of Z2. SEQ ID NO: 11 represents the amino acid sequence of the polypeptide backbone within Reference Compound 1. SEQ ID NO: 12 represents the amino acid sequence of the polypeptide backbone within Reference Compound 2. SEQ ID NO: 13 represents the amino acid sequence of the polypeptide backbone within Reference Compound 3. SEQ ID NO: 14 represents the amino acid sequence of the polypeptide backbone within Reference Compound 4. SEQ ID NO: 15 represents the amino acid sequence of the polypeptide backbone within Reference Compound 5 (tirzepatide). SEQ ID NO: 16 represents the amino acid sequence of the polypeptide backbone within Reference Compound 6 (caglilintide). SEQ ID NO: 17 represents the amino acid sequence of the polypeptide backbone within Reference Compound 7 (semaglutide). SEQ ID NOs: 20 to 124 represent the amino acid sequences of the peptide backbones in compounds 10 to 115 and 210. SEQ ID NOs: 125 to 159 represent the amino acid sequences of exemplified peptide linkers L1. SEQ ID NO: 161 represents the amino acid sequence of formula X of Z1. SEQ ID NO: 162 represents the amino acid sequence of formula Xa of Z1. SEQ ID NO: 163 represents the amino acid sequence of Formula XI of Z1. SEQ ID NO: 164 represents the amino acid sequence of Formula XII of Z2. SEQ ID NO: 165 represents the amino acid sequence of Formula XIIa of Z2. SEQ ID NO: 166 represents the amino acid sequence of Formula XIII of Z2. SEQ ID NOs: 170 to 242 represent the amino acid sequences of the peptide backbones in compounds 120 to 197 and 211 to 221. [Table 1-1] [Table 1-2] [Table 1-3] [Table 1-4] [Table 1-5] [Table 1-6] [Table 1-7] [Table 1-8] DETAILED DESCRIPTION OF THE INVENTION

[0037] The present invention provides GLP-1 / GIP / amylin receptor triple agonists, comprising a peptide according to formula I, which contains one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, L1 is a peptide linker, Z2 is a C-terminal amide and a group of formula III (SEQ ID NO: 2): This invention relates to GLP-1 / GIP / amylin receptor triple agonists, which are peptides containing up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III).

[0038] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula X (SEQ ID NO: 161): X 21 X 22 X 23 GTFTSDYSX 24 LLEEX 25 AAX 26 EFIX 27 WLX 28 X 29 GGPSX 30 X 31 (X) (In the formula, X 21 represents His (H) or Tyr (Y), X 22 represents Aib, X 23 represents Glu(E) or His(H), X 24 represents Ile (I) or Lys (K), X 25 represents Gln(Q) or Ile(I), X 26 represents Arg(R) or Gln(Q), X 27 represents Ala (A), Glu (E), or Gln (Q); X 28 represents Leu (L) or I (Ile), X 29 represents Ala (A) or Gln (Q), X 30 represents Arg (R), Gly (G), Lys (K), or Ser (S); X 31 represents Gly (G), Glu (E), or Lys (K), L1 is a peptide linker, Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XII (SEQ ID NO: 164): AX 32 X 33 LSTAX 34 X 35 X 36 RLSAX 37 LHX 38 LX 39 X 40 X 41 PX 42 TETGSGX 43 P (XII) (In the formula, X 32 represents Gly (G) or Ser (S), X 33 represents Gln(Q), Glu(E), His(H), or Lys(K); X 34 represents Ala (A) or Gln (Q), X 35 represents Gln(Q), Leu(L), or Thr(T), X 36 represents Ala (A), Gly (G), or Gln (Q); X 37 represents Glu(E) or Lys(K), X 38 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 39 represents Ala (A) or Lys (K), X 40 represents Asp (D) or Thr (T), X 41 represents Leu (L) or Glu (E), X 42 represents Arg (R) or Lys (K); X 43 represents Ala (A) or Ser (S)).

[0039] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), Lys (K), or Ser (S); X5 represents Gly (G) or Lys (K), L1 is a peptide linker, Z2 comprises a C-terminal amide, Formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S)).

[0040] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R) or Gln(Q), X 54 represents Ala (A), Glu (E), or Gln (Q); X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A) or Gln (Q), X 57 represents Gly (G) or Glu (E), L1 is a peptide linker, Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Gly (G) or Ser (S), X 59 represents Gln(Q), Glu(E), or His(H); X 60 represents Ala (A) or Gln (Q), X 61 represents Leu (L) or Thr (T), X 62 represents Ala (A), Gly (G), or Gln (Q); X 63 represents Gln(Q), Glu(E), or Lys(K); X 64 represents Leu (L) or Glu (E)).

[0041] The compounds disclosed herein are agonists at each of the receptors GLP-1, GIP, and amylin.Therefore, the compounds of the present invention are GLP-1 receptor agonists and GIP receptor agonists, and agonists for amylin receptors (i.e., amylin receptor agonists).They can activate or "agonize" all three of the GLP-1 receptor, GIP receptor, and amylin receptor systems, and are "GLP-1 / GIP / amylin receptor agonists."GLP-1 / GIP / amylin receptor triple agonists can provide similar levels of activation of all three GLP-1, GIP, and amylin receptors, which are then referred to as "balanced GLP-1 / GIP / amylin receptor triple agonists," or simply "balanced triple agonists."

[0042] A "receptor agonist" or "agonist" can be defined as a ligand, such as a compound, that binds to and activates a biological receptor, resulting in a biological response. A full agonist can be defined as one that causes a response of the same magnitude as the natural ligand (see, for example, "Principles of Biochemistry," AL Lehninger, DL Nelson, MM Cox, Second Edition, Worth Publishers, 1993, page 763). Receptors can be activated by either endogenous agonists, such as endogenous hormones, or exogenous agonists, such as pharmaceuticals.

[0043] In the context of the present invention, a "co-agonist" is a compound capable of binding to and activating two different biological receptors, e.g., a compound comprising two different ligands, each of which binds to a given biological receptor and produces a biological response characteristic of the natural ligand. Similarly, a "triple agonist" or "tri-agonist" is a compound capable of binding to and activating three different biological receptors, e.g., a compound comprising three different ligands, each of which binds to a given biological receptor and produces a biological response characteristic of the natural ligand.

[0044] A "GLP-1 receptor agonist" can be defined as a compound capable of binding to and activating the GLP-1 receptor. A "full" GLP-1 receptor agonist can be defined as a GLP-1 receptor agonist that is capable of eliciting a GLP-1 receptor response of similar magnitude to that of native glucagon-like peptide 1 (GLP-1). Semaglutide, disclosed in Example 4 of WO 2006 / 097537, is an example of an exogenous GLP-1 receptor agonist.

[0045] A "GIP receptor agonist" can be defined as a compound capable of binding to and activating the GIP receptor. A "full" GIP receptor agonist can be defined as a GIP receptor agonist that is capable of eliciting a GIP receptor response of a similar magnitude to that of native glucose-dependent insulinotropic polypeptide (GIP).

[0046] A "GLP-1 / GIP receptor agonist" can be defined as a compound capable of binding to and activating both the GLP-1 receptor and the GIP receptor. An example of a GLP-1 / GIP co-agonist is tirzepatide, described in WO 2016 / 111971.

[0047] An "amylin receptor agonist" can be defined as a compound capable of binding to and activating the amylin receptor (AMYR) and calcitonin receptor (CTR). The amylin receptor consists of two components: a heterodimer of the calcitonin receptor (CTR) and one of three receptor activity-modifying proteins (RAMPs 1-3), resulting in three possible complexes: AMYR1-3. Unless otherwise specified herein, "amylin receptor" refers to at least amylin receptor 3 (AMYR3). Nevertheless, some simultaneous activity against other receptors can be expected. A "full" amylin receptor agonist can be defined as an amylin receptor agonist capable of eliciting amylin receptor responses of a similar magnitude to those of native amylin. Amylin receptor agonists are often also calcitonin receptor agonists. Examples of amylin receptor agonists are human amylin, human calcitonin, and caglilintide (disclosed in WO 2012 / 168432). It should be noted that all headings and sub-headings are used herein for convenience only and should not be construed as limiting the invention in any way.

[0048] The use of any and all examples or exemplary phrases (e.g., "such as") provided herein is intended merely to further clarify the invention and does not impose a limitation on the scope of the invention unless otherwise claimed.

[0049] In order that the present invention may be more readily understood, certain terms are first defined.

[0050] In the following, Greek letters may be represented by their symbols or by their corresponding descriptive names, for example α = alpha, β = beta, γ = gamma, ε = epsilon, ω = omega, etc. The Greek letter μ may also be represented by "u", for example μl = ul, μM = uM.

[0051] Unless otherwise indicated herein, terms provided in the singular include plural references. The terms "a" or "an" are intended to mean "one or more."

[0052] The term "comprise," and variations thereof, such as "comprises" and "comprising," when preceding a list of steps or elements, are intended to mean that the addition of additional steps or elements is optional and not excluded. As disclosed herein, open-ended terms such as "comprises" and "comprising" can be replaced with restrictive terms such as "consists of," "consisting of," etc.

[0053] The term "about" is used herein to mean approximately, roughly, or in the region of. When the term "about" is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the stated numerical values. In general, the term "about" can modify numerical values ​​above and below the stated value by 10 percent above or below (higher or lower).

[0054] Amino acids are molecules containing an amine group and a carboxylic acid group, and optionally one or more additional groups often called side chains.

[0055] The term "amino acid" includes standard amino acids (genetically encoded) and unnatural amino acids. Non-limiting examples of unnatural amino acids are Aib (α-aminoisobutyric acid or 2-aminoisobutyric acid), deaminohistidine (also known as 3-(imidazol-4-yl)propanoic acid, abbreviated Imp (imidazopropionyl), and d-isomers of the standard amino acids. All amino acid residues in peptides for which the optical isomer is not specified shall be understood herein to refer to the L-isomer, unless otherwise specified.

[0056] As used herein, "amino acid substitution" or "substitution" refers to one or more amino acids being replaced with the same number of amino acids in the backbone of a peptide. The substitutions may be, but are not limited to, conservative substitutions. For example, an amino acid may be substituted for an amino acid with similar biochemical properties, e.g., a basic amino acid may be substituted for another basic amino acid (e.g., lysine for arginine), an acidic amino acid may be substituted for another acidic amino acid (e.g., glutamic acid for aspartic acid), a neutral amino acid may be substituted for another neutral amino acid (e.g., threonine for serine), a charged amino acid may be substituted for another charged amino acid (e.g., glutamic acid for lysine), a hydrophilic amino acid may be substituted for another hydrophilic amino acid (e.g., asparagine for glutamine), a hydrophobic amino acid may be substituted for another hydrophobic amino acid (e.g., alanine for valine), a polar amino acid may be substituted for another polar amino acid (e.g., serine for threonine), an aromatic amino acid may be substituted for another aromatic amino acid (e.g., phenylalanine for tryptophan), or an aliphatic amino acid may be substituted for another aliphatic amino acid (e.g., leucine for isoleucine).

[0057] The term "excipient" as used herein refers broadly to any component other than the active pharmaceutical ingredient (API).

[0058] The term "identity" or "sequence identity," as known in the art, refers to the relationship between the sequences of two or more polypeptides, as determined by comparing the sequences. In the art, "identity" also means the degree of sequence relatedness between polypeptides, as determined by the number of matches between two or more strings of amino acid residues. "Identity" measures the percentage of exact matches between the smaller of two or more sequences, with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., "algorithm"). The identity of related polypeptides can be readily calculated by known methods, for example, using Needleman from EMBOSS-6.6.0 (Needleman et al. J. Mol. Biol. 1970;48:443-453) using parameters of 10 and 0.5 for gap opening and extension (gapopen=10, gapextend=0.5), respectively, or can be calculated, for example, by (I) comparing two optimally aligned sequences over a window of comparison (e.g., the length of the longer sequence, the length of the shorter sequence, a specified window, etc.), (2) determining the number of positions containing identical monomers (e.g., the same amino acid occurs in both sequences) to yield the number of matched positions, (3) dividing the number of matched positions by the total number of positions within the window of comparison (e.g., the length of the longer sequence, the length of the shorter sequence, a specified window), and (4) multiplying the result by 100 to yield a percentage "sequence identity." For example, if peptides A and B are both 20 amino acids in length and have exactly the same amino acids except for one position, then peptide A and peptide B have 95% sequence identity.

[0059] The term "polypeptide" or "peptide" as used herein includes oligopeptides and refers to a single chain of amino acids joined by one or more amide (or peptide) bonds. The terms "polypeptide" and "peptide" are intended to be used interchangeably herein.

[0060] The term "half-life" or "plasma half-life" as used herein refers to the time required for half of the amount of a substance administered to an individual to be metabolized or eliminated from the individual's serum or plasma by normal biological processes.

[0061] The term "treatment" or variations thereof as used herein refers to the medical therapy of any human subject in need thereof. The term includes administering a therapeutically effective amount of a peptide disclosed herein sufficient to reduce or eliminate at least one symptom of the disorder in question. However, "treatment" need not be curative. The timing and purpose of the treatment may vary from individual to individual according to the subject's current health status. Thus, the treatment may be preventative, palliative, symptomatic, and / or curative. In the context of the present invention, preventative, palliative, symptomatic, and / or curative treatment may represent separate aspects of the invention.

[0062] As used herein, the terms "preventing," "prevent" or "prevention," or variations thereof, refer to protecting a subject from developing at least one symptom of a disease or reducing the severity of a symptom of a disorder.

[0063] GLP-1 / GIP / amylin receptor triple agonist The compounds disclosed herein are referred to herein as "GLP-1 / GIP / amylin receptor triple agonists" or "GLP-1 receptor-GIP receptor-amylin receptor triple agonists," or "GLP-1 / GIP / amylin receptor triple agonists" or "GLP-1 receptor-GIP receptor-amylin receptor triple agonists."

[0064] The GLP-1 / GIP / amylin receptor triple agonist comprises peptide Z1, a GLP-1 / GIP receptor co-agonist, peptide linker L1, and peptide Z2, an amylin receptor agonist. The GLP-1 / GIP / amylin receptor triple agonist is a compound that can bind to each of the three GLP-1, GIP, and amylin receptors and activate each of the receptors, GLP-1R, GIPR, and amylin receptor, thereby eliciting a response at each receptor.

[0065] Peptide Z1 disclosed herein can have up to 4 amino acid substitutions relative to Formula II (SEQ ID NO: 1). Peptide Z2 disclosed herein can have up to 10 amino acid substitutions relative to Formula III (SEQ ID NO: 2).

[0066] The term "compound" is used herein to refer to a molecular entity, and thus a "compound" is Each compound or group of compounds may have different structural elements other than the minimum elements defined.As long as the compound contains the defined structural and / or functional elements, it can be a peptide or its derivative.The term "compound" is also intended to include its pharmaceutically relevant forms, i.e., the compound defined herein, or its pharmaceutically acceptable salts, amides, or esters.

[0067] The compounds disclosed herein can be potent GLP-1 receptor agonists.

[0068] The compounds disclosed herein can be potent GIP receptor agonists.

[0069] The compounds disclosed herein can be potent amylin receptor agonists.

[0070] The in vitro potency of an agonist can be measured as described in the assay in Example 4. The term "potency" is used to describe the effect of a given compound in an assay in which a sigmoidal relationship between log concentration and compound effect is established. Furthermore, the response should be variable from 0 to 100%. The potency of a compound is expressed as its EC (effective concentration) 50 It can be explained using the value EC 50 represents the concentration of a compound at which 50% of its maximal effect is observed in an assay, e.g., as described in Example 4. EC 50 The lower the value, the more potent the compound.

[0071] The compounds disclosed herein can provide similar levels of activation of all three GLP-1 receptors, GIP receptors, and amylin receptors, i.e., they can be "balanced" and referred to as "balanced GLP-1 / GIP / amylin receptor triple agonists," or simply "balanced triple agonists." Because the relative ratios of the compound's GLP-1, GIP, and amylin receptor agonist activity are locked into the molecule, relatively "balanced" receptor activation is advantageous, and it is not possible to titrate the three receptor agonists against each other. Finally, if a molecule is "balanced," it can be administered so that all three hormone systems are activated without side effects outweighing the benefits.

[0072] Highest potency (i.e., lowest numerical EC 50 The lowest potency (i.e., highest numerical EC value) divided by the potency (B) of the receptor with 50 A triple agonist having a potency ratio (A / B) of receptor potencies (A) with a potency (A / B) of less than 50 is a "balanced triple agonist" or "balanced GLP-1 / GIP / amylin receptor triple agonist" (based on assays in the absence of human serum albumin (HSA) as shown in Tables 7a and 8a of Example 4). For example, compound 10 has an EC50 of 13.83 pM for the GLP-1 receptor. 50 , EC of 2.11 pM for GIP receptors 50, and an EC of 6.8 pM for amylin receptors 50 Thus, it has the lowest potency at the hGLP-1 receptor, with (A) corresponding to 13.83 pM and (B) corresponding to 2.11 pM, and the highest potency at the GIP receptor, with (A) corresponding to 13.83 pM and (B) corresponding to 2.11 pM. Therefore, the potency ratio (A / B) is 13.83 pM (A) divided by 2.11 pM (B), which equals 7 (rounded appropriately), meaning that compound 10 is a "balanced triple agonist."

[0073] A compound that is potent at one receptor and much weaker at the other may be "unbalanced." Such an "unbalanced triple agonist" is defined as a compound with a potency ratio (A / B) of 50 or greater. For example, reference compound 1 has a potency ratio (A / B) of 287 (i.e., 1516.05 pM (=A) divided by 5.29 pM (=B), rounded appropriately). For example, a compound that is potent at the GIP receptor and the amylin receptor (i.e., EC 50 value <30 pM), and is less potent at the GLP-1 receptor (i.e., EC 50 value), this reference compound cannot achieve optimal efficacy from all three hormone systems because side effects resulting from activation of the GIP receptor and amylin receptors prevent the administration of high enough doses to also achieve activation of the GLP-1 hormone system. If a compound is too potent at one receptor, e.g., the GLP-1 receptor (e.g., an EC<50 pM), 50 values), but significantly weaker at two other receptors, e.g., the GIP receptor and the amylin receptor (e.g., EC values ​​>500 pM each). 50 The opposite situation can occur when the

[0074] peptide The present invention in one aspect provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, L1 is a peptide linker, Z2 is a C-terminal amide and a group of formula III (SEQ ID NO: 2): This invention relates to GLP-1 / GIP / amylin receptor triple agonists, which are peptides containing up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III).

[0075] The GLP-1 / GIP / amylin receptor triple agonist comprises a peptide Z1-L1-Z2, which comprises a peptide Z1, a peptide linker L1, and a peptide Z2.

[0076] Peptide Z1 is a GLP-1 / GIP receptor coagonist that can bind to and activate both the GLP-1 receptor and the GIP receptor. The C-terminus of peptide Z1 is linked to peptide linker L1 via a peptide bond.

[0077] L1 is a peptide linker, the N-terminus of which is bound to the C-terminus of Z1 via a peptide bond, and the C-terminus of which is bound to the N-terminus of Z2.

[0078] Peptide Z2 is an amylin receptor agonist that can bind to and activate at least amylin receptors. The N-terminus of Z2 is linked to the C-terminus of L1 via a peptide bond. The C-terminus of Z2 is modified with an amide group that is considered essential for biological activity. In a preferred embodiment, the amine group of the C-terminal amide is NH2.

[0079] The molecular form can be a single polypeptide backbone containing one lysine (Lys, K) residue. The one lysine (Lys, K) residue can be in the peptide Z1 portion of the peptide backbone, or the one lysine (Lys, K) residue can be in the peptide Z2 portion of the peptide backbone. A single lysine residue is referred to herein as "Lys, K." P and a covalently linked extension, which may be referred to as "L-P" P " is an optional linker and "P" is a protractor. The peptide backbone of the GLP-1 / GIP / amylin receptor triple agonists of the invention typically comprises about 66 to about 80 amino acid residues linked together by peptide bonds.

[0080] Peptide Z1 disclosed herein can have up to four amino acid substitutions relative to Formula II (SEQ ID NO: 1), which can be at any of positions 1 to 34, preferably at positions 1, 3, 12, 17, 20, 24, 27, 28, 33, and / or 34. The present invention encompasses variants of the GLP-1 / GIP / amylin receptor triple agonists disclosed herein, in which peptide Z1 can contain one, two, three, or four amino acid substitutions relative to Formula II (SEQ ID NO: 1).

[0081] Preferred substitutions include conservative substitutions, which are those that contain a structural analog of an amino acid residue with similar biochemical properties in place of the amino acid residue occurring in the sequence.

[0082] Peptide Z2 disclosed herein can have up to 10 amino acid substitutions relative to Formula III (SEQ ID NO: 2), which can be at any of positions 1 through 32, preferably at positions 2, 3, 7, 8, 9, 10, 15, 18, 20, 21, 22, 24, and / or 31. The present invention encompasses variants of the GLP-1 / GIP / amylin receptor triple agonists disclosed herein, in which peptide Z2 can contain 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions relative to Formula III (SEQ ID NO: 2). Preferred substitutions include the conservative substitutions described above.

[0083] In some embodiments of the invention, peptide Z1 comprises amino acids having at least 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity (i.e., sequence identity) to Formula II (SEQ ID NO:1), and peptide Z2 comprises amino acids having at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity (i.e., sequence identity) to Formula III (SEQ ID NO:2).

[0084] In some embodiments of the present invention, the GLP-1 / GIP / amylin receptor triple agonists disclosed herein do not contain cysteine ​​(Cys, C) residues and / or do not contain disulfide bridges. The term "disulfide bridge" with respect to human amylin and its analogs refers to a functional group having the structure RSS-R', which may also be referred to as an "SS bond."

[0085] GLP-1 / GIP / amylin receptor triple agonists, as described herein, can exhibit a variety of properties that make them useful as pharmaceuticals.

[0086] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula X (SEQ ID NO: 161): X 21 X 22 X 23 GTFTSDYSX 24 LLEEX 25 AAX 26 EFIX 27 WLX 28 X 29 GGPSX 30 X 31 (X) (In the formula, X 21 represents His (H) or Tyr (Y), X 22 represents Aib, X 23 represents Glu(E) or His(H), X 24 represents Ile (I) or Lys (K), X 25 represents Gln(Q) or Ile(I), X 26 represents Arg(R) or Gln(Q), X 27 represents Ala (A), Glu (E), or Gln (Q); X 28 represents Leu (L) or I (Ile), X 29 represents Ala (A) or Gln (Q), X 30 represents Arg (R), Gly (G), Lys (K), or Ser (S); X 31 represents Gly (G), Glu (E), or Lys (K), L1 is a peptide linker, Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XII (SEQ ID NO: 164): AX 32 X 33 LSTAX 34 X 35 X 36 RLSAX 37 LHX 38 LX 39 X 40 X 41 PX 42 TETGSGX 43 P (XII) (In the formula, X 32 represents Gly (G) or Ser (S), X 33 represents Gln(Q), Glu(E), His(H), or Lys(K); X 34 represents Ala (A) or Gln (Q), X 35 represents Gln(Q), Leu(L), or Thr(T), X 36 represents Ala (A), Gly (G), or Gln (Q); X 37 represents Glu(E) or Lys(K), X 38 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 39 represents Ala (A) or Lys (K), X 40 represents Asp (D) or Thr (T), X 41 represents Leu (L) or Glu (E), X42 represents Arg (R) or Lys (K); X 43 represents Ala (A) or Ser (S)).

[0087] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), Lys (K), or Ser (S); X5 represents Gly (G) or Lys (K), L1 is a peptide linker, Z2 comprises a C-terminal amide, Formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S)).

[0088] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R) or Gln(Q), X 54 represents Ala (A), Glu (E), or Gln (Q); X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A) or Gln (Q), X 57 represents Gly (G) or Glu (E), L1 is a peptide linker, Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Gly (G) or Ser (S), X 59 represents Gln(Q), Glu(E), or His(H); X 60 represents Ala (A) or Gln (Q), X 61 represents Leu (L) or Thr (T), X 62 represents Ala (A), Gly (G), or Gln (Q); X 63 represents Gln(Q), Glu(E), or Lys(K); X 64 represents Leu (L) or Glu (E)).

[0089] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAaREFIEWLLAGGPSX4X5(IIa) (In the formula, X1X2X3 represents YAibE (Tyr-Aib-Glu) or HAibH (His-Aib-His), X4 represents Arg (R), Gly (G), or Ser (S); X5 may comprise a peptide Z1 comprising or consisting of Gly (G).

[0090] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His; X2 represents Aib, X3 represents His (H), X4 represents Lys(K), X5 may comprise a peptide Z1 comprising or consisting of Gly (G).

[0091] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula V (SEQ ID NO: 6): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSX4G (V) (In the formula, X2 represents Aib, X4 is Arg (R) or Ser (S).

[0092] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula VI (SEQ ID NO: 7): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSSG (VI) wherein X2 represents Aib.

[0093] In some embodiments of the invention, peptide Z1 may comprise an amino acid sequence having at least 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to Formula VI (SEQ ID NO:7).

[0094] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R), X 54 represents Glu(E), X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A), X 57 represents Gly (G) or Glu (E).

[0095] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R), X 54 represents Glu(E), X 55 represents Leu(L), X 56 represents Ala (A), X 57 represents Gly (G)).

[0096] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula XI (SEQ ID NO: 163): YX 51 EGTFTSDYSX 52 LLEEIAAREFIEWLLAGGPSSG (XI) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K).

[0097] In one embodiment, peptide Z2 has an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Lys(K), X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Thr(T), or Tyr(Y); X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S), or X6 represents Gln(Q), Glu(E), or His(H); X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Thr(T), or Tyr(Y); X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S), or X6 represents Gln(Q), Glu(E), or His(H); X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Lys(K), X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S), or X6 represents Gln(Q), Glu(E), or His(H); X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Thr(T), or Tyr(Y); X 12 represents Lys(K), X 13 represents Asp (D) or Thr (T), X14 represents Arg(R), X 15 represents Ala (A) or Ser (S), or X6 represents Gln(Q), Glu(E), or His(H); X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Thr(T), or Tyr(Y); X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Lys(K), X 15 represents Ala (A) or Ser (S).

[0098] In one embodiment, peptide Z2 has an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents His(H), X7 represents Gln(Q), X8 represents Thr(T), X9 represents Gln(Q), X 10 represents Glu(E), X 11 represents Arg (R) or Lys (K); X 12 represents Ala (A) or Lys (K), X 13 represents Thr(T), X 14 represents Arg (R) or Lys (K); X 15 represents Ser (S)).

[0099] In one embodiment, peptide Z2 has an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents His(H), X7 represents Ala (A) or Gln (Q); X8 represents Leu (L) or Thr (T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R) or Gln(Q), X 12 represents Lys(K), X 13 represents Thr(T), X 14 represents Arg(R), X 15 represents Ser (S)).

[0100] In one embodiment, peptide Z2 has an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14TETGSGX 15 P (IIIa) (In the formula, X6 represents His(H), X7 represents Ala (A) or Gln (Q); X8 represents Leu (L) or Thr (T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), X 12 represents Ala (A), X 13 represents Thr(T), X 14 represents Lys(K), X 15 represents Ser (S)).

[0101] In one embodiment, peptide Z2 has an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S).

[0102] In one embodiment, peptide Z2 has an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Glu(E) or His(H), X7 represents Ala (A) or Gln (Q); X8 represents Leu (L) or Thr (T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), Gln(Q), or Glu(E); X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Arg(R), X 15 represents Ser (S)).

[0103] In one embodiment, peptide Z2 has an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Glu(E) or His(H), X7 represents Ala (A) or Gln (Q); X8 represents Leu (L) or Thr (T); X9 represents Ala (A) or Gly (G), X 10 represents Glu(E), X 11 represents Arg(R), Gln(Q), or Glu(E); X 12 represents Ala (A), X 13 represents Thr(T), X 14 represents Arg(R), X 15 represents Ser (S)).

[0104] In one embodiment, peptide Z2 has an amino acid sequence according to Formula VII (SEQ ID NO: 8): It may comprise or consist of ASHLSTAQTQRLSAKLHRLATLPRTETGSGSP (VII).

[0105] In one embodiment, peptide Z2 has an amino acid sequence according to formula VIII (SEQ ID NO: 9): It may comprise or consist of ASHLSTAQTQRLSAELHKLATLPRTETGSGSP (VIII).

[0106] In some embodiments of the invention, peptide Z2 may comprise an amino acid sequence having at least 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to Formula VII (SEQ ID NO: 8) or Formula VIII (SEQ ID NO: 9).

[0107] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP(XIIa) (In the formula, X 58 represents Ser(S), X 59 represents His(H), X 60 represents Gln(Q), X 61 represents Thr(T), X 62 represents Gln(Q), X 63 represents Lys(K), X 64 represents Leu (L)).

[0108] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula XIII (SEQ ID NO: 166): ASX 59 LSTAQTQRLSAELHKLATLPRTETGSGSP(XIII) (In the formula, X 59 represents Glu (E) or His (H)).

[0109] In one embodiment, a GLP-1 / GIP / amylin receptor triple agonist of the invention may comprise a peptide Z1 comprising or consisting of an amino acid sequence having at least 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to Formula VI (SEQ ID NO:7), and a peptide Z2 comprising or consisting of an amino acid sequence having at least 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to Formula VII (SEQ ID NO:8) or Formula VIII (SEQ ID NO:9).

[0110] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), and Amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S)).

[0111] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), and Amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Glu(E) or His(H), X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg (R), Gln (Q), or Lys (K); X 12 represents Ala (A) or Lys (K), X 13 represents Thr(T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S)).

[0112] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 may comprise a peptide Z1 comprising or consisting of Gly (G), Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Glu(E) or His(H), X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Lys(K), X 12 represents Ala (A), X 13 represents Thr(T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S).

[0113] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist of the present invention has an amino acid sequence according to Formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R), X 54 represents Glu(E), X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A), X 57 represents Gly (G) or Glu (E)), and Amino acid sequence according to formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Ser(S), X 59 represents His(H), X 60 represents Gln(Q), X 61 represents Thr(T), X 62 represents Gln(Q), X 63 represents Lys(K), X 64 represents Leu (L)).

[0114] In one embodiment, the present invention relates to a GLP-1 / GIP / amylin receptor triple agonist comprising a peptide, wherein the peptide comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 20-124 and 170-242, and X represents Aib. In a particular embodiment, the present invention relates to a GLP-1 / GIP / amylin receptor triple agonist, wherein the amino acid sequence of the peptide is YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPGASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 62), where X represents Aib; or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPGASHLSTAQTQRLSAKLHRLATLPRTETGSGSP (SEQ ID NO: 65), where X represents Aib; or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPLASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 68), where X represents Aib; or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSRGEASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 78), where X represents Aib; or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPLASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 87), where X represents Aib; or HXHGTFTSDYSILLEEQAAREFIEWLLAGGPSKGAPPPSGGGEASHLSTAQTARLSAELHQLATLPRTETGSGSP (SEQ ID NO: 111), where X represents Aib; or YXEGTFTSDYSILLEEIAAREFIEWLLAGGPSSGAGQAPGQAPGASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 170), where X represents Aib.

[0115] One aspect of the present invention relates to GLP-1 / GIP / amylin receptor triple agonists that are capable of activating human GIP receptors, GLP-1 receptors, and amylin receptors in vitro.

[0116] When tested as described in "GLP-1 Receptor Assay" (preferably Method A; in the absence of HSA), the GLP-1 / GIP / amylin receptor triple agonists disclosed herein have an EC50 of less than 125 pM, preferably less than 100 pM, for example, less than 75 pM, even more preferably less than 50 pM, for example, less than 40 pM, and most preferably less than 30 pM, for example, less than 20 pM, for example, less than 10 pM, for example, less than 5 pM. 50 It may have a value.

[0117] When tested as described in "GIP Receptor Assay" (preferably Method A; in the absence of HSA), the GLP-1 / GIP / amylin receptor triple agonists disclosed herein have an EC50 of less than 125 pM, preferably less than 100 pM, for example, less than 75 pM, even more preferably less than 50 pM, for example, less than 40 pM, and most preferably less than 30 pM, for example, less than 20 pM, for example, less than 10 pM, for example, less than 5 pM. 50 It may have a value.

[0118] When tested as described in "Amylin Receptor Assay" (preferably Method A; in the absence of HSA), the GLP-1 / GIP / amylin receptor triple agonists disclosed herein have an EC50 of less than 125 pM, preferably less than 100 pM, for example, less than 75 pM, even more preferably less than 50 pM, for example, less than 40 pM, and most preferably less than 30 pM, for example, less than 20 pM, for example, less than 10 pM, for example, less than 5 pM. 50 The GLP-1 / GIP / amylin receptor triple agonists disclosed herein agonize or activate amylin receptors. The GLP-1 / GIP / amylin receptor triple agonists disclosed herein can be tested for amylin activity as described in Example 4.

[0119] The more potent a compound is, the higher its EC 50 GLP-1 / GIP / amylin receptor triple agonists have an EC value of about 100 pM or less in the human GLP-1 receptor functional assay (see Example 4). 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonists disclosed herein may have potency similar to that of semaglutide or tirzepatide.

[0120] GLP-1 / GIP / amylin receptor triple agonists have an EC of about 125 pM or less in the human GIP receptor functional assay (see Example 4). 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonists disclosed herein may have potency similar to that of tirzepatide.

[0121] GLP-1 / GIP / amylin receptor triple agonists have an EC of about 125 pM or less in the human amylin receptor functional assay (see Example 4). 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonist may have an EC 50 The GLP-1 / GIP / amylin receptor triple agonists disclosed herein may have potency similar to that of caglilintide.

[0122] In another aspect, the present invention relates to a balanced GLP-1 / GIP / amylin receptor triagonist that activates human GIP, GLP-1, and amylin receptors in vitro and has a potency ratio of less than 50 when measured without HSA in the assay described in Example 4.

[0123] Peptide Linker The GLP-1 / GIP / amylin receptor triple agonist peptide scaffolds disclosed herein include a peptide linker, L1, which can contain 1 to 14 amino acid residues, particularly standard amino acid residues. The peptide linker can contain 1 to 10 amino acid residues, particularly standard amino acid residues, such as 2 to 10, 3 to 10, 4 to 10, 5 to 10, 6 to 10, 7 to 10, 8 to 10, 9 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, or 1 to 3 amino acid residues. Specifically, the peptide linker can contain 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid residues, particularly standard amino acid residues.

[0124] The peptide linker L1 has the formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) (In the formula, X 1~14 are independently selected from any naturally occurring or standard amino acid residue; X 2-14 may be represented by (any of which may be absent).

[0125] The GLP-1 / GIP / amylin receptor triple agonist peptide scaffold disclosed herein comprises a peptide linker L1, which comprises or consists of an amino acid sequence according to Formula IV. Thus, the GLP-1 / GIP / amylin receptor triple agonist comprises or consists of a peptide according to the amino acid sequence of SEQ ID NO:5.

[0126] X 1~14 Any of X may be selected from any non-aromatic amino acid residue. 1~14 Any of X may be a charged amino acid. 1~14 Any of X may be a polar amino acid. 1~14 Any of the amino acids may be hydrophobic amino acids.

[0127] X 1~14Any of X may be independently selected from the group consisting of alanine (Ala, A), glutamic acid (Glu, E), glutamine (Gln, Q), glycine (Gly, G), leucine (Leu, L), phenylalanine (Phe, F), proline (Pro, P), serine (Ser, S), threonine (Thr, T), valine (Val, V), and asparagine (Asn, N). 1~14 Any of the amino acids may be selected from the group consisting of alanine (Ala, A), glutamic acid (Glu, E), glutamine (Gln, Q), glycine (Gly, G), leucine (Leu, L), and proline (Pro, P).

[0128] In one embodiment, the peptide linker L1 can be represented by Formula IV or an amino acid sequence according to Formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) (In the formula, X1 represents Ala (A), Glu (E), or Gly (G), X2 represents Gln(Q), Glu(E), Gly(G), Leu(L), Pro(P), or is absent; X3 represents Ala (A), Gln (Q), Glu (E), Gly (G), Pro (P), or is absent; X4 represents Ala (A), Gln (Q), Glu (E), Gly (G), Pro (P), or is absent; X5 represents Glu(E), Gly(G), Pro(P), Ser(S), Thr(T) or is absent; X6 represents Glu(E), Gly(G), Leu(L), Gln(Q), or is absent; X7 represents Ala (A), Gln (Q), Glu (E), Gly (G), Phe (F), or is absent; X8 represents Ala (A), Gln (Q), Glu (E), Gly (G), Thr (T), Pro (P), Val (V), or is absent; X9 represents Glu(E), Asn(N), Pro(P), Thr(T) or is absent; X 10 represents Ala (A), Gln (Q), Glu (E), Gly (G), Leu (L), Pro (P), Ser (S), Val (V), or is absent; X 11 represents Ala (A) or is absent, X 12 represents Gln(Q) or is absent, X 13 represents Thr(T) or is absent, X 14 represents Leu (L) or is absent).

[0129] The peptide linker L1 can be any one of the peptide linkers represented by SEQ ID NOs: 125 to 159. The peptide linker L1 can be any one of the peptide linkers listed in Table 2. [Table 2]

[0130] The peptide linker L1 is A, E, G, AE, GE, APPE (SEQ ID NO: 125), GGGE (SEQ ID NO: 126), AGQAPG (SEQ ID NO: 127), APPPSGGG (SEQ ID NO: 128), APPPSGGGE (SEQ ID NO: 129), APPPSGGGG (SEQ ID NO: 130), ALAQTLAQTL (SEQ ID NO: 131), ALAQTLFVNQ (SEQ ID NO: 132), ALAQTLGTNE (SEQ ID NO: 133), ALQAPGQAPG (SEQ ID NO: 134), ALQAPGQAPL (SEQ ID NO: 135), AGQAPGQAPG (SEQ ID NO: 136), AGQAPGQAPL (SEQ ID NO: 137), GGGEGGGEGE (SEQ ID NO: 138), GQAPGQAPGE (SEQ ID NO: 139), GQEPGQEPGE (SEQ ID NO: 140), APPPSLAQTLAQTL (SEQ ID NO: 141), AG, AGGGG (SEQ ID NO: 142), ALAQTLFVNQ (SEQ ID NO: 133), ALAQTLGTNE (SEQ ID NO: 134), ALAQTLFVNQ (SEQ ID NO: 135), ALAQTLGTNE (SEQ ID NO: 136), ALAQTLGTNE (SEQ ID NO: 137), ALAQTLGTNE (SEQ ID NO: 138), ALAQTLGTNE (SEQ ID NO: 139), ALAQTLGTNE (SEQ ID NO: 142), ALAQTLGTNE (SEQ ID NO: 139), ALAQTLGTNE (SEQ ID NO: 143), ALAQTLGTNE ( No. 142), AGEAPGQAPG (SEQ ID NO: 143), AGEAPGEAPG (SEQ ID NO: 144), AGQAPGQAPA (SEQ ID NO: 145), AGQAPGQAPE (SEQ ID NO: 146), AGQAPGQAPP (SEQ ID NO: 147), AGQAPGQAPS (SEQ ID NO: 148), AGQAPGQAPV (SEQ ID NO: 149), EGQAPGQAPG (SEQ ID NO: 150), AGQEPGQAPG (SEQ ID NO: 151), AGQAEGQAPG (SEQ ID NO: 152), AGQAPEQAPG (SEQ ID NO: 153), AGQAPGEAPG (SEQ ID NO: 154), AGQAPGQEPG (SEQ ID NO: 155), AGQAPGQAEG (SEQ ID NO: 156), AGQEPGQEPG (SEQ ID NO: 157), AGQAPGQAP (SEQ ID NO: 158), and AGQAPGEAPL (SEQ ID NO: 159).

[0131] In a preferred embodiment, the peptide linker L1 can be E, GE, APPPSGGGE (SEQ ID NO: 129), AGQAPGQAPG (SEQ ID NO: 136), or AGQAPGQAPL (SEQ ID NO: 137) or AGQAPGEAPG (SEQ ID NO: 154).

[0132] In one embodiment, the backbone of peptide Z1-L1-Z2 comprises 66 to 80 amino acid residues.

[0133] In one embodiment, the backbone of peptide Z1-L1-Z2 comprises 67, 68, 75, or 76 amino acid residues.

[0134] In one embodiment, the backbone of peptide Z1-L1-Z2 comprises 76 amino acid residues.

[0135] In one embodiment, the backbone of peptide Z1-L1-Z2 comprises or consists of the amino acid sequence according to SEQ ID NO:5.

[0136] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist comprises a peptide according to Formula I:Z1-L1-Z2, wherein the peptide comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 20-124, and 170-242.

[0137] extension part In another aspect, the present invention relates to a GLP-1 / GIP / amylin receptor triple agonist, which may further comprise a prolongation moiety. In such a case, the peptide is referred to as a "peptide derivative". Thus, the addition of the term "derivative" means that a prolongation moiety is present, and the compound containing the prolongation moiety is referred to as a "derivative" or "derivatives".

[0138] The term "extending moiety" as used herein refers to a molecule that has half-life extending properties and is composed of a "protractor P" and an optional "linker L". P " refers to the part containing L P is the optional linker and P is the protractor, P -P".

[0139] The term "protractor" as used herein refers to a molecule that is capable of increasing the plasma half-life of the peptide to which it is attached. Accordingly, the term "prolongation" refers to the prolongation of half-life, and thus, the protractor or prolonging moiety serves the purpose of extending the plasma half-life of the peptides disclosed herein.

[0140] Furthermore, the GLP-1 / GIP / amylin receptor triple agonists of the present invention have a long plasma half-life relative to the dosing interval, thus reducing the variability of steady-state exposure and thus allowing for once-weekly dosing. The compounds disclosed herein are orally bioavailable and therefore suitable for oral administration to subjects in need thereof. Both the polypeptide backbone and the extension moiety have been engineered and refined to achieve compounds with all of the above properties.

[0141] Each extension L P -P is covalently attached to the epsilon amino group of a lysine residue within the peptide backbone of the GLP-1 / GIP / amylin receptor triple agonists of the present invention. P -P can be attached to the epsilon position (i.e., the amino group) of a single lysine (Lys, K) residue. P -P is at position X4 or X5 of formula IIa (SEQ ID NO: 3), or at position 33 or 34 of formula IIa (SEQ ID NO: 3), or at position 12 of formula Xa (SEQ ID NO: 162), or at position X of formula Xa (SEQ ID NO: 162). 52 The peptide may be attached to the epsilon position (i.e., amino group) of a lysine (Lys, K) residue in the peptide Z1 portion of the peptide backbone ("Z1" in Z1-L1-Z2), such as a lysine (Lys, K) residue at position 1.

[0142] Extension part L P -P can be attached to the epsilon position (ie, amino group) of a lysine (Lys, K) residue in the peptide linker L1 portion of the peptide backbone ("L1" in Z1-L1-Z2).

[0143] Extension part L P -P is at position X6 of formula IIIa (SEQ ID NO: 4), 10 Place, X 11 Place, X 12 Place or X 14or at position 3, 15, 18, 20, or 24 of Formula IIIa (SEQ ID NO: 4), or at position 18 of Formula XIIa (SEQ ID NO: 165), or at position X of Formula XIIa (SEQ ID NO: 165). 63 The attachment point may be at the epsilon position (i.e., amino group) of a lysine (Lys, K) residue in the peptide Z2 portion of the peptide backbone ("Z2" in Z1-L1-Z2), such as a lysine (Lys, K) residue at position R1. The point of attachment is commonly referred to as R1.

[0144] optional linker L P If there is an extension L P -P is the linker L P is covalently attached to the peptide backbone via a linker L P When is absent, P is covalently attached to the polypeptide backbone.

[0145] The GLP-1 / GIP / amylin receptor triple agonists of the invention disclosed herein comprise or consist of a peptide containing one lysine (Lys, K) residue to which a single extension moiety is covalently attached / conjugated (at the epsilon amino group). The extension moiety can consist of one protractor P. The extension moiety can consist of one linker L. P and one protractor P. The extension may comprise one linker L P and two or more protractors (in this case referred to as P1, P2, or P3, etc.). The two protractors (P1 and P2) can be identical, or the two protractors (P1 and P2) can be non-identical. When the peptide derivative contains two or three protractors (P1, P2, P3), the protractors are preferably similar, more preferably substantially identical, or most preferably identical.

[0146] With respect to chemical moieties such as the extension moieties disclosed herein, similarity and / or identity can be determined using any suitable computer program and / or algorithm known in the art.

[0147] The prolonging moiety may be capable of non-covalently binding to albumin, thereby facilitating the circulation of the peptide derivative of the present invention in the bloodstream and extending its plasma half-life. Therefore, those skilled in the art may also refer to the prolonging moiety as being an "albumin-binding moiety".

[0148] Protractor (P) The protractor (P) may comprise an acyl group. The acyl group may be branched or unbranched. The acyl group may be saturated or unsaturated. The protractor P may comprise a fatty acid acyl group. The fatty acid acyl group may be branched or unbranched. The fatty acid acyl group may be saturated or unsaturated.

[0149] The protractor P may include a distal carboxylic acid group.

[0150] The protractor P may comprise a fatty acid group.

[0151] The protractor P may contain a fatty acid group and an amide group.

[0152] The protractor P may contain a distal carboxylic acid group and an amide group.

[0153] The protractor P may comprise an alkyl group.

[0154] The protractor P may comprise an aryl group.

[0155] The protractor P may contain a tetrazole group.

[0156] The protractor P may contain sulfonic acid groups.

[0157] The protractor P may contain a phenoxy group.

[0158] The protractor P may contain a benzoic acid group.

[0159] The protractor P may contain a phosphonic acid group.

[0160] The protractor is Chemical formula 1a: HOOC-(CH2) n -CO-*, where n is an integer in the range of 6 to 30, which may also include groups defined by C (n+2) Diacids (e.g., C 18 diacid), or Chemical formula 1b: [ka] where n is an integer ranging from 6 to 30. The asterisk (*) indicates the point of attachment of the radical.

[0161] The protractor P can contain 8 to 32 carbon atoms. The protractor can contain 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, or 32 carbon atoms.

[0162] The protractor P may contain 6 to 30 consecutive -CH2- groups. The protractor P may contain a carbon chain containing at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive -CH2- groups.

[0163] The protractor P may contain 12 to 26 carbon atoms. The protractor P may contain 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 carbon atoms.

[0164] The protractor P can contain 10 to 26 consecutive -CH2- groups. The protractor P can contain a carbon chain containing 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 consecutive -CH2- groups.

[0165] The protractor P can contain 16 to 22 carbon atoms. The peptide derivatives of the invention can include a single extension moiety having a protractor P that includes a carbon chain that is a side chain containing 16, 17, 18, 19, 20, 21, or 22 carbon atoms.

[0166] The protractor P may contain 14 to 20 consecutive -CH2- groups. The protractor P may contain a carbon chain containing 14, 15, 16, 17, 18, 19, or 20 consecutive -CH2- groups.

[0167] The protractor P may contain 16 to 22 consecutive carbon atoms and 14 to 20 consecutive -CH2- groups.

[0168] The protractor P may contain 16 consecutive carbon atoms and 14 consecutive -CH2- groups. 16 It may also be a diacid, which has the formula HOOC-(CH) 14 It may be defined by -CO-*.

[0169] The protractor P may contain 18 consecutive carbon atoms and 16 consecutive -CH2- groups. 18 It may also be a diacid, which has the formula HOOC-(CH) 16 It may be defined by -CO-*.

[0170] The protractor P may contain 20 consecutive carbon atoms and 18 consecutive -CH2- groups. 20 It may also be a diacid, which has the formula HOOC-(CH) 18 It may be defined by -CO-*.

[0171] The protractor P may contain 22 consecutive carbon atoms and 20 consecutive -CH2- groups. 22 It may also be a diacid, which has the formula HOOC-(CH) 20It may be defined by -CO-*.

[0172] The term "fatty acid" refers to an aliphatic mono- or dicarboxylic acid having 4 to 28 carbon atoms, which may be branched or unbranched, preferably unbranched, and may be saturated or unsaturated, preferably saturated.

[0173] As described above, the peptide derivatives disclosed herein contain one lysine (Lys, K) residue and therefore one extension (L P -P), where the extender is attached to the peptide backbone described herein via the epsilon position (i.e., amino group) of a lysine (Lys, K) residue (via an amide bond formed between the carboxylic acid group of the extender and the epsilon amino group of the lysine residue). The extender may be attached to the epsilon position of one lysine (Lys, K) residue in the peptide backbone.

[0174] In one embodiment, the extension moiety may be attached to the epsilon position of a lysine (Lys, K) residue in peptide Z1 ("Z1" in Z1-L1-Z2) of the peptide backbone. In particular, the extension moiety may be attached to the epsilon position of a lysine (Lys, K) residue in position X4 or X5 of formula IIa (SEQ ID NO: 3) of peptide Z1. In particular, the extension moiety may be attached to the epsilon position of a lysine (Lys, K) residue in position X4 or X5 of formula Xa (SEQ ID NO: 162) of peptide Z1. 52 In particular, the extension may be attached to the epsilon position of a lysine (Lys, K) at any one of positions 12, 33, or 34 of peptide Z1, preferably at position 12 or 33 of peptide Z1.

[0175] In one embodiment, the extender moiety may be attached to the epsilon position of a lysine (Lys, K) residue in the linker L1 portion of the peptide backbone ("L1" in Z1-L1-Z2).

[0176] In one embodiment, the extension moiety may be attached to the epsilon position of a lysine (Lys, K) residue in peptide Z2 ("Z2" in Z1-L1-Z2) of the peptide backbone. In particular, the extension moiety may be attached to the X6 position of peptide Z2 of formula IIIa (SEQ ID NO: 4), X 10 Place, X 11 Place, X 12 Place, or X 14 In particular, the extension may be attached to the epsilon position of a lysine (Lys, K) in any one of the positions X of formula XIIa (SEQ ID NO: 165) of peptide Z2. 63 In particular, the extension may be attached to the epsilon position of the lysine (Lys, K) residue at any one of positions 3, 15, 18, 20, or 24 of peptide Z2. In a preferred embodiment, the extension may be attached to the epsilon position of the lysine (Lys, K) residue at position 15 of peptide Z2 or at position 18 of peptide Z2.

[0177] In some embodiments, the GLP-1 / GIP / amylin receptor triple agonists comprising the peptide derivatives disclosed herein may comprise a protractor P selected from any one of those depicted in Table 3. R1 may be attached to (a) the backbone of the peptide derivative, more specifically, the epsilon amino group of a lysine, or (b) the optional linker L P Based on the disclosure herein, one skilled in the art will be able, optionally after some limited routine experimentation, to determine other chemical moieties for use as protractors in the specific peptide derivatives disclosed herein. [Table 3]

[0178] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist is C 12 ~C 20 Includes peptide derivatives containing the diacid protractor P.

[0179] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist is C 16 diacid, C 18 diacid, and C 20 The present invention also includes peptide derivatives containing a protractor P selected from the group consisting of diacids.

[0180] In a preferred embodiment, the GLP-1 / GIP / amylin receptor triple agonist is 18 Diacid or C 20 Includes peptide derivatives containing the diacid protractor P.

[0181] Linker L P In one embodiment, the protractor is directly attached / conjugated onto the backbone of the peptide derivative, i.e., via a linker L P (i.e., via a covalent bond, for example, an amide bond).

[0182] In other embodiments, the protractor is linked to a linker L P and thus, as described above, the extending moiety (L P -P) is an optional linker L P The linker L P may contain several "linker elements." Linker elements may be selected so that they improve the overall properties of the molecule, for example, so that they improve oral bioavailability, half-life conversion, or prolongation effect, and thus improve the overall exposure profile upon oral administration of the compound.

[0183] Linker L P may include Ado, Aeep, or Aeeep, Ala, ε-Lys, Glu, γGlu, Gly, Ser, sulfonamide, Thr, and / or Trx.

[0184] L P The linker has the following chemical formula, where the asterisk (*) indicates the point of attachment of the radical: Chemical formula 9a:*-NH-(CH2)2-(O-(CH2)2) k -O-(CH2) n -CO-* Chemical formula 9b: [ka] wherein k is an integer in the range of 1 to 5 and n is an integer in the range of 1 to 5.

[0185] When k=1 and n=1, the linker element can be designated Ado, or 8-amino-3,6-dioxaoctanoyl, which has the following chemical formula: Formula 10a: *-NH-(CH2)2-O-(CH2)2-O-CH2-CO-* or Chemistry 11b: [ka] It can be represented by:

[0186] When k=1 and n=2, the linker element may be designated Aeep, which has the following chemical formula: Formula 12a: *-NH-(CH2)2-O-(CH2)2-O-(CH2)2-CO-* or Chemical formula 12b: [ka] It can be represented by:

[0187] When k=2 and n=2, the linker element may be designated Aeeep, which has the following chemical formula: Chemical formula 13a:*-NH-(CH2) 2- O-(CH2)2O-(CH2)2-O-(CH2)2-CO-* or Chemical formula 13b: [ka] It can be represented by:

[0188] optional linker L P may contain a sulfonamido-C4 moiety. The sulfonamido-C4 group is a sulfonamido group attached to a 4-butanoyl group and has the following chemical formula: Chemical formula 14a: *-NH-S(O)2-CH2-CH2-CH2-CO-* or Chemistry 14b: [ka] It has.

[0189] Linker L P may contain Trx. Trx is also known as tranexamic acid, trans-4-(aminomethyl)cyclohexanecarboxylic acid, and has the following chemical formula: Chemical formula 15a:*-NH-CH2-(C6H 10 )-CO-* or Chemical formula 15b: [ka] It has.

[0190] Linker L P may include Ahx, which is also known as aminocaproic acid or 6-aminohexanoic acid and has the following chemical formula: Chemical formula 16a:*-NH-(CH2)5-CO-* or Chemistry 16b: [ka] It has.

[0191] Linker L P may contain epsilon-lysine (ε-Lys).

[0192] Linker L P may contain lysine (Lys).

[0193] Linker L P may contain alanine (Ala).

[0194] Linker L P may contain glycine (Gly).

[0195] Linker L P may contain serine (Ser).

[0196] Linker L P may contain glutamic acid (Glu).

[0197] Linker L P teeth, Chemical formula 17: [ka] The linker L may contain a Glu diradical such as: (wherein the Glu diradical may be contained p times, where p is an integer ranging from 1 to 3). P as, or as a linker L P Any one of the amino acids disclosed above used as part of may be used as the L-isomer or as the D-isomer.

[0198] Formula 17 may also be referred to as gamma-Glu, or simply γGlu, due to the fact that it is the gamma carboxy group of the amino acid glutamic acid used herein to connect to the epsilon-amino group of lysine. As described above, the other linker element can be, for example, another Glu residue or an Ado molecule. The amino group of Glu then forms an amide bond with the carboxy group of the extender, or, if present, with the carboxy group of an Ado molecule, or, if present, with the gamma carboxy group of another Glu.

[0199] The peptide derivatives disclosed herein may comprise a linker L selected from any one of those depicted in Table 4 below. PR1 represents the residue in the peptide backbone to which the extender is attached, and P represents the protractor.

[0200] In some embodiments, the peptide derivative comprises an extension moiety, wherein the protractor Formula 4 or Formula 5 or Formula 6 is selected from the group consisting of L in Table 4 below. P 1. L P 2. L P 3. L P 4. L P 5, or L P It is attached to the peptide backbone using a linker designated 6.

[0201] In some embodiments, the peptide derivative comprises an extension moiety, and the protractor formula 5 is L in Table 4 below. P 1. L P 2. L P 3. L P 4. L P 5, or L P 6, and the extension moiety is thus linked to the peptide backbone using a linker designated as Formula 18, Formula 19, Formula 20, Formula 21, Formula 33, or Formula 34 via the linker L. P and Formula 5 as the protractor P.

[0202] In some embodiments, the peptide derivative comprises an extension moiety, and the protractor formula 6 is selected from the group consisting of L in Table 4 below. P 1. L P 2. L P 3. L P 4. L P 5, or L P 6, and the extension moiety is thus linked to the peptide backbone using a linker designated as Formula 18, Formula 19, Formula 20, Formula 21, Formula 33, or Formula 34 via the linker L. P and Formula 6 as the protractor P.

[0203] In a preferred embodiment, the peptide derivative comprises an extension moiety, which extension moiety is a group of formula 20 or formula 21 linked to a linker LP and Formula 5 or Formula 6 as the protractor P.

[0204] In a preferred embodiment, the peptide derivative comprises an extension moiety, and the protractor formula 5 is selected from the group consisting of L in Table 4 below. P 3, and the extension moiety is thus linked to the peptide backbone using a linker designated as formula 20 via linker L P and Formula 5 as the protractor P.

[0205] In a preferred embodiment, the peptide derivative comprises an extension moiety, and the protractor formula 6 is selected from the group consisting of L in Table 4 below. P 3, and the extension moiety is thus linked to the peptide backbone using a linker designated as formula 20 via linker L P and Formula 6 as the protractor P.

[0206] Based on the disclosure herein, one of skill in the art will be able to determine, optionally after some limited routine experimentation, the optimal L for use in a specific peptide derivative disclosed herein. P The linker could be determined. [Table 4]

[0207] In some embodiments, the peptide derivative comprises an extension moiety selected from the group presented in Table 5. R1 represents the residue in the peptide backbone to which the extension moiety is attached. [Table 5-1] [Table 5-2]

[0208] In one embodiment, the free lysine is one C 16The diacid gamma-Glu 2xAdo fatty acid moiety (IUPAC name [2-[2-[[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(15-carboxypentadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]) can serve as a conjugation site for attaching the moiety, and thus the peptide derivatives of the invention comprise an extension moiety, which extension moiety is C 16 Diacid (S) gamma-Glu 2xAdo fatty acid moiety.

[0209] In one embodiment, the free lysine is one C 18 The diacid gamma-Glu 2xAdo fatty acid moiety (IUPAC name [2-[2-[[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxypentadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]) can serve as a conjugation site for attaching the moiety, and thus the peptide derivatives of the invention comprise an extension moiety, which extension moiety is C 18 Diacid (S) gamma-Glu 2xAdo fatty acid moiety.

[0210] In one embodiment, the free lysine is one C 20 The diacid gamma-Glu 2xAdo fatty acid moiety (IUPAC name [2-[2-[[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19-carboxypentadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]) can serve as a conjugation site for attaching the moiety, and thus the peptide derivatives of the invention comprise an extension moiety, which extension moiety is C 20 Diacid (S) gamma-Glu 2xAdo fatty acid moiety.

[0211] In one embodiment, the free lysine is one C 18The peptide derivatives of the present invention may serve as a conjugation site for attaching a diacid gamma-Glu fatty acid moiety (IUPAC name [(4S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)butanoyl]), and thus the peptide derivatives of the present invention may comprise an extension moiety, which extension moiety is C 18 It is a diacid (S) gamma-Glu fatty acid moiety.

[0212] In one embodiment, the free lysine is one C 20 The peptide derivatives of the present invention may serve as a conjugation site for attaching a diacid gamma-Glu fatty acid moiety (IUPAC name [(4S)-4-carboxy-4-(19-carboxy-heptadecanoylamino)butanoyl]), and thus the peptide derivatives of the present invention may comprise an extension moiety, which extension moiety is C 20 It is a diacid (S) gamma-Glu fatty acid moiety.

[0213] In a preferred embodiment, the free lysine is one C 18 The diacid gamma-Glu 2xAdo fatty acid moiety (IUPAC name [2-[2-[[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxypentadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]) can serve as a conjugation site for attaching the moiety, and thus the peptide derivatives of the invention comprise an extension moiety, which extension moiety is C 18 Diacid (S) gamma-Glu 2xAdo fatty acid moiety.

[0214] In a preferred embodiment, the free lysine is one C 20 The diacid gamma-Glu 2xAdo fatty acid moiety (IUPAC name [2-[2-[[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19-carboxypentadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]) can serve as a conjugation site for attaching the moiety, and thus the peptide derivatives of the invention comprise an extension moiety, which extension moiety is C 20Diacid (S) gamma-Glu 2xAdo fatty acid moiety.

[0215] In a most preferred embodiment, the free lysine is one C 18 The diacid gamma-Glu 2xAdo fatty acid moiety (IUPAC name [2-[2-[[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxypentadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]) can serve as a conjugation site for attaching the moiety, and thus the peptide derivatives of the invention comprise an extension moiety, which extension moiety is C 18 Diacid (S) gamma-Glu 2xAdo fatty acid moiety.

[0216] Peptide Derivatives As described above, the GLP-1 / GIP / amylin receptor triple agonists of the present invention may comprise a peptide linker and may further comprise an extension moiety. Thus, in another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, which is a peptide according to formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula X (SEQ ID NO: 161): X 21 X 22 X 23 GTFTSDYSX 24 LLEEX 25 AAX 26 EFIX 27 WLX 28 X 29 GGPSX 30 X 31 (X) (In the formula, X 21represents His (H) or Tyr (Y), X 22 represents Aib, X 23 represents Glu(E) or His(H), X 24 represents Ile (I) or Lys (K), X 25 represents Gln(Q) or Ile(I), X 26 represents Arg(R) or Gln(Q), X 27 represents Ala (A), Glu (E), or Gln (Q); X 28 represents Leu (L) or I (Ile), X 29 represents Ala (A) or Gln (Q), X 30 represents Arg (R), Gly (G), Lys (K), or Ser (S); X 31 represents Gly (G), Glu (E), or Lys (K), L1 is a peptide linker, Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XII (SEQ ID NO: 164): AX 32 X 33 LSTAX 34 X 35 X 36 RLSAX 37 LHX 38 LX 39 X 40 X 41 PX 42 TETGSGX 43 P (XII) (In the formula, X 32represents Gly (G) or Ser (S), X 33 represents Gln(Q), Glu(E), His(H), or Lys(K); X 34 represents Ala (A) or Gln (Q), X 35 represents Gln(Q), Leu(L), or Thr(T), X 36 represents Ala (A), Gly (G), or Gln (Q); X 37 represents Glu(E) or Lys(K), X 38 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 39 represents Ala (A) or Lys (K), X 40 represents Asp (D) or Thr (T), X 41 represents Leu (L) or Glu (E), X 42 represents Arg (R) or Lys (K); X 43 represents Ala (A) or Ser (S), The present invention relates to GLP-1 / GIP / amylin receptor triple agonists, wherein the peptide is a peptide derivative containing an extension moiety.

[0217] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), Lys (K), or Ser (S); X5 represents Gly (G) or Lys (K), L1 is a peptide linker, Z2 comprises a C-terminal amide, Formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S), The present invention relates to GLP-1 / GIP / amylin receptor triple agonists, wherein the peptide is a peptide derivative containing an extension moiety.

[0218] In another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R) or Gln(Q), X 54 represents Ala (A), Glu (E), or Gln (Q); X 55 represents Leu (L) or I (Ile), X56 represents Ala (A) or Gln (Q), X 57 represents Gly (G) or Glu (E), L1 is a peptide linker, Z2 comprises a C-terminal amide, Formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Gly (G) or Ser (S), X 59 represents Gln(Q), Glu(E), or His(H); X 60 represents Ala (A) or Gln (Q), X 61 represents Leu (L) or Thr (T), X 62 represents Ala (A), Gly (G), or Gln (Q); X 63 represents Gln(Q), Glu(E), or Lys(K); X 64 represents Leu (L) or Glu (E), The present invention relates to GLP-1 / GIP / amylin receptor triple agonists, wherein the peptide is a peptide derivative containing an extension moiety.

[0219] In yet another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula X (SEQ ID NO: 161): X 21 X 22 X 23 GTFTSDYSX 24 LLEEX 25 AAX 26 EFIX 27 WLX 28 X 29 GGPSX 30 X 31 (X) (In the formula, X 21 represents His (H) or Tyr (Y), X 22 represents Aib, X 23 represents Glu(E) or His(H), X 24 represents Ile (I) or Lys (K), X 25 represents Gln(Q) or Ile(I), X 26 represents Arg(R) or Gln(Q), X 27 represents Ala (A), Glu (E), or Gln (Q); X 28 represents Leu (L) or I (Ile), X 29 represents Ala (A) or Gln (Q), X 30 represents Arg (R), Gly (G), Lys (K), or Ser (S); X 31 represents Gly (G), Glu (E), or Lys (K), L1 is an amino acid sequence according to formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) is a peptide linker comprising or consisting of: is selected from the group consisting of E, GE, APPPSGGGE (SEQ ID NO: 129), AGQAPGQAPG (SEQ ID NO: 136), AGQAPGQAPL (SEQ ID NO: 137), and AGQAPGEAPG (SEQ ID NO: 154); Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XII (SEQ ID NO: 164): AX 32 X 33 LSTAX 34 X 35 X 36 RLSAX 37 LHX 38 LX 39 X 40 X 41 PX 42 TETGSGX 43 P (XII) (In the formula, X 32 represents Gly (G) or Ser (S), X 33 represents Gln(Q), Glu(E), His(H), or Lys(K); X 34 represents Ala (A) or Gln (Q), X 35 represents Gln(Q), Leu(L), or Thr(T), X 36represents Ala (A), Gly (G), or Gln (Q); X 37 represents Glu(E) or Lys(K), X 38 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 39 represents Ala (A) or Lys (K), X 40 represents Asp (D) or Thr (T), X 41 represents Leu (L) or Glu (E), X 42 represents Arg (R) or Lys (K); X 43 represents Ala (A) or Ser (S), The present invention relates to GLP-1 / GIP / amylin receptor triple agonists, wherein the peptide is a peptide derivative containing an extension moiety.

[0220] In yet another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), Lys (K), or Ser (S); X5 represents Gly (G) or Lys (K), L1 is an amino acid sequence according to formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) is a peptide linker comprising or consisting of: is selected from the group consisting of E, GE, APPPSGGGE (SEQ ID NO: 129), AGQAPGQAPG (SEQ ID NO: 136), AGQAPGQAPL (SEQ ID NO: 137), and AGQAPGEAPG (SEQ ID NO: 154); Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S), The present invention relates to GLP-1 / GIP / amylin receptor triple agonists, wherein the peptide is a peptide derivative containing an extension moiety.

[0221] In yet another aspect, the present invention provides a GLP-1 / GIP / amylin receptor triple agonist, comprising a peptide according to Formula I, which comprises one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a compound of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R) or Gln(Q), X 54represents Ala (A), Glu (E), or Gln (Q); X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A) or Gln (Q), X 57 represents Gly (G) or Glu (E), L1 is an amino acid sequence according to formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) is a peptide linker comprising or consisting of: is selected from the group consisting of E, GE, APPPSGGGE (SEQ ID NO: 129), AGQAPGQAPG (SEQ ID NO: 136), AGQAPGQAPL (SEQ ID NO: 137), and AGQAPGEAPG (SEQ ID NO: 154); Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Gly (G) or Ser (S), X 59 represents Gln(Q), Glu(E), or His(H); X 60 represents Ala (A) or Gln (Q), X 61 represents Leu (L) or Thr (T), X 62 represents Ala (A), Gly (G), or Gln (Q); X 63 represents Gln(Q), Glu(E), or Lys(K); X 64 represents Leu (L) or Glu (E), The present invention relates to GLP-1 / GIP / amylin receptor triple agonists, wherein the peptide is a peptide derivative containing an extension moiety.

[0222] The GLP-1 / GIP / amylin receptor triple agonist of the present invention may be a peptide derivative comprising any one of the peptides Z1 disclosed above, any one of the peptides Z2 disclosed above, any one of the peptide linkers L1 disclosed above, and any one of the extension moieties disclosed above. Based on the disclosure herein, one skilled in the art will be able to determine the optimal combination to arrive at a specific peptide derivative that is a potent GLP-1 / GIP / amylin receptor triple agonist with the specific properties described below.

[0223] When tested as described in "GLP-1 Receptor Assay" (preferably Method A; in the absence of HSA), the peptide derivatives disclosed herein have an EC of less than 125 pM, preferably less than 100 pM, for example, less than 75 pM, even more preferably less than 50 pM, for example, less than 40 pM, and most preferably less than 30 pM, for example, less than 20 pM, for example, less than 10 pM, for example, less than 5 pM. 50 It may have a value.

[0224] When tested as described in "GIP Receptor Assay" (preferably Method A; in the absence of HSA), the peptide derivatives disclosed herein have an EC of less than 125 pM, preferably less than 100 pM, for example, less than 75 pM, even more preferably less than 50 pM, for example, less than 40 pM, and most preferably less than 30 pM, for example, less than 20 pM, for example, less than 10 pM, for example, less than 5 pM. 50It may have a value.

[0225] When tested as described in "Amylin Receptor Assay" (preferably Method A; in the absence of HSA), the peptide derivatives disclosed herein have an EC of less than 125 pM, preferably less than 100 pM, for example, less than 75 pM, even more preferably less than 50 pM, for example, less than 40 pM, and most preferably less than 30 pM, for example, less than 20 pM, for example, less than 10 pM, for example, less than 5 pM. 50 It may have a value.

[0226] 2. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, which activates human GIP, GLP-1, and amylin receptors in vitro and has a potency ratio (A / B) of less than 50 when measured without HSA in the assay described in Example 4.

[0227] The balanced GLP-1 / GIP / amylin receptor triple agonists of the present invention activate human GIP, GLP-1, and amylin receptors in vitro, as measured without HSA in the assay described in Example 4, and have a potency ratio (A / B) of less than 50, i.e., the potency (A) of the receptor with the lowest potency divided by the potency (B) of the receptor with the highest potency. The triple agonists disclosed herein may have a potency ratio (A / B) of less than 50, preferably less than 20, e.g., less than 19, less than 18, less than 17, less than 16, even more preferably less than 15, e.g., less than 14, less than 13, less than 12, and most preferably less than 11, e.g., less than 10, less than 9, less than 8, and less than 7. Half-life is an important parameter, as a long half-life indicates that less frequent administration of the compound may be possible. Based on the disclosure herein, one skilled in the art will be able to determine, optionally after some limited routine experimentation, an extension moiety for use in a specific peptide derivative disclosed herein. Thus, in a fourth aspect, the present invention relates to GLP-1 / GIP / amylin receptor triple agonists with improved pharmacokinetic properties. The GLP-1 / GIP / amylin receptor triple agonists or peptide derivatives of the present invention have a long half-life relative to the administration interval, thus reducing the variability of steady-state exposure.

[0228] The in vivo pharmacological effects, including half-life, of the GLP-1 / GIP / amylin receptor triple agonists described herein can be assessed as described in Example 6. In some embodiments, the half-life is the in vivo half-life (t1 / 2) in minipigs after intravenous administration, for example, as described in Example 6. The half-life of a GLP-1 / GIP / amylin receptor triple agonist in an animal subject can be as long as about 100 hours or more. The half-life of a GLP-1 / GIP / amylin receptor triple agonist in an animal subject can be at least 40 hours, preferably at least 100 hours. The half-life of the GLP-1 / GIP / amylin receptor triple agonist may be greater than 40, 45, 55, 60, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, or 140 hours. The half-life of the GLP-1 / GIP / amylin receptor triple agonist may be 40 to 145 hours, for example, 90 to 140 hours, for example, 85 to 125 hours.

[0229] In a fifth aspect, the present invention relates to GLP-1 / GIP / amylin receptor triple agonists that are suitable for once-weekly administration. The GLP-1 / GIP / amylin receptor triple agonists or peptide derivatives of the present invention have a long half-life relative to the dosing interval, thus reducing the variability of steady-state exposure and thus allowing for once-weekly dosing.

[0230] In a sixth aspect, the present invention relates to a GLP-1 / GIP / amylin receptor triple agonist suitable for oral administration. The GLP-1 / GIP / amylin receptor triple agonist is orally bioavailable, i.e., can be present in the bloodstream after each oral administration. Therefore, the compound is suitable for oral administration to a subject in need thereof.

[0231] In a seventh aspect, the present invention relates to a GLP-1 / GIP / amylin receptor triple agonist with improved chemical stability. The term "chemical stability" refers to chemical (especially covalent) changes in the polypeptide structure that result in the formation of chemical degradation products, such as high molecular weight proteins (HMWPs), deamidation, isomerization, and hydrolysis products, which potentially have reduced biological potency and / or increased immunogenicity compared to the intact polypeptide. Chemical stability can be determined by measuring purity loss, e.g., by SEC-HPLC and / or LCMS, e.g., by measuring the amount of chemical degradation products at various time points after exposure to different environmental conditions, as described in Example 7 herein. The GLP-1 / GIP / amylin receptor triple agonist of the present invention has a purity loss per week of less than 10.0 percent, preferably less than 6.0 percent, e.g., 5.0 or 4.0 percent, more preferably less than 3.0 percent, and most preferably less than 1.5 percent, as determined in Example 7 herein, upon incubation at 37°C.

[0232] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonists disclosed herein can reduce food intake in subjects, such as normal-weight rats or DIO rats. Administration of the GLP-1 / GIP / amylin receptor triple agonists disclosed herein can result in a rapid reduction in food intake. The in vivo effect of GLP-1 / GIP / amylin receptor triple agonists on food intake in rats can be evaluated as described in Example 5 or Example 8. A 100% (hypothetical value) reduction in food intake relative to or compared to vehicle means that the rats do not eat.

[0233] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonists disclosed herein may reduce food intake on day 1 (0-24 hours) by at least 10% compared to vehicle, preferably by at least 50% compared to vehicle, for example, by at least 70% compared to vehicle, following a single subcutaneous administration of 10 nmol / kg. The GLP-1 / GIP / amylin receptor triple agonists disclosed herein may reduce food intake on day 1 (0-24 hours) by 1% to 100%, for example, by 15% to 95%, preferably by 40% to 85% compared to vehicle, and even more preferably by 50% to 80% compared to vehicle, following a single subcutaneous administration of 10 nmol / kg.

[0234] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonists disclosed herein may reduce food intake on day 2 (24-48 hours) by at least 15% compared to vehicle, preferably by at least 50% compared to vehicle, e.g., by at least 70% compared to vehicle, following a single subcutaneous administration of 10 nmol / kg. The GLP-1 / GIP / amylin receptor triple agonists disclosed herein may reduce food intake on day 2 (24-48 hours) by 1% to 100%, e.g., 15% to 95%, preferably by 40% to 95% compared to vehicle, and even more preferably by 70% to 95% compared to vehicle, following a single subcutaneous administration of 10 nmol / kg.

[0235] In one embodiment, the GLP-1 / GIP / amylin receptor triple agonists disclosed herein may reduce food intake on day 1 (0-24 hours) by at least 15% compared to vehicle, preferably by at least 35% compared to vehicle, following a single subcutaneous administration of 30 nmol / kg. The GLP-1 / GIP / amylin receptor triple agonists disclosed herein may reduce food intake on day 2 (24-48 hours) by at least 15% compared to vehicle, preferably by at least 35% compared to vehicle, following a single subcutaneous administration of 30 nmol / kg.

[0236] Both the polypeptide backbone and the extension moieties have been engineered and refined to achieve peptide derivatives possessing all of the above properties.

[0237] Preferred GLP-1 / GIP / amylin receptor triple agonists of the present invention are Compound 52, i.e., [ka] Compound 55, i.e., [ka] Compound 58, i.e., [ka] Compound 68, i.e., [ka] Compound 77, i.e., [ka] Compound 101, i.e., [ka] and Compound 210, i.e., [ka] is.

[0238] Pharmaceutically acceptable salts The compounds of the present invention can be in the form of a pharmaceutically acceptable salt or amide.

[0239] A salt is formed, for example, by a chemical reaction between a base and an acid, for example, 2 NH3 + H2SO4 → (NH4)2SO4.

[0240] Salts can be basic salts, acidic salts, or neither (i.e., neutral salts). Basic salts form hydroxide ions in water, and acidic salts form hydronium ions.

[0241] Salts of the compounds of the present invention can be formed with an additional cation or anion between the anionic and cationic groups, respectively, which can be located in the peptide portion and / or the prolonged portion of the compounds of the present invention.

[0242] Non-limiting examples of anionic groups of the compounds of the invention include free carboxylic acid groups, if present, in the extension moiety and in the peptide backbone, which may contain free carboxylic acid groups at internal amino acid residues such as Asp (D) and Glu (E).

[0243] Non-limiting examples of cationic groups within the peptide backbone include the free amino group at the N-terminus, if present, and any free amino groups of internal basic amino acid residues such as His (H), Arg (R), and Lys (K).

[0244] Amides of the compounds of the present invention can be formed, for example, during peptide synthesis (based on the resin used), or by reaction of a free carboxylic acid group with an amine or substituted amine, or by reaction of a free or substituted amino group with a carboxylic acid. The amide formation can be at any free carboxylic acid group in the extension, at the N-terminus of the peptide, and / or at any free or substituted amino group within the peptide backbone.

[0245] In one aspect, the derivatives of the invention are in the form of a pharmaceutically acceptable salt, preferably a trifluoroacetate salt.

[0246] How to generate The triple agonists disclosed herein can be produced by classical peptide synthesis, such as solid-phase peptide synthesis using t-Boc or Fmoc chemistry, or other well-established techniques. See, for example, Greene and Wuts, "Protective Groups in Organic Synthesis," John Wiley & Sons, 1999; Florencio Zaragoza Dorwald, "Organic Synthesis on Solid Phase," Wiley-VCH Verlag GmbH, 2000; and W.C. Chan and P.O. White, eds., "Fmoc Solid Phase Peptide Synthesis," Oxford University Press, 2000. In some embodiments, methods for preparing triple agonists are described herein. In some embodiments, the methods for preparing triple agonists described herein include a step of solid-phase peptide synthesis.

[0247] Also, or alternatively, the compounds, peptide sequences, or portions of peptide sequences can be produced by recombinant methods, for example, by culturing a host cell containing a DNA sequence encoding the triple agonist peptide sequence and capable of expressing the peptide in a suitable nutrient medium under conditions that allow expression of the peptide. Non-limiting examples of host cells suitable for expression of these peptides are Escherichia coli, Saccharomyces cerevisiae, and mammalian BHK or CHO cell lines.

[0248] Triple agonists containing non-natural amino acids and / or covalently attached substituents (extensions) can be produced as described under "General Methods for Peptide Synthesis" in the Experimental Section, or see, for example, Hodgson et al: "The synthesis of peptides and proteins containing non-natural amino acids", Chemical Society Reviews, vol. 33, no. 7 (2004), pp. 422-430.

[0249] The triple agonists described herein containing the extension moiety can be produced, for example, as described in the Experimental Section under "General Methods for Peptide Synthesis." In some embodiments, the extension moiety is constructed as part of solid-phase peptide synthesis or produced separately and attached via a single lysine residue after solid-phase peptide synthesis.

[0250] Specific examples of methods for preparing some of the triple agonists described herein are provided below.

[0251] A further aspect of the present invention relates to methods of preparing the triple receptor agonists described herein.

[0252] In one embodiment, the method for preparing the compounds described herein comprises a process of solid phase peptide synthesis, where the extension moiety is either constructed sequentially as part of the solid phase peptide synthesis or generated separately and attached via a lysine residue after peptide synthesis.

[0253] Pharmaceutical Composition In a further aspect, the present invention relates to pharmaceutical compositions comprising the GLP-1 / GIP / amylin receptor triple agonists. Disclosed herein are pharmaceutical compositions comprising the GLP-1 / GIP / amylin receptor triple agonists disclosed herein and one or more pharmaceutically acceptable excipients. Pharmaceutical compositions comprising the GLP-1 / GIP / amylin receptor triple agonists disclosed herein and one or more pharmaceutically acceptable excipients can be prepared using methods known to those skilled in the art.

[0254] The term "pharmaceutically acceptable excipient" refers to any ingredient in a pharmaceutical composition that is not an active pharmaceutical ingredient or a GLP-1 / GIP / amylin receptor triple agonist disclosed herein. The term "pharmaceutically acceptable excipient" refers to an excipient that is useful in preparing a pharmaceutical composition, including excipients that are generally safe, non-toxic, and acceptable for human pharmaceutical use. Such excipients can be, for example, solid, liquid, or semi-solid.

[0255] Excipients can be functional or inert and can serve a variety of purposes, such as, for example, buffers, tonicity agents, carriers, vehicles, fillers, binders, lubricants, glidants, disintegrants, flow control agents, crystallization inhibitors, solubilizers, stabilizers, colorants, flavoring agents, surfactants, emulsifiers, or combinations thereof, and / or to improve administration and / or absorption of the active pharmaceutical ingredient. The amount of each excipient used can vary within ranges conventional in the art.

[0256] Techniques and excipients that can be used are described, for example, in the Handbook of Pharmaceutical Excipients (e.g., thedition, Sheskey et al., Eds., American Pharmaceuticals Association and Pharmaceutical Press, publications department of the Royal Pharmaceutical Society of Great Britain (2017) and subsequent editions), and Remington: The Science and Practice of Pharmacy (e.g., 23 rd edition, Remington and Allen, Eds., Pharmaceutical Press (2021) and subsequent editions).

[0257] Pharmaceutical compositions comprising the GLP-1 / GIP / amylin receptor triple agonists disclosed herein may be for oral administration.

[0258] Pharmaceutical compositions comprising the GLP-1 / GIP / amylin receptor triple agonists disclosed herein can be prepared, for example, as a solid pharmaceutical composition containing the active pharmaceutical ingredient as a freeze-dried or spray-dried composition (e.g., Tablet or capsule) and may be used as is, dissolved before use, or combined with excipients in a formulation.

[0259] The pharmaceutical composition may be a solid pharmaceutical composition comprising a compound disclosed herein, a salt of N-[8-(2-hydroxybenzoyl)amino]caprylate, preferably sodium N-(8-(2-hydroxybenzoyl)amino)caprylate, and one or more additional excipients, as described in the art. For example, the solid pharmaceutical composition may be as described in WO 2012 / 080471, WO 2013 / 139694, WO 2013 / 189988, WO 2019 / 149880, WO 2019 / 215063, WO 2021 / 219710, or WO 2023 / 012263 A1.

[0260] Alternatively, pharmaceutical compositions comprising the GLP-1 / GIP / amylin receptor triple agonists disclosed herein can be liquid compositions, such as aqueous compositions, which can be suitable for oral administration or for parenteral administration, e.g., intravenous, intramuscular, or subcutaneous administration.

[0261] Liquid compositions suitable for injection can be prepared using conventional techniques in the pharmaceutical industry, involving dissolving and mixing components as needed to produce desired final product.Thus, according to a procedure, the compounds described herein are dissolved in a suitable buffer solution at a suitable pH.The composition can be sterilized, for example, by sterile filtration.The techniques and excipients that can be used to prepare liquid formulations can be found, for example, in Handbook of Pharmaceutical Excipients (e.g., 8 th edition, Sheskey et al., Eds., American Pharmaceuticals Association and Pharmaceutical Press, publications department of the Royal Pharmaceutical Society of Great Britain (2017) and subsequent editions), and Remington: The Science and Practice of Pharmacy (e.g., 23 rd (Remington and Allen, Eds., Pharmaceutical Press (2021) and later editions). Preferably, in embodiments where the pharmaceutical composition is in a liquid formulation, the liquid formulation provides improved stability.

[0262] Pharmaceutical compositions are typically administered to subjects who already suffer from diseases such as the indications described below in an amount sufficient to cure, alleviate, or partially prevent the disease and its complications.The amount sufficient to achieve this is defined as "therapeutically effective amount".As understood by those skilled in the art, the amount effective for this purpose depends on the severity of the disease and the weight and general condition of the subject.

[0263] In some embodiments, the dose of compound delivered by subcutaneous administration can be about 0.1 mg to 500 mg of compound per day, preferably about 0.5 mg to 150 mg per day, every other day, every third day, every fourth day, every fifth day, or once a week, depending on the severity of the condition.

[0264] The appropriate dose can also be adjusted for a particular compound based on its characteristics, including its in vivo half-life or mean residence time and its biological activity. For example, the delivered compound can be administered once daily in one embodiment, or once weekly in another embodiment. Thus, the pharmaceutical composition can be used for administration approximately once daily, for example, once every 12 to 36 hours, for example, once every 18 to 30 hours, for example, approximately once every 24 hours, or approximately once weekly, for example, once every 6 to 8 days.

[0265] In one embodiment, the invention relates to an injection device containing the pharmaceutical composition.

[0266] Indications In a further aspect, the present invention relates to a GLP-1 / GIP / amylin receptor triple agonist disclosed herein for use as a pharmaceutical.

[0267] The GLP-1 / GIP / amylin receptor triple agonists disclosed herein are It may be used for the following medical treatments or indications: (i) prevention and / or treatment of all forms of diabetes, including hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, non-insulin-dependent diabetes, MODY (maturity-onset diabetes of the young), and gestational diabetes, and / or reduction of HbA1c; (ii) delaying or preventing the progression of diabetic disease, such as the progression of type 2 diabetes, delaying the progression from impaired glucose tolerance (IGT) to insulin-requiring type 2 diabetes, and / or delaying the progression from insulin-nonrequiring type 2 diabetes to insulin-requiring type 2 diabetes; (iii) prevention and / or treatment of eating disorders such as obesity, for example, by reducing food intake, reducing weight, suppressing appetite to induce satiety, treatment or prevention of binge eating, food cravings, bulimia nervosa and / or obesity induced by the administration of antipsychotic drugs or steroids, reducing gastric motility and / or delaying gastric emptying; (iv) weight maintenance after successful weight loss (drug-induced or diet and exercise-induced), i.e., prevention of weight gain after successful weight loss; (v) prevention and / or treatment of cardiovascular disease, such as delaying or reducing the occurrence of major adverse cardiovascular events (MACE) selected from the group consisting of cardiovascular death, non-fatal myocardial infarction, non-fatal stroke, revascularization, hospitalization for unstable angina, and hospitalization for heart failure; (vi) prevention and / or treatment of non-alcoholic fatty liver disease (NAFLD, also known as metabolic dysfunction-associated fatty liver disease, MAFLD) and / or non-alcoholic steatohepatitis (NASH, also known as metabolic dysfunction-associated steatohepatitis, MASH); (vii) prevention and / or treatment of cognitive impairment, such as that caused by Alzheimer's disease; (viii) prevention and / or treatment of chronic kidney disease; (ix) Prevention and / or treatment of obstructive sleep apnea.

[0268] In some embodiments, the indication is (i). In some embodiments, the indication is (ii). In still further particular aspects, the indication is (iii). In some embodiments, the indication is (iv). In some embodiments, the indication is (v). In some embodiments, the indication is (vi). In some embodiments, the indication is (vii). In some embodiments, the indication is (viii). In some embodiments, the indication is (ix). In some embodiments, the indication is type 2 diabetes. In some embodiments, the indication is overweight or obesity.

[0269] The term "treatment" as used herein refers to the medical therapy of any human or other vertebrate subject in need of treatment. The subject is expected to have undergone a physical examination by a physician or veterinarian who has provided a provisional or definitive diagnosis indicating that the use of the particular treatment will be beneficial to the health of the human or other vertebrate. The timing and purpose of the treatment may vary from individual to individual, depending on the subject's current health status. Thus, the treatment may be prophylactic (preventive), palliative, symptomatic, and / or curative.

[0270] In some embodiments, the indications are (i) and (iii). In some embodiments, the indications are (ii) and (iii).

[0271] The World Health Organization (WHO) defines overweight and obesity as an abnormal or excessive accumulation of body fat that poses a risk to an individual's overall health. Generally, all subjects suffering from obesity are considered to also suffer from overweight. A subject suffering from obesity can be a human, such as an adult or a child, where "child" includes infants, toddlers, and adolescents. The term pre-obese is also used in the field as an alternative to overweight. The WHO considers body mass index (BMI) to be the most convenient population-level measure of overweight and obesity. Body mass index (BMI) is a measure of body fat based on height and weight. The formula for calculation is BMI = body weight in kilograms (kg) / m 2 ) units of height.

[0272] For adults, the WHO defines overweight and obesity as follows: overweight means having a BMI of 25 or greater, and obese means having a BMI of 30 or greater.

[0273] For children, the WHO takes age into account when defining overweight and obesity. For children under 5 years of age, overweight means having a weight-for-height that is more than two standard deviations below the median of the WHO Child Growth Standards, and obesity means having a weight-for-height that is more than three standard deviations below the median of the WHO Child Growth Standards. Overweight and obesity are defined for children 5-19 years of age as follows: overweight means having a BMI-for-age that is more than one standard deviation below the median of the WHO Child Growth Standards, and obesity means having a BMI-for-age that is more than two standard deviations below the median of the WHO Child Growth Standards.

[0274] Nevertheless, as illustrated in Table 16 below for adults, diagnostic criteria for underweight, normal range, pre-obese / overweight, and obesity may vary between countries / populations. [Table 6]

[0275] Guidelines for Asian populations were published by Misra A et al. J Assoc Physicians India. 2009;57:163-70.

[0276] Guidelines for the Chinese population were published in the 2006 edition of Guidelines for Prevention and Control of Overweight and Obesity in Chinese Adults, compiled by the Chinese Working Group on Obesity.

[0277] Guidelines for Japanese people were published in 2016 by the Japanese Society for the Study of Obesity (JASSO) in Guidelines for the management of obesity disease.

[0278] Guidelines for the Taiwanese population were published in 2023 by the Taiwanese government's Health Promotion Administration (HPA), Ministry of Health and Welfare, in the second edition of its "Evidence-Based Guideline on Adult Obesity Prevention and Management."

[0279] In some embodiments, the subject suffering from obesity is a human, such as an adult or child (including infants, toddlers, and adolescents). Thus, a human subject suffering from obesity may have a BMI of 25 or greater, or 27 or greater, or 28 or greater, or 30 or greater, and the subject may also be referred to as being obese. The obesity may be Class I, Class II, Class III, or Class IV obesity (as defined in Table 16). In some embodiments, a human subject suffering from obesity may have a BMI of ≥35 or a BMI in the range of ≥30 to <40. In some embodiments, the obesity is severe obesity or morbid obesity, and the human subject may have a BMI of ≥40.

[0280] In some embodiments, the present invention relates to a method for the treatment or prevention of overweight, optionally in the presence of at least one weight-related comorbidity. In one embodiment, the GLP-1 / GIP / amylin receptor triple agonist disclosed herein is for use in treating a subject with an initial body mass index (BMI) of 25 or greater, 27 or greater, or 28 or greater, or 30 or greater, optionally in the presence of at least one weight-related comorbidity.

[0281] In some embodiments, the present invention relates to the use of a formulation for the treatment or prevention of overweight, optionally in the presence of at least one weight-related comorbidity. In some embodiments, the overweight subject is a human, such as an adult or child (including infants, toddlers, and adolescents). An overweight adult human subject may have a BMI of 23 or greater, or 24 or greater, or 25 or greater, or 27 or greater. In some embodiments, an overweight human subject has a BMI within the range of 24 to <27, 24 to <28, 25 to <30, or 27 to <30. In some embodiments, the weight-related comorbidity is selected from the group consisting of hypertension, dysglycemia (such as prediabetes or type 2 diabetes), dyslipidemia, high cholesterol, cardiovascular disease, and obstructive sleep apnea.

[0282] In some embodiments, the triple agonists disclosed herein relate to methods for weight management, hi some embodiments, the triple agonists disclosed herein relate to methods for appetite reduction, hi some embodiments, the triple agonists disclosed herein relate to methods for food intake reduction, hi some embodiments, the triple agonists disclosed herein relate to methods for preventing or treating overweight in a subject.

[0283] The term "weight reduction" may include the treatment or prevention of obesity and / or overweight.

[0284] Administration of the compounds disclosed herein can be as an adjunct to a reduced calorie diet and increased physical activity in adult subjects suffering from obesity, i.e., with an initial body mass index (BMI) of 25 or greater, or 27 or greater, or 28 or greater, or 30 or greater, or in adult subjects suffering from overweight, i.e., with an initial body mass index (BMI) of 23 or greater, or 24 or greater, or 25 or greater, or 27 or greater, optionally in the presence of at least one weight-related comorbidity (e.g., hypertension, dysglycemia (prediabetes or type 2 diabetes), dyslipidemia, high cholesterol, cardiovascular disease, or obstructive sleep apnea).

[0285] How to generate The compounds disclosed herein can be produced, for example, by classical peptide synthesis, such as solid-phase peptide synthesis using t-Boc or Fmoc chemistry, or other well-established techniques. See, for example, Greene and Wuts, "Protective Groups in Organic Synthesis," John Wiley & Sons, 1999; Florencio Zaragoza Dorwald, "Organic Synthesis on Solid Phase," Wiley-VCH Verlag GmbH, 2000; and WCChan and POWhite, eds., "Fmoc Solid Phase Peptide Synthesis," Oxford University Press, 2000.

[0286] Alternatively, the compounds can be produced by recombinant methods, for example, by culturing host cells containing a DNA sequence encoding the peptide sequence and capable of expressing the peptide in a suitable nutrient medium under conditions that allow expression of the peptide. Non-limiting examples of host cells suitable for expression of these peptides are Escherichia coli, Saccharomyces cerevisiae, and mammalian BHK or CHO cells. Specific examples of methods for preparing the disclosed compounds are included in the Examples.

[0287] A further aspect of the present invention relates to methods for preparing the peptides described herein. In one embodiment, the method for preparing the compounds described herein comprises a step of solid-phase peptide synthesis. The extension moiety can be constructed continuously as part of the solid-phase peptide synthesis or generated separately and attached via a lysine residue after peptide synthesis.

[0288] Specific Embodiments 1. A GLP-1 / GIP / amylin receptor triple agonist, a peptide according to formula I, containing one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a member of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, L1 is a peptide linker; Z2 is a C-terminal amide and a group of formula III (SEQ ID NO: 2): A GLP-1 / GIP / amylin receptor triple agonist, a peptide containing up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III). 2. peptide Z1 comprises an amino acid sequence having at least 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to Formula II (SEQ ID NO:1); 2. The GLP-1 / GIP / amylin receptor triple agonist of embodiment 1, wherein peptide Z2 comprises an amino acid sequence having at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% identity to Formula III (SEQ ID NO:2). 3. A GLP-1 / GIP / amylin receptor triple agonist, a peptide according to formula I, containing one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a member of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula X (SEQ ID NO: 161): X 21 X 22 X 23 GTFTSDYSX 24 LLEEX 25 AAX 26 EFIX 27 WLX 28 X 29 GGPSX 30 X 31 (X) (In the formula, X 21 represents His (H) or Tyr (Y), X 22 represents Aib, X 23 represents Glu(E) or His(H), X 24 represents Ile (I) or Lys (K), X 25 represents Gln(Q) or Ile(I), X 26 represents Arg(R) or Gln(Q), X 27 represents Ala (A), Glu (E), or Gln (Q); X 28 represents Leu (L) or I (Ile), X 29 represents Ala (A) or Gln (Q), X 30 represents Arg (R), Gly (G), Lys (K), or Ser (S); X 31 represents Gly (G), Glu (E), or Lys (K), L1 is a peptide linker; Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XII (SEQ ID NO: 164): AX 32 X 33 LSTAX 34 X 35 X 36 RLSAX 37 LHX 38 LX 39 X 40 X 41 PX 42 TETGSGX 43 P (XII) (In the formula, X 32 represents Gly (G) or Ser (S), X 33 represents Gln(Q), Glu(E), His(H), or Lys(K); X 34 represents Ala (A) or Gln (Q), X 35 represents Gln(Q), Leu(L), or Thr(T), X 36 represents Ala (A), Gly (G), or Gln (Q); X 37 represents Glu(E) or Lys(K), X 38 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 39 represents Ala (A) or Lys (K), X 40 represents Asp (D) or Thr (T), X 41 represents Leu (L) or Glu (E), X42 represents Arg (R) or Lys (K); X 43 represents Ala (A) or Ser (S)). 4. The GLP-1 / GIP / amylin receptor triple agonist of embodiments 1 to 3, wherein one lysine (Lys, K) residue is present in peptide Z1 or peptide Z2. 5. The GLP-1 / GIP / amylin receptor triple agonist of embodiments 1-4, wherein the GLP-1 / GIP / amylin receptor triple agonist does not contain a cysteine ​​(Cys, C) residue. 6. The GLP-1 / GIP / amylin receptor triple agonist of embodiments 1-5, wherein the GLP-1 / GIP / amylin receptor triple agonist does not contain any disulfide bridges. 7. Z1 is a member of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), Lys (K), or Ser (S); X5 represents Gly (G) or Lys (K), L1 is a peptide linker; Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S). 8. Z1 is a member of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R) or Gln(Q), X 54 represents Ala (A), Glu (E), or Gln (Q); X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A) or Gln (Q), X 57 represents Gly (G) or Glu (E), L1 is a peptide linker; Z2 comprises a C-terminal amide and has formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Gly (G) or Ser (S), X 59represents Gln(Q), Glu(E), or His(H); X 60 represents Ala (A) or Gln (Q), X 61 represents Leu (L) or Thr (T), X 62 represents Ala (A), Gly (G), or Gln (Q); X 63 represents Gln(Q), Glu(E), or Lys(K); X 64 represents Leu (L) or Glu (E). 9. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 1 to 8, wherein the peptide linker L1 comprises 1 to 14, 1 to 10, 4 to 10, or 9 to 10 amino acid residues. 10. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 1 to 9, wherein the peptide linker L1 comprises 1 to 14 amino acid residues selected from the group consisting of Ala (A), Glu (E), Gln (Q), Gly (G), Leu (L), Phe (F), Pro (P), Ser (S), Thr (T), Val (V), Asn (N). 11. The peptide linker L1 has an amino acid sequence according to formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) (In the formula, X1 represents Ala (A), Glu (E), or Gly (G), X2 represents Gln(Q), Glu(E), Gly(G), Leu(L), Pro(P), or is absent; X3 represents Ala (A), Gln (Q), Glu (E), Gly (G), Pro (P), or is absent; X4 represents Ala (A), Gln (Q), Glu (E), Gly (G), Pro (P), or is absent; X5 represents Glu(E), Gly(G), Pro(P), Ser(S), Thr(T) or is absent; X6 represents Glu(E), Gly(G), Leu(L), Gln(Q), or is absent; X7 represents Ala (A), Gln (Q), Glu (E), Gly (G), Phe (F), or is absent; X8 represents Ala (A), Gln (Q), Glu (E), Gly (G), Thr (T), Pro (P), Val (V), or is absent; X9 represents Glu(E), Asn(N), Pro(P), Thr(T) or is absent; X 10 represents Ala (A), Gln (Q), Glu (E), Gly (G), Leu (L), Pro (P), Ser (S), Val (V), or is absent; X 11 represents Ala (A) or is absent, X 12 represents Gln(Q) or is absent, X 13 represents Thr(T) or is absent, X 14 represents Leu (L) or is absent). 12. The peptide linker L1 has an amino acid sequence according to formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) These include A, E, G, AE, GE, APPE (SEQ ID NO: 125), GGGE (SEQ ID NO: 126), AGQAPG (SEQ ID NO: 127), APPPSGGG (SEQ ID NO: 128), APPPSGGGE (SEQ ID NO: 129), APPPSGGGG (SEQ ID NO: 130), ALAQTLAQTL (SEQ ID NO: 131), ALAQTLFVNQ (SEQ ID NO: 132), ALAQTLGTNE (SEQ ID NO: 133), ALQAPGQAPG (SEQ ID NO: 134), ALQTLAQTL (SEQ ID NO: 135), ALQTLFVNQ (SEQ ID NO: 136), ALQTLGTNE (SEQ ID NO: 137), ALQTLAQTL (SEQ ID NO: 138), ALQTLGTNE (SEQ ID NO: 139), ALQTLAQTL (SEQ ID NO: 140), ALQTLGTNE (SEQ ID NO: 141), ALQTLGTNE (SEQ ID NO: 142), ALQTLGTNE (SEQ ID NO: 143), ALQTLGTNE (SEQ ID NO: 144), ALQTLGTNE (SEQ ID NO: 145), ALQTLGTNE (SEQ ID NO: 146), ALQTLGTNE (SEQ ID NO: 147), ALQTLGTNE (SEQ ID NO: 148), ALQTLGTNE (SEQ ID NO: 149), ALQTLGTNE (SEQ ID NO: 150), ALQTLGTNE (SEQ ID NO: 151), ALQTLGTNE (SEQ ID NO: 152), ALQTLGTNE (SEQ ID NO: 153), ALQTLGT Sequence number 134), ALQAPGQAPL (SEQ ID NO: 135), AGQAPGQAPG (SEQ ID NO: 136), AGQAPGQAPL (SEQ ID NO: 137), GGGEGGGEGE (SEQ ID NO: 138), GQAPGQAPGE (SEQ ID NO: 139), GQEPGQEPGE (SEQ ID NO: 140), APPPSLAQTLAQTL (SEQ ID NO: 141), AG, AGGGG (SEQ ID NO: 142), AGEAPGQAPG (SEQ ID NO: 143) , AGEAPGEAPG (SEQ ID NO: 144), AGQAPGQAPA (SEQ ID NO: 145), AGQAPGQAPE (SEQ ID NO: 146), AGQAPGQAPP (SEQ ID NO: 147), AGQAPGQAPS (SEQ ID NO: 148), AGQAPGQAPV (SEQ ID NO: 149), EGQAPGQAPG (SEQ ID NO: 150), AGQEPGQAPG (SEQ ID NO: 151), AGQAEGQAPG (SEQ ID NO: 152), AGQAPEQ 12. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 1 to 11, selected from the group consisting of AGQAPGEAPG (SEQ ID NO: 153), AGQAPGQEPG (SEQ ID NO: 154), AGQAPGQAEG (SEQ ID NO: 156), AGQEPGQEPG (SEQ ID NO: 157), AGQAPGQAP (SEQ ID NO: 158), and AGQAPGEAPL (SEQ ID NO: 159). 13. Amino acid sequence according to Formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) is selected from the group consisting of E, GE, APPPSGGGE (SEQ ID NO: 129), AGQAPGQAPG (SEQ ID NO: 136), AGQAPGQAPL (SEQ ID NO: 137), and AGQAPGEAPG (SEQ ID NO: 154). 14. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S). 15. Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Lys(K), X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Thr(T), or Tyr(Y); X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S), or X6 represents Gln(Q), Glu(E), or His(H); X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Thr(T), or Tyr(Y); X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S), or X6 represents Gln(Q), Glu(E), or His(H); X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Lys(K), X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S), or X6 represents Gln(Q), Glu(E), or His(H); X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Thr(T), or Tyr(Y); X 12 represents Lys(K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S), or X6 represents Gln(Q), Glu(E), or His(H); X7 represents Ala (A) or Gln (Q), X8 represents Gln(Q), Leu(L), or Thr(T), X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Thr(T), or Tyr(Y); X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Lys(K), X 15 represents Ala (A) or Ser (S). 16. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1X2X3 represents YAibE (Tyr-Aib-Glu) or HAibH (His-Aib-His), X4 represents Arg (R), Gly (G), or Ser (S); 16. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 1 to 7 and 9 to 15, comprising or consisting of: X5 represents Gly (G). 17. Peptide Z1 has the amino acid sequence according to formula V (SEQ ID NO: 6): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSX4G (V) (In the formula, X2 represents Aib, X4 is Arg(R) or Ser(S). 18. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Glu(E) or His(H), X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg (R), Gln (Q), or Lys (K); X 12 represents Ala (A) or Lys (K), X 13 represents Thr(T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S). 19. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Glu(E) or His(H), X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Lys(K), X 12 represents Ala (A), X 13 represents Thr(T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S). 20. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), Peptide Z2 has the amino acid sequence according to formula VIII (SEQ ID NO: 9): 20. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 9 to 15, 18, and 19, comprising or consisting of ASHLSTAQTQRLSAELHKLATLPRTETGSGSP (VIII). 21. The amino acid sequence of peptide Z1-L1-Z2 is YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPGASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 62), or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPLASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 68), or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSRGEASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 78), or YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPLASHLSTAQTQRLSAELHKLATLPRTETGSGSP (SEQ ID NO: 87), 21. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 1 to 7 and 9 to 20, comprising or consisting of: wherein in each amino acid sequence, X represents Aib. twenty two. Peptide Z2 has the amino acid sequence according to formula VII (SEQ ID NO: 8): The GLP-1 / GIP / amylin receptor triple agonist according to embodiment 16 or 17, comprising or consisting of ASHLSTAQTQRLSAKLHRLATLPRTETGSGSP (VII). twenty three. The amino acid sequence of peptide Z1-L1-Z2 is 23. The GLP-1 / GIP / amylin receptor triple agonist of embodiment 22, comprising or consisting of: YXEGTFTSDYSILLEEQAAREFIEWLLAGGPSSGAGQAPGQAPGASHLSTAQTQRLSAKLHRLATLPRTETGSGSP (SEQ ID NO: 65). twenty four. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents His(H), X7 represents Ala (A) or Gln (Q); X8 represents Leu (L) or Thr (T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R) or Gln(Q), X 12 represents Lys(K), X 13 represents Thr(T), X 14 represents Arg(R), X 15 represents Ser(S). 25. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents His(H), X7 represents Ala (A) or Gln (Q); X8 represents Leu (L) or Thr (T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), X 12 represents Ala (A), X 13 represents Thr(T), X 14 represents Lys(K), X 15 represents Ser(S). 26. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents His(H), X7 represents Gln(Q), X8 represents Thr(T), X9 represents Gln(Q), X 10 represents Glu(E), X 11 represents Arg (R) or Lys (K); X 12 represents Ala (A) or Lys (K), X 13 represents Thr(T), X 14 represents Arg (R) or Lys (K); X 15 represents Ser(S). 27. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H), X2 represents Aib, X3 represents His (H), X4 represents Arg (R), Gly (G), Lys (K), or Ser (S); X5 represents Gly (G), Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S). 28. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His; X2 represents Aib, X3 represents His (H), X4 represents Lys(K), X5 represents Gly (G), Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Glu(E) or His(H), X7 represents Ala (A) or Gln (Q); X8 represents Leu (L) or Thr (T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Arg(R), Gln(Q), or Glu(E); X 12 represents Ala (A), X 13 represents Asp (D) or Thr (T), X 14 represents Arg(R), X 15 represents Ser(S). 29. In Formula IIIa (SEQ ID NO: 4): X6 represents Glu(E) or His(H), X7 represents Ala (A) or Gln (Q); X8 represents Leu (L) or Thr (T); X9 represents Ala (A) or Gly (G), X 10 represents Glu(E), X 11represents Arg(R), Gln(Q), or Glu(E); X 12 represents Ala (A), X 13 represents Thr(T), X 14 represents Arg(R), X 15 The GLP-1 / GIP / amylin receptor triple agonist according to embodiment 27 or embodiment 28, wherein represents Ser(S). 30. 30. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 27-29, wherein the amino acid sequence of peptide Z1-L1-Z2 comprises or consists of HXHGTFTSDYSILLEEQAAREFIEWLLAGGPSKGAPPPSGGGEASHLSTAQTARLSAELHQLATLPRTETGSGSP (SEQ ID NO: 111), wherein X represents Aib. 31. 14. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 1 to 7 and 9 to 13, wherein peptide Z1-L1-Z2 comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 20 to 124, wherein X represents Aib. 32. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 19, 20, 24, 25, 26, 27, or 28, wherein X1 represents His (H). 33. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 18, 19, 20, 24, 25, or 26, wherein X1 represents Tyr(Y). 34. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 19, 20, 24, 25, or 26, wherein X3 represents Glu(E). 35. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 18, 19, 20, 24, 25, 26, 27, or 28, wherein X3 represents His (H). 36. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 16, 17, 18, 19, 20, 24, 25, 26, or 27, wherein X4 represents Arg(R). 37. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 16, 18, 19, 20, 24, 25, 26, or 27, wherein X4 represents Gly(G). 38. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 27, or 28, wherein X4 represents Lys(K). 39. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 16, 17, 18, 20, 20, 24, 25, 26, or 27, wherein X4 represents Ser(S). 40. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 16, 18, 19, 20, 24, 25, 26, 27, or 28, wherein X5 represents Gly(G). 41. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, or 27, wherein X5 represents Lys(K). 42. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, or 27, wherein X6 represents Gln(Q). 43. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 18, 19, 27, 28, or 29, wherein X6 represents Glu(E). 44. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 16, 19, 24, 25, 26, 27, 28, or 29, wherein X6 represents His (H). 45. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, or 27, wherein X6 represents Lys(K). 46. ​​The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 18, 19, 24, 25, 26, 27, 28, or 29, wherein X7 represents Ala (A). 47. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 17, 19, 24, 25, 26, 27, 28, or 29, wherein X7 represents Gln(Q). 48. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 18, 19, or 27, wherein X8 represents Gln(Q). 49. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 18, 19, 24, 25, 27, 28, or 29, wherein X8 represents Leu(L). 50. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 18, 19, 24, 25, 26, 27, 28, or 29, wherein X8 represents Thr (T). 51. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 18, 19, 24, 25, 27, 28, or 29, wherein X9 represents Ala (A). 52. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 18, 19, 24, 25, 26, 27, 28, or 29, wherein X9 represents Gly(G). 53. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 18, 19, 24, 25, 26, 27, or 28, wherein X9 represents Gln(Q). 54. X 10 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, 19, 24, 25, 26, 27, 28, or 29, wherein represents Glu(E). 55. X 10 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, or 27, wherein represents Lys(K). 56. X 11 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, 24, 25, 26, 27, 28, or 29, wherein represents Arg(R). 57. X 11 The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 18, 24, 27, 28, or 29, wherein represents Gln(Q). 58. X 11 The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, 27, 28, or 29, wherein represents Glu(E). 59. X 11 The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, or 27, wherein represents Gly(G). 60. X 11 The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, or 27, wherein represents His(H). 61. X 11 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, 19, 26, or 27, wherein represents Lys(K). 62. X 11 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, or 27, wherein represents Thr (T). 63. X 11 The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 7, 14, 15, or 27, wherein represents Tyr(Y). 64. X 12 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, 19, 25, 26, 27, 28, or 29, wherein represents Ala (A). 65. X 12The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, 24, 26, or 27, wherein represents Lys(K). 66. X 13 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 27, or 28, wherein represents Asp(D). 67. X 13 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 16, 18, 24, 25, 26, 27, 28, or 29, wherein represents Thr (T). 68. X 14 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, 19, 24, 26, 27, 28, or 29, wherein represents Arg(R). 69. X 14 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, 25, 26, or 27, wherein represents Lys(K). 70. X 15 The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, 19, or 27, wherein represents Ala (A). 71. X 15 30. The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 7, 14, 15, 18, 19, 23, 24, 25, 26, 27, 28, or 29, wherein represents Ser(S). 72. Peptide Z1 has the amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52represents Ile (I) or Lys (K), X 53 represents Arg(R), X 54 represents Glu(E), X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A), X 57 represents Gly(G) or Glu(E). 73. Peptide Z2 has the amino acid sequence according to formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Ser(S), X 59 represents His(H), X 60 represents Gln(Q), X 61 represents Thr(T), X 62 represents Gln(Q), X 63 represents Lys(K), X 64 represents Leu (L). 74. Peptide Z1 has the amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R), X 54 represents Glu(E), X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A), X 57 represents Gly (G) or Glu (E), Peptide Z2 has the amino acid sequence according to formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Ser(S), X 59 represents His(H), X 60 represents Gln(Q), X 61 represents Thr(T), X 62 represents Gln(Q), X 63 represents Lys(K), X 64 The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 8, 72, or 73, comprising or consisting of: 75. Peptide Z1 has the amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R), X 54 represents Glu(E), X 55 represents Leu(L), X 56 represents Ala (A), X 57 represents Gly(G)). 76. Peptide Z1 has the amino acid sequence according to formula XI (SEQ ID NO: 163): YX 51 EGTFTSDYSX 52 LLEEIAAREFIEWLLAGGPSSG (XI) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K). 77. Peptide Z2 has the amino acid sequence according to formula XIII (SEQ ID NO: 166): ASX 59 LSTAQTQRLSAELHKLATLPRTETGSGSP (XIII) (In the formula, X 59represents Glu(E) or His(H). 78. 14. The GLP-1 / GIP / amylin receptor triple agonist of any one of embodiments 1 to 7 and 9 to 13, wherein peptide Z1-L1-Z2 comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 170 to 242, wherein X represents Aib. 79. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, wherein the backbone of peptide Z1-L1-Z2 comprises 66 to 80 amino acid residues. 80. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, wherein the backbone of peptide Z1-L1-Z2 comprises 67, 68, 75, or 76 amino acid residues, preferably 76 amino acid residues. 81. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, wherein the peptide is a peptide derivative comprising an extension moiety. 82. The peptide is a peptide derivative containing an extension, and the extension is C 12 ~C 20 2. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, comprising the diacid Protractor P. 83. The peptide is a peptide derivative comprising an extension, the extension being [ka] 10. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, comprising a protractor P selected from the group consisting of: 84. The peptide is a peptide derivative containing an extension, and the extension is C 16 diacid, C 18 diacid, C 20 diacid, and C 19 and a protractor P selected from the group consisting of phosphonic acids, preferably the protractor P is C18 Diacid or C 20 The GLP-1 / GIP / amylin receptor triple agonist according to any one of the preceding embodiments, wherein the GLP-1 / GIP / amylin receptor triple agonist is a diacid. 85. A GLP-1 / GIP / amylin receptor triple agonist according to any one of the preceding embodiments, wherein the peptide is a peptide derivative comprising an extension moiety, and the extension moiety is attached to the epsilon position of one lysine (Lys, K) residue. 86. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, wherein the peptide is a peptide derivative comprising an extension moiety, and the extension moiety is attached to the epsilon position of a lysine (Lys, K) residue in peptide Z1 or to the epsilon position of a lysine (Lys, K) residue in peptide Z2. 87. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, wherein the peptide is a peptide derivative comprising an extension moiety, and the extension moiety is attached to the epsilon position of a lysine (Lys, K) residue at position 12, or 33, or 34 of peptide Z1, preferably at position 12 or 33 of peptide Z1. 88. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, wherein the peptide is a peptide derivative comprising an extension moiety, and the extension moiety is attached to the epsilon position of a lysine (Lys, K) residue at position 3, or 15, or 18, or 20, or 24 of peptide Z2. 89. A GLP-1 / GIP / amylin receptor triple agonist according to any one of the preceding embodiments, wherein the peptide is a peptide derivative comprising an extension moiety, and the extension moiety is attached to the epsilon position of the lysine (Lys, K) residue at position 15 of peptide Z2 or at position 18 of peptide Z2. 90. The peptide is a peptide derivative comprising an extension, and the extension is linked to a linker L P And, [ka] 10. The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, comprising a linker selected from the group consisting of: 91. The peptide is a peptide derivative containing an extension moiety, and the extension moiety is a peptide derivative containing a linker L P and wherein the protractor P is selected from the group consisting of Formula 5 and Formula 6. 92. The peptide is a peptide derivative containing an extension moiety; The extension comprises: (i) a linker L selected from the group presented in Table 4 P and (ii) a protractor P selected from the group presented in Table 3, wherein preferably the protractor moiety is selected from the group presented in Table 5. 93. The peptide is a peptide derivative containing an extension, and the extension is C 18 Diacid (S) gamma-Glu 2xAdo fatty acid moiety (chemical formula 28) or C 20 The GLP-1 / GIP / amylin receptor triple agonist of any one of the preceding embodiments, which is a diacid (S) gamma-Glu 2xAdo fatty acid moiety (Formula 27). 94. Peptide Z1 has the amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), or Ser (S); X5 represents Gly (G), The peptide linker L1 has an amino acid sequence according to formula IV: X1X2X3X4X5X6X7X8X9X 10 X11 X 12 X 13 X 14 (IV) is selected from the group consisting of E, GE, APPPSGGGE (SEQ ID NO: 129), AGQAPGQAPG (SEQ ID NO: 136), and AGQAPGQAPL (SEQ ID NO: 137); Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14 represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S), 2. The GLP-1 / GIP / amylin receptor triple agonist according to any one of the preceding embodiments, wherein the peptide is a peptide derivative comprising an extension moiety. 95. The peptide is a peptide derivative containing an extension, and the extension is C 12 -C 20 The GLP-1 / GIP / amylin receptor triple agonist according to embodiment 94, which comprises the diacid Protractor P. 96. The peptide is a peptide derivative comprising an extension moiety, wherein the extension moiety is a linker L selected from the group presented in Table 4. P 96. The GLP-1 / GIP / amylin receptor triple agonist of embodiment 95, further comprising: 97. Peptide Z2 has the amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Glu(E) or His(H), X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E), X 11 represents Lys(K), X 12 represents Ala (A), X 13 represents Thr(T), X 14 represents Arg(R), X 15 represents Ala (A) or Ser (S). 98. Peptide Z2 has the amino acid sequence according to formula VIII (SEQ ID NO: 9): The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 94 to 97, comprising or consisting of ASHLSTAQTQRLSAELHKLATLPRTETGSGSP (VIII). 99. Peptide Z2 has the amino acid sequence according to formula VII (SEQ ID NO: 8): The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 94 to 98, comprising or consisting of ASHLSTAQTQRLSAKLHRLATLPRTETGSGSP (VII). 100. Peptide Z1 has the amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R) or Gln(Q), X 54 represents Ala (A), Glu (E), or Gln (Q); X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A) or Gln (Q), X 57 represents Gly (G) or Glu (E), The peptide linker L1 has an amino acid sequence according to formula IV: X1X2X3X4X5X6X7X8X9X 10 X 11 X 12 X 13 X 14 (IV) is selected from the group consisting of E, AG, AGQAPGQAPG (SEQ ID NO: 136), AGQAPGQAPL (SEQ ID NO: 137), AGGGG (SEQ ID NO: 142), AGEAPGQAPG (SEQ ID NO: 143), and AGQAPGEAPG (SEQ ID NO: 154); Peptide Z2 has the amino acid sequence according to formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Gly (G) or Ser (S), X 59 represents Gln(Q), Glu(E), or His(H); X 60 represents Ala (A) or Gln (Q), X 61 represents Leu (L) or Thr (T), X 62 represents Ala (A), Gly (G), or Gln (Q); X 63 represents Gln(Q), Glu(E), or Lys(K); X 64 represents Leu (L) or Glu (E), The GLP-1 / GIP / amylin receptor triple agonist according to any one of embodiments 1-93, wherein the peptide is a peptide derivative comprising an extension moiety. 101. The peptide is a peptide derivative containing an extension, and the extension is C 12 -C 20 The GLP-1 / GIP / amylin receptor triple agonist according to embodiment 100, comprising the diacid Protractor P. 102. The peptide is a peptide derivative comprising an extension moiety, wherein the extension moiety is a linker L selected from the group presented in Table 4. P102. The GLP-1 / GIP / amylin receptor triple agonist of embodiment 101, further comprising: 103. Peptide Z1 has the amino acid sequence according to formula XI (SEQ ID NO: 163): YX 51 EGTFTSDYSX 52 LLEEIAAREFIEWLLAGGPSSG (XI) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K). 104. Peptide Z2 has the amino acid sequence according to formula XIII (SEQ ID NO: 166): ASX 59 LSTAQTQRLSAELHKLATLPRTETGSGSP (XIII) (In the formula, X 59 represents Glu(E) or His(H). 105. A GLP-1 / GIP / amylin receptor triple agonist, a peptide according to formula I, containing one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a member of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula IIa (SEQ ID NO: 3): X1X2X3GTFTSDYSILLEEQAAREFIEWLLAGGPSX4X5(IIa) (In the formula, X1 represents His (H) or Tyr (Y); X2 represents Aib, X3 represents Glu(E) or His(H), X4 represents Arg (R), Gly (G), Lys (K), or Ser (S); X5 represents Gly (G) or Lys (K), L1 is a peptide linker comprising or consisting of 1 to 14, 1 to 10, 4 to 10, or 9 to 10 amino acid residues; Z2 comprises a C-terminal amide; Formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to formula IIIa (SEQ ID NO: 4): ASX6LSTAX7X8X9RLSAX 10 LHX 11 LX 12 X 13 LPX 14 TETGSGX 15 P (IIIa) (In the formula, X6 represents Gln(Q), Glu(E), His(H), or Lys(K); X7 represents Ala (A) or Gln (Q); X8 represents Gln(Q), Leu(L), or Thr(T); X9 represents Ala (A), Gly (G), or Gln (Q); X 10 represents Glu(E) or Lys(K), X 11 represents Arg(R), Gln(Q), Glu(E), Gly(G), His(H), Lys(K), Thr(T), or Tyr(Y); X 12 represents Ala (A) or Lys (K), X 13 represents Asp (D) or Thr (T), X 14represents Arg (R) or Lys (K); X 15 represents Ala (A) or Ser (S), The peptide is a peptide derivative comprising an extension, the extension being C 16 -C 20 A linker L selected from the group presented in Table 4, comprising a protractor P that is a diacid. P GLP-1 / GIP / amylin receptor triple agonists further include: 106. A GLP-1 / GIP / amylin receptor triple agonist, a peptide according to formula I, containing one lysine (Lys, K) residue: Z1-L1-Z2 (I) Z1 is a member of formula II (SEQ ID NO: 1): YX2EGTFTSDYSILLEEQAAREFIEWLLAGGPSKG (II) wherein the amino acid at position X2 represents Aib, and Z1 is an amino acid sequence according to formula Xa (SEQ ID NO: 162): YX 51 EGTFTSDYSX 52 LLEEIAAX 53 EFIX 54 WLX 55 X 56 GGPSSX 57 (Xa) (In the formula, X 51 represents Aib, X 52 represents Ile (I) or Lys (K), X 53 represents Arg(R) or Gln(Q), X 54 represents Ala (A), Glu (E), or Gln (Q); X 55 represents Leu (L) or I (Ile), X 56 represents Ala (A) or Gln (Q), X57 represents Gly (G) or Glu (E), L1 is a peptide linker comprising or consisting of 1 to 14, 1 to 10, 4 to 10, or 9 to 10 amino acid residues; Z2 comprises a C-terminal amide; Formula III (SEQ ID NO: 2): A peptide having up to 10 amino acid substitutions relative to ASELSTAALGRLSAELHELATLPRTETGSGSP (III), and Z2 is an amino acid sequence according to Formula XIIa (SEQ ID NO: 165): AX 58 X 59 LSTAX 60 X 61 X 62 RLSAELHX 63 LATX 64 PRTETGSGSP (XIIa) (In the formula, X 58 represents Gly (G) or Ser (S), X 59 represents Gln(Q), Glu(E), or His(H); X 60 represents Ala (A) or Gln (Q), X 61 represents Leu (L) or Thr (T), X 62 represents Ala (A), Gly (G), or Gln (Q); X 63 represents Gln(Q), Glu(E), or Lys(K); X 64 represents Leu (L) or Glu (E), The peptide is a peptide derivative comprising an extension, the extension being C 16 -C 20 A linker L selected from the group presented in Table 4, comprising a protractor P that is a diacid. P GLP-1 / GIP / amylin receptor triple agonists further include: 107. Compound 10

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

[0289] material and method List of Abbreviations The following abbreviations are used below, in alphabetical order: Ado: 8-amino-3,6-dioxaoctanoic acid Aib: 2-aminoisobutyric acid amu: atomic mass unit BHK Baby Hamster Kidney Boc: t-butoxycarbonyl CAD: Charged Aerosol Detector cAMP: cyclic adenosine monophosphate CRE: cAMP response element DCM: dichloromethane DIC: N,N'-diisopropylcarbodiimide DIO: diet-induced obesity DMB: 2,4-dimethoxybenzyl DMEM: Dulbecco's modified Eagle's medium DMF: N,N-dimethylformamide DTT: 1,4-dithiothreitol EC50: Half-maximal effective concentration EDTA: ethylenediaminetetraacetic acid ES: Electrospray FBS: fetal bovine serum Fmoc: 9-fluorenylmethyloxycarbonyl FWHM: Full width at half maximum GIP: glucose-dependent insulinotropic polypeptide GLP-1: Glucagon-like peptide 1 hAMYR3: human amylin receptor 3 hGIPR: human glucose-dependent insulinotropic polypeptide receptor hGLP-1R: human glucagon-like peptide 1 receptor HEPES: N-(2-hydroxyethyl)piperazine-N'-(2-ethanesulfonic acid) HFIP: 1,1,1,3,3,3-hexafluoro-2-propanol or hexafluoroisopropanol HPLC: High-performance liquid chromatography HSA: human serum albumin iv: intravenous LCMS or LC-MS: Liquid Chromatography Mass Spectrometry LLoQ: Lower limit of quantification Luc: luciferase MeCN: acetonitrile MRI: Magnetic Resonance Imaging MS: mass spectrometry Mtt: 4-methyltrityl NCA: Non-compartmental pharmacokinetics nd: Not decided OtBu: tert-butoxy Oxyma Pure®: cyano-hydroxyimino-acetic acid ethyl ester Pbf: 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl PBS: phosphate buffered saline PK: Pharmacokinetics QD: Daily (Once a day) QTof: Quadrupole time of flight RAMP3: receptor-modifying protein 3 RT: room temperature sc: subcutaneous SD: Sprague Dawley SEM: standard error SPPS: Solid Phase Peptide Synthesis tBu: tert-butyl TFA: trifluoroacetic acid TIPS Triisopropylsilane TQ: Three-stage quadrupole Trt: triphenylmethyl or trityl UPLC: Ultra-high performance liquid chromatography UV: Ultraviolet light

[0290] Building blocks of fatty acids and special amino acids Octadecanedioic acid mono-tert-butyl ester (C 18 For the synthesis of diacid mono-tert-butyl esters, see patent application WO 2010 / 102886 (pages 27-28). 12 -C 20 The corresponding mono-tert-butyl esters of the diacids, in particular C 16 Diacid and C 20 Diacids can be prepared based thereon.

[0291] Fmoc-Leu-Ser(ψ Me , Me pro)-OH, Fmoc-Tyr(tBu)-Ser(ψ Me , Me pro)-OH, and Fmoc-Gly-(DMB)Gly-OH are commercially available from TechnoComm Ltd.

[0292] General methods for peptide synthesis The preparation of peptides (reference compounds and compounds of the present invention) was carried out using SPPS on a Symphony X from Protein Technologies, a PurePep Chorus from Protein Technologies, a MultiPep 2 from CEM, a Vapourtec RS-500 from Vapourtec, or a CS136XT from CSBioon using Fmoc-based chemistry. The Fmoc-protected amino acids used in this method are those recommended by the following standard manufacturers: e.g., Gyros Protein Technologies, Bachem, Iris Fmoc-Ala-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Asp(OtBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Cys(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Glu(OtBu)-OH, Fmoc-Gly-OH, Fmoc-His(Trt)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, supplied by Biotech or NovabioChem. H, Fmoc-Lys(Boc)-OH, Fmoc-Phe-OH, Fmoc-Pro-OH, Fmoc-Ser(tBu)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Mtt)-OH, Boc-His(Trt)-OH, Fmoc-Aib-OH, Fmoc-Glu-OtBu, and Fmoc-Ado-OH. For example, Fmoc-Leu-Ser(ψ), commercially available from TechnoComm Ltd. Me,Me pro)-OH, Fmoc-Tyr(tBu)-Ser(ψ Me,Me pro)-OH, and Fmoc-Gly-(DMB)Gly-OH were introduced where applicable.

[0293] Fmoc-PAL AM resin or Rink-Amide AM resin was used, which were commercially available from NovabioChem. Subsequent amino acids were introduced in a stepwise procedure on a Symphony X peptide synthesizer according to the SPPS principle.

[0294] Fmoc deprotection was achieved with 20% piperidine in DMF containing 0.1 M Oxyma Pure for 2 × 10 min. Introduction of a substituent at the alpha position of the N-terminal amino acid (i.e., a "protractor" P and an optional "linker L) was performed. P The coupling of the extender moiety (including the ' and ' extension moieties) was achieved using standard Fmoc-protected amino acids. Peptide coupling was performed using DIC and collidine. An amino acid / Oxyma Pure solution (0.3M / 0.3M in DMF at a 5-10-fold molar excess) was first added to the resin. Then, an equal molar equivalent of DIC was added (1.5M in DMF), followed by collidine (1.5M in DMF). Most commonly, this was mixed for 2 hours. In some cases, the coupling time was increased, additional DIC was added, or the coupling step was repeated. A subsequent capping step was performed using 1M acetic anhydride in DMF and collidine. Introduction of the extender moiety to the epsilon nitrogen of the lysine (Lys, K) in the sequence was achieved using Fmoc-Lys(Mtt)-OH. After synthesis of the peptide backbone sequence, the Mtt group was removed by treatment with HFIP / DCM / TIPS (75:23:2) (5 min), followed by a DCM wash. The resin was then resuspended in HFIP / DCM / TIPS (75:23:2) (2 x 25 min) and then washed with DCM and DMF. P was introduced using the stepwise procedure described above using a suitable protected building block, for example, a standard Fmoc-protected amino acid such as Fmoc-8-amino-3,6-dioxaoctanoic acid or Fmoc-Glu-OtBu. Introduction of the protractor, a fatty acid, was achieved using a suitable building block such as, but not limited to, octadecanedioic acid mono-tert-butyl-ester.

[0295] Common cutting methods The peptide was cleaved from the resin using TFA / TIPS / HO / DTT (90:4:3:3) for 2-3 h. The peptide was then extruded into cold diethyl ether and centrifuged. The ether was decanted, and the peptide precipitate was washed twice more with ether.

[0296] General methods for the purification and quantification of derivatives The crude peptide was dissolved in acetic acid / MeCN / Milli-Q water (45:10:45 or 40:20:40) and orthogonally purified by reversed-phase preparative HPLC (Waters Delta Prep 4000) on a column containing C18 silica gel. The first elution was performed using an increasing gradient of MeCN from 20 to 50% in Milli-Q water containing 1% ammonium bicarbonate. Relevant fractions were analyzed by UPLC. Fractions containing the target peptide were pooled and diluted with Milli-Q water (1:1) before a second reversed-phase preparative HPLC run. The second elution was performed using an increasing gradient of MeCN from 20 to 50% in Milli-Q water containing 0.1% TFA. Relevant fractions were analyzed by UPLC. Fractions containing the pure target peptide were pooled. The resulting solution was analyzed (UPLC, LCMS), and peptide derivatives were quantified using a CAD-specific HPLC detector (Thermo-Fischer Vanquish HPLC-CAD). The product was dispensed into glass vials. The vial was capped with a Millipore glass fiber pre-filter. Lyophilization afforded the trifluoroacetate salt of the derivative as a white solid.

[0297] Synthetic compounds The compounds were prepared using the methods described above.

[0298] Example 1: Reference Compounds Reference compound 1 (GLP-1 / GIP / amylin receptor triple agonist disclosed in WO 2023 / 288313, Example 1, Peptide / Compound No. 16) [ka] Reference compound 2 (Triple agonist based on the conjugation of tirzepatide and caglilintide) [ka] Reference compound 3 (A triple agonist based on the conjugation of tirzepatide and an amylin receptor agonist as disclosed in Example 21 of WO 2016 / 034604) [ka] Reference compound 4 (GIP receptor agonist disclosed in WO 2019 / 211451, Example 1, Compound 31) [ka] Reference compound 5 (GLP-1 / GIP coagonist tirzepatide) [ka] Reference compound 6 (Amylin receptor agonist caglilintide, WO 2012 / 168432, Example 53) [ka] Reference compound 7 (GLP-1 receptor agonist semaglutide, WO 2006 / 097537, Example 4) [ka]

[0299] Example 2: GLP-1 / GIP / Amylin Receptor Triple Agonists According to the Invention compound 10 [ka] compound 11 [ka] compound 12 [ka] compound 13 [ka] Compound 14

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

change

Table 7-1

Table 7-2

Table 7-3

Table 7-4

Table 7-5

Table 7-6

Table 7-7

Table 7-8

Table 7-9

Table 7-10

Table 7-11

Table 7-12

Table 7-13

Table 7-14

Table 7-15

[0300] Example 3: LCMS characterization of synthesized compounds LCMS characterization method LCMS analysis was performed on a setup consisting of a Waters Acquity UPLC H Class system and a Waters Xevo G2-XS QTof. Eluents: A: Milli-Q water, B: MeCN, C: 2% formic acid + 0.1% TFA in Milli-Q water.

[0301] The analysis was carried out at RT (column temperature 60°C) by injecting an appropriate volume of sample onto the column. The sample was eluted with a linear gradient of 5-95% B in A, and a constant 5% C.

[0302] UPLC conditions, detector settings, and mass spectrometer settings were as follows: Column: Waters Acquity BEH Shield, C-18, 1.7 μm, 2.1 mm x 50 mm. Gradient: Linear 5% to 95% B and constant 5% C for 4.0 min at 0.4 ml / min. Total run time: 7.0 min. Detection: MS sensitivity mode, ionization method: ES. Scan: 50-5000 amu.

[0303] Monoisotopic masses were recorded for the synthesized compounds and their observed and calculated values ​​are shown in Table 6. [Table 8-1] [Table 8-2] [Table 8-3] [Table 8-4] [Table 8-5] [Table 8-6] [Table 8-7] [Table 8-8] [Table 8-9] [Table 8-10]

[0304] Example 4: Human GLP-1 Receptor, Human GIP Receptor, and Human Amylin Receptor In Vitro Potency Assays (High Throughput Assays) GLP-1 receptor assay To determine the ability of compounds to activate or agonize GLP-1 receptor, an in vitro potency assay was carried out on baby hamster kidney (BHK) cells expressing human GLP-1 receptor (hGLP-1R) as follows.To evaluate whether receptor activation may be affected by the presence of human serum albumin (HSA), in vitro assays were carried out in the absence of HSA and in the presence of 1% (w / v) HSA.Unless otherwise stated, throughout this specification, reference to "GLP-1 receptor assay described in Example 4" refers to the assay procedure method A (hGLP-1R assay) described herein in the absence of HSA.

[0305] Assay principle Activation of the human GLP-1 receptor results in an increase in the intracellular concentration of cyclic AMP (cAMP) and consequent transcriptional activation from promoters containing multiple copies of the cAMP response element (CRE). Therefore, it is possible to measure GLP-1 receptor activity using a CRE-luciferase reporter gene introduced into baby hamster kidney (BHK) cells co-expressing the human GLP-1 receptor.

[0306] Cells and assay reagents Cell stocks were prepared by culturing cell lines stably expressing the human GLP-1 receptor and a CRE-responsive luciferase (CRE-Luc) reporter gene (BHK 467-12A KZ-10, prepared according to methods known to those skilled in the art) in growth medium consisting of DMEM (Gibco, 61965-026) supplemented with 10% FBS (Gibco, 16140-071 or 10100-147), 1% penicillin-streptomycin (Gibco, 15140-122), 1 mM Na-pyruvate (Gibco, 11360-039), 1 mg / mL G418 (Gibco, 10131-027), and 240 nM methotrexate (Pfizer, 15936). Cells at approximately 80-90% confluence were washed once with PBS (Gibco 14190-094) and detached from the cell flask using Versene (Gibco, 15040-033). After centrifugation, the cell pellet was resuspended and cultured at approximately 1.5 × 10 cells / well in Recovery™ Cell Culture Freezing Medium (Gibco, 12648-010) or in a medium consisting of DMEM (Gibco, 61965-026) supplemented with 20% FBS (Gibco, 16140-071 or 10100-147), 1% penicillin-streptomycin (Gibco, 15140-122), 1 mM Na-pyruvate (Gibco, 11360-039), 1 mg / mL G418 (Gibco, 10131-027), 240 nM methotrexate (Pfizer, 15936), and 10% DMSO (Sigma, D2650). 6 The cells were diluted to (1.5E+6) cells / mL and aliquoted and stored at -180°C until use.

[0307] Assay buffer consisted of DMEM without phenol red (Gibco, 11880-028) supplemented with 1x GlutaMAX (Gibco, 35050-038), 10 mM HEPES (Gibco, 15630-056), 1% (w / v) ovalbumin (Sigma, A5503), and 0.1% (v / v) Pluronic F-68 (Gibco, 24040-032), either with or without HSA (Sigma, A9511).

[0308] Procedure - Method A (hGLP-1R Assay) To perform the assay, serial dilutions (10-fold dilutions, 8 concentrations per compound) of reference compounds and GLP-1 / GIP / amylin receptor triple agonists were performed in assay buffer without HSA in 96-well plates. Frozen stocks of hGLP-1R BHK CRE-Luc cells were thawed in a 37°C water bath, washed once in PBS (Gibco 14190-094), and plated at 1.5 × 10 in assay buffer with or without 2% (w / v) HSA (Sigma, A9511). 6 For each dilution, a 50 μL aliquot of the reference compound or GLP-1 / GIP / amylin receptor triple agonist was added to 50 μL of cell suspension (5.0 × 10) with or without 2% (w / v) HSA. 3 The cells were transferred to two 96-well assay plates (ThermoFisher, 237105) at a concentration of (5.0E+3) cells / well. The assay plates were incubated at 37°C in 5% CO2 for 3 hours, left at room temperature for 5 minutes, and then 100 μL steadylite plus™ (PerkinElmer / Revvity, 6066759) was added to each well. The plates were sealed and incubated at room temperature for 30 minutes with gentle shaking, protected from light. Luminescence was detected using a luminescence plate reader, e.g., Synergy 2 (BioTek). EC 50Values ​​[pM] were calculated by nonlinear curve fitting applying a four-parameter logistic model (Hill slope = 1) using GraphPad Prism (GraphPad Software, Boston, MA, USA) or by TIBCO Enterprise Runtime for R (TIBCO Software, Palo Alto, CA, USA).

[0309] Procedure - Method B (hGLP-1R Assay) To perform the assay, serial dilutions (7-fold dilutions, 7 concentrations per compound, and one well containing assay buffer only) of the reference compound and GLP-1 / GIP / amylin receptor triple agonist were performed in assay buffer in a 96-well plate. The serial dilutions were transferred to a 384-well assay plate (PerkinElmer / Revvity, 6007688) and mixed with an equal volume (10 μL) of assay buffer without or with 3% (w / v) HSA (Sigma, A-9511). Frozen stocks of hGLP-1R BHK Cre-Luc cells were thawed in a 37°C water bath, washed once in PBS (Gibco 14190-094), and cultured at 1.5 × 10 in assay buffer (without HSA). 5 The cells were diluted to (1.5E+5) cells / mL and added (10 μL) to each well of a 384-well assay plate. After brief centrifugation, the assay plate was incubated at 37°C in 5% CO2 for 3 hours, equilibrated to room temperature for 10 minutes, and then 30 μL of steadylite plus™ (PerkinElmer / Revvity, 6066759) was added per well. The plate was sealed and incubated at room temperature for 30 minutes with gentle shaking, protected from light. Luminescence was detected with a luminescence plate reader, e.g., Synergy 2 (BioTek). EC 50Values ​​[pM] were calculated by nonlinear curve fitting applying a four-parameter logistic model (Hill slope = 1) using GraphPad Prism (GraphPad Software, Boston, MA, USA) or by TIBCO Enterprise Runtime for R (TIBCO Software, Palo Alto, CA, USA).

[0310] GIP receptor assay To determine the ability of compounds to activate or agonize GIP receptor, an in vitro potency assay is carried out on baby hamster kidney (BHK) cells expressing human GIP receptor (hGIPR) as follows.To evaluate whether receptor activation may be affected by the presence of human serum albumin (HSA), in vitro assays are carried out in the absence of HSA and in the presence of 1% (w / v) HSA.Unless otherwise stated, throughout this specification, reference to "GIP receptor assay described in Example 4" refers to the assay procedure method A (hGIPR assay) described herein in the absence of HSA.

[0311] Assay principle Activation of the human GIP receptor results in an increase in the intracellular concentration of cyclic AMP (cAMP) and consequent transcriptional activation from promoters containing multiple copies of the cAMP response element (CRE). Therefore, it is possible to measure GIP receptor activity using a CRE-luciferase reporter gene introduced into baby hamster kidney (BHK) cells co-expressing the human GIP receptor.

[0312] Cells and assay reagents Cell stocks were prepared by culturing a cell line stably expressing the human GIP receptor and containing a CRE-responsive luciferase (CRE-Luc) reporter gene (hGIPR BHK Cre-Luc2p clone #5, prepared according to methods known to those skilled in the art) in growth medium consisting of DMEM (Gibco, 61965-026) supplemented with 10% fetal bovine serum (Gibco, 16140-071 or 10100-147), 0.5 mg / ml G418 (Gibco, 10131-027), 1% penicillin-streptomycin (Gibco, 15140-122), and 0.3 mg / ml hygromycin B (Invitrogen, 10687010) at 5% CO and 37°C. Cells at approximately 80-90% confluence were washed once with PBS (Gibco 14190-094) and detached from the cell flask using Versene (Gibco, 15040-066). After centrifugation, cells were counted, resuspended, and diluted to approximately 1.5-3.0 × 10 in Recovery Cell Culture Freezing Medium (Gibco, 12648-010). 6 The cells were diluted to (1.5E+6 to 3.0E+6) cells / mL and stored at -180°C in suitable aliquots until use.

[0313] Assay buffer consisted of DMEM without phenol red (Gibco, 11880-028) supplemented with 1x GlutaMAX (Gibco, 35050-038), 10 mM HEPES (Gibco, 15630-056), 1% (w / v) ovalbumin (Sigma, A5503), and 0.1% (v / v) Pluronic F-68 (Gibco, 24040-032), either with or without HSA (Sigma, A9511).

[0314] Procedure - Method A (hGIPR Assay) The day before the assay, thaw hGIPR BHK Cre-Luc cells and culture at 5.0 × 10 in growth medium as described above. 3(5.0E+3) cells / well were plated into a 96-well culture plate (PerkinElmer / Revvity, 6005680). The plate was then incubated at 37°C with 5% CO₂ for 21–23 hours. On the day of the assay, GLP-1 / GIP / amylin receptor triple agonists or reference compounds were diluted in assay buffer using a 7-point, 10-fold titration and a blank (no compound). Each compound was diluted and tested in duplicate in each experiment. In the plate containing cells, growth medium was removed, and the cells were washed twice with 100 μL of PBS (Gibco 14190-094). 50 μL of the test compound dilution was added to the plate containing cells, preceded by 50 μL of assay buffer with or without 2% (w / v) HSA (Sigma, A9511). The cell plate was incubated in a 37°C, 5% CO₂ incubator for 3 hours. The plate was then transferred to room temperature, after which 100 μL of steadylite plus™ (PerkinElmer / Revvity, 6066759) was added. The plate was sealed and gently shaken at room temperature for 30 minutes, protected from light. Finally, luminescence (as an indicator of receptor activation) was measured using a Mithras reader (Berthold Technologies, DE). EC 50 Values ​​[pM] were calculated by nonlinear curve fitting applying a four-parameter logistic model (Hill slope = "shared value for all datasets") using GraphPad Prism (GraphPad Software, Boston, MA, USA).

[0315] Procedure - Method B (hGIPR Assay) To perform the assay, serial dilutions (7-fold dilutions, seven concentrations per compound, and one well containing assay buffer only) of the reference compound and GLP-1 / GIP / amylin receptor triple agonist were prepared in assay buffer in a 96-well plate. The serial dilutions were transferred to a 384-well assay plate (PerkinElmer / Revvity, 6007688) and mixed with an equal volume (10 μL) of assay buffer without or with 3% HSA (Sigma, A-9511). Frozen stocks of hGIPR BHK Cre-Luc cells were thawed in a 37°C water bath, washed once in PBS (Gibco 14190-094), and cultured at 1.5 × 10 in assay buffer (without HSA). 5 The cells were diluted to (1.5E+5) cells / mL and added (10 μL) to each well of a 384-well assay plate. After brief centrifugation, the assay plate was incubated at 37°C in 5% CO2 for 3 hours, equilibrated at room temperature for 10 minutes, and then 30 μL of steadylite plus™ (PerkinElmer / Revvity, 6066759) was added per well. The plate was sealed and incubated at room temperature for 30 minutes with gentle shaking, protected from light. Luminescence was detected using a luminescence plate reader, e.g., Synergy 2 (BioTek). EC 50 Values ​​[pM] were calculated by nonlinear curve fitting applying a four-parameter logistic model (Hill slope = 1) using GraphPad Prism (GraphPad Software, Boston, MA, USA) or by TIBCO Enterprise Runtime for R (TIBCO Software, Palo Alto, CA, USA).

[0316] Amylin receptor assay To determine the ability of compounds to activate or agonize amylin receptors, the in vitro potency assay is carried out on baby hamster kidney (BHK) cells expressing human amylin receptors (hAMYR3) as follows.To evaluate whether receptor activation may be affected by the presence of human serum albumin (HSA), in vitro assay is carried out in the absence of HSA and in the presence of 1% (w / v) HSA.Unless otherwise stated, throughout this specification, reference to "the amylin receptor assay described in Example 4" refers to the assay procedure method A (hAMYR3 assay) described herein in the absence of HSA.

[0317] Assay principle Activation of the human amylin 3 receptor leads to an increase in the intracellular concentration of cAMP and consequent transcriptional activation from promoters containing multiple copies of the cAMP response element (CRE). Therefore, it is possible to measure hAMYR3 receptor activity using a CRE-luciferase reporter gene introduced into baby hamster kidney (BHK) cells co-expressing hAMYR3.

[0318] Cells and assay reagents The BHK cell line was transfected with human calcitonin receptor agonists according to methods known to those skilled in the art (Hollex-1 cell line, obtained from Zymogentics as described in US Pat. No. 5,622,839). (a) The cells were transfected to stably express the CRE-responsive luciferase (CRE-Luc) reporter gene. The cell lines were further transfected with human receptor-modifying protein 3 (RAMP3) using standard methods, which converts the human calcitonin receptor to the human amylin-3(a) receptor (hAMYR3).

[0319] Cell stocks were prepared by culturing the hAMYR3 BHK Cre-Luc cell line in growth medium consisting of DMEM (Gibco, 31966-021) supplemented with 10% FBS (Gibco, 16140-071 or 10100-147), 1% penicillin-streptomycin (Gibco, 15140-122), 0.5 mg / mL genticin (Gibco, 10131-027), 0.4 mg / mL hygromycin (Invitrogen, 10687010), and 250 nM methotrexate (Sigma, A6770). Cells at approximately 80-90% confluence were washed once with PBS (Gibco 14190-094) and detached from the cell flask using Versene (Gibco, 15040-033) or TrypLE™ (Gibco, 12605-010). After centrifugation, the cell pellet was resuspended and frozen at approximately 2.5-4.0 x 10 cells / ml in Recovery™ Cell Culture Freezing Medium (Gibco, 12648-010). 6 The cells were diluted to (2.5E+6 to 4.0E+6) cells / mL and aliquoted and stored at -180°C until use.

[0320] The assay buffer consisted of DMEM without phenol red (Gibco, 11880-028) supplemented with 1x GlutaMAX (Gibco, 35050-038), 10 mM HEPES (Gibco, 15630-056), and 1% (w / v) ovalbumin (Sigma, A5503), with or without 0.1% (v / v) Pluronic F-68 (Gibco, 24040-032), with or without HSA (Sigma, A9511).

[0321] Procedure - Method A (hAMYR3 Assay) To perform the assay, BHK hAMYR3 / CRE-Luc cells were thawed, washed once with PBS (Gibco 14190-094), and plated at 4.0 × 10 cells / well in 40 μL growth medium in a white 384-well culture plate (PerkinElmer, 6007688) the day before the experiment. 3Cells were seeded at a cell density of (4.0E+3) cells / well. The plate was incubated overnight at 37°C in 5% CO2. On the day of the assay, the cells were washed once in assay PBS (Gibco 14190-094). Serial dilutions (7-fold dilutions, 7 concentrations per compound, one well containing assay buffer only) of reference compounds and GLP-1 / GIP / amylin receptor triple agonists were performed in assay buffer with or without 1% (w / v) HSA (Sigma, A9511) in a 96-well plate, and 30 μL of each concentration was added to the 384-well assay plate containing the cells. The assay plate was incubated at 37°C in 5% CO2 for 3 hours, after which 30 μL of steadylite plus™ (PerkinElmer / Revvity, 6066759) was added to each well. The assay plate was sealed and incubated at room temperature with gentle shaking for 5 minutes, followed by 30 minutes without shaking, protected from light. Luminescence was detected with a luminescence plate reader, e.g., Synergy 2 (BioTek). EC 50 Values ​​[pM] were calculated by nonlinear curve fitting applying a four-parameter logistic model (Hill slope = 1.5, shared nadir response within each plate) using GraphPad Prism (GraphPad Software, Boston, MA, USA) or by TIBCO Enterprise Runtime for R (TIBCO Software, Palo Alto, CA, USA).

[0322] Procedure - Method B (hAMYR3) To perform the assay, hAMYR3 BHK Cre-Luc cells were thawed, washed once with PBS (Gibco 14190-094), and plated at 4.0 × 10 cells in 40 μL growth medium in a white 384-well culture plate (PerkinElmer, 6007688) the day before the experiment. 3The cells were seeded at a cell density of (4.0E+3) cells / well. The plate was incubated overnight at 37°C in 5% CO2. On the day of the assay, serial dilutions (7-fold dilutions, 7 concentrations per compound, and one well containing assay buffer only) of the reference compound and GLP-1 / GIP / amylin receptor triple agonist were prepared in assay buffer in a 96-well plate. The serial dilutions were then mixed in a new 96-well plate with equal volumes (1:1:1 ratio) of assay buffer and assay buffer with or without 3% HSA (Sigma, A-9511). 20 microliters of the solution mixture was transferred to the cells, which had previously been washed once with PBS (Gibco 14190-094). After brief centrifugation, the assay plate was incubated at 37°C in 5% CO2 for 3 hours, equilibrated at room temperature for 10 minutes, and then 30 μL of steadylite plus™ (PerkinElmer / Revvity, 6066759) was added per well. The plate was sealed and incubated at room temperature for 30 minutes with gentle shaking, protected from light. Luminescence was detected with a luminescence plate reader, e.g., Synergy 2 (BioTek). EC 50 Values ​​[pM] were calculated by nonlinear curve fitting applying a four-parameter logistic model (Hill slope = 1.5, shared nadir response within each plate) using GraphPad Prism (GraphPad Software, Boston, MA, USA) or by TIBCO Enterprise Runtime for R (TIBCO Software, Palo Alto, CA, USA). [Table 9] [Table 10]

[0323] The results in Tables 7a and 7b show that Reference Compounds 4 to 7 are agonists or co-agonists for one or two of the GLP-1 receptor, the GIP receptor, and the amylin receptor (hAMYR3).

[0324] According to Table 7a, the activity data of Reference Compound 2 shows that linking the C-terminus of a potent GLP-1 / GIP coagonist (tirzepatide) to the N-terminus of a potent amylin receptor agonist (caglilintide) via a peptide linker does not result in a compound that is equally potent at these three receptors and can necessarily function as a GLP-1 / GIP / amylin receptor triple agonist (i.e., a compound according to the present invention).Comparing Reference Compound 2 with Reference Compound 5 (tirzepatide) and Reference Compound 6 (caglilintide) illustrates this point.Reference Compound 2 significantly loses potency at GLP-1 receptors and further shows some loss of potency at amylin receptors when compared with the original compounds, Reference Compounds 5 (tirzepatide) and 6 (caglilintide).

[0325] Reference compounds 1-3 show functional activation of all three receptors, but all exhibit poor potency at the GLP-1 receptor and are therefore unbalanced triple agonists with potency ratios (A / B) of 116-287. [Table 11-1] [Table 11-2] [Table 11-3] [Table 12-1] [Table 12-2]

[0326] The results in Table 8a / b show that compounds of the present invention exhibit potent functional activation of all three receptors: the human GLP-1 receptor, the human GIP receptor, and the human amylin receptor (hAMYR3).

[0327] Most of the GLP-1 / GIP / amylin receptor triple agonists of the present invention have EC values ​​comparable to the GIP, GLP-1, and amylin receptor agonists and GLP-1 / GIP coagonists disclosed herein as Reference Compounds 4-7. 50 Furthermore, the GLP-1 / GIP / amylin receptor triple agonists of the present invention exhibit potent and balanced functional activation of all three receptors, as shown in Table 8a / b, and are balanced GLP-1 / GIP / amylin receptor triple agonists, in contrast to Reference Compounds 1, 2, and 3. [Table 13] [Table 14] [Table 15-1] [Table 15-2] [Table 16-1] [Table 16-2]

[0328] Example 5: Experimental protocol for testing efficacy on appetite using an ad libitum feeding rat model Sprague Dawley (SD) rats from Taconic, Denmark were used in acute food intake experiments in accordance with the principles of laboratory animal care.

[0329] The rats were normal weights of 250–350 g at the start of the experiment. To allow for acclimation to the experimental setup, they arrived at least 10–14 days before the start of the experiment. During this period, the animals were handled at least twice (immobilized by restraints at the neck skin). Immediately after arrival, the rats were switched to a reversed light cycle (darkness from 11:00 AM to 11:00 PM) and transferred to an automated food intake measurement system (HM2 system, MBRose; Faaborg, Denmark). The rats were housed at room temperature (approximately 22°C) with free access to chow (Altromin catalog number 1324, Brogaarden, Lynge, Denmark) and water. Each rat was implanted with an ID chip to allow recording of individual food intake. Three rats were housed per cage. During the acclimation period, during which the rats became accustomed to the new light cycle and diet (LF 10% (D12450B), Research Diets Inc.), the animals had free access to food and water. Because rats are typically active and consume the majority of their daily calories during the dark period, rats were dosed in the morning, just before lights-out. This setup minimized data variability and maximized test sensitivity. Each dose of triple agonist was tested in groups of 5–8 rats. A vehicle group of 6–8 rats was included in each set of tests. Each cage contained animals from three different treatment groups (to eliminate the possibility of cage effects (e.g., cage failure) on the primary readout: food intake). Rats were dosed subcutaneously (sc) once with the peptide of interest according to body weight (10 or 30 nmol / kg) in vehicle (0.5 ml / kg) using a NovoPen® (Novo Nordisk, Bagsvaerd, Denmark).

[0330] Compounds of the invention were formulated (20 or 60 nmol / ml) in the following vehicle: 8 mM phosphate, 250 mM glycerol, 0.007% polysorbate 20, pH 7.4.

[0331] After dosing, rats were returned to their home cages, where they had free access to chow and water. Food consumption was recorded individually and continuously by the HM2 system from 0 to 72 hours after test compound administration. Data acquired by the HM-2 system were stored in an HMBase SQL database (Firebird® relational database management system) and processed by HM2Lab software (MBRose; Faborg, Denmark) installed on an embedded computer. The feeding system is a highly sensitive system with a loading resolution of 0.001 g. In addition to recording food intake, the system records the number of feeding events, defined as a loss of 0.001 g of food within 5 seconds (detailed information on the system can be found in Rathod, YD, and Di Fulvio, M. (2021). The feeding microstructure of male and female mice. PLoS One 16, e0246569). At the end of the experimental session, the animals were euthanized.

[0332] Table 11 shows acute food intake in normal weight (lean) rats based on the above protocol for efficacy testing on appetite. These results allow for assessment of in vivo effects on food intake and provide an indication of the duration of action of the compounds. Data are expressed as the mean percent inhibition of the mean food intake in the vehicle group on each test day (Day 1 [0-24 hours], Day 2 [24-48 hours], and Day 3 [48-72 hours]), where food intake was observed in rats for up to 72 hours. Food intake on each test day (e.g., Day 1) refers to the cumulative food intake over the course of that day (i.e., a 24-hour period). [Table 17-1] [Table 17-2]

[0333] As can be inferred from the data presented in Table 11, after dosing rats with GLP-1 / GIP / amylin receptor triple agonists, it was observed that many of them caused significant inhibition of food intake compared to vehicle treatment. In general, the compounds in Table 11 showed similar or improved reduction in food intake compared to Reference Compound 1 disclosed in WO 2023 / 288313, at doses much lower than the dosage level of the disclosed Reference Compound 1 of 50 nmol / kg.

[0334] Example 6: Pharmacokinetic studies in minipigs The purpose of this study was to determine the in vivo half-life (t 1 / 2 ), i.e., their residence time in the body, and therefore their duration of action. This is called the terminal half-life (t 1 / 2 Terminal half-life refers to the time it takes to reduce a particular plasma concentration by half during the terminal elimination phase.

[0335] the study Female Göttingen minipigs were obtained from Ellegaard Göttingen Minipigs (Dalmose, Denmark) and were approximately 8-12 months old and weighed approximately 20-30 kg. Minipigs (those with permanent catheters) were housed individually in sheds with straw bedding and were restricted-fed once daily with Altromin 9023 minipig chow (Altromin Spezialfutter GmbH & Co. KG).

[0336] After 3 weeks of acclimation, two permanent central venous catheters were implanted into the caudal vena cava of each animal. Animals were allowed to recover for at least 10 days after surgery and then used in repeated pharmacokinetic studies with appropriate washout periods between successive doses.

[0337] Compounds of the invention were formulated (40 nmol / ml) in the following vehicle: 8 mM phosphate, 250 mM glycerol, 0.007% polysorbate 20, pH 7.4.

[0338] Intravenous injections of the derivative (volume corresponding to a dose of 0.05 ml / kg and 2 nmol / kg / derivative) were given through one catheter, and blood samples were taken (preferably from the other catheter) at predetermined time points up to 14 days after dosing.

[0339] Blood samples (eg, 1.3 ml) were collected in tubes coated with EDTA (1.3 ml tubes containing K3EDTA to obtain 1.6 mg K3EDTA / ml blood) and then centrifuged at 4°C and 2000 x g for 10 minutes.

[0340] Sampling and analysis Plasma was pipetted into Micronic tubes stored on dry ice within 30 minutes of centrifugation and then kept at -20°C until analyzed for plasma concentration of compound using LCMS.

[0341] Plasma concentrations of the peptides of the present invention were assayed by plasma protein precipitation and analyzed by liquid chromatography-mass spectrometry (LC-MS). Standards were prepared by spiking blank plasma from minipigs with compounds in the typical range of 0.05–200 nM. The LLoQ was typically within the range of 0.2–2 nM. Standards, plasma blanks, or test samples were prepared for LC-MS by protein precipitation by adding 4 volumes of ethanol containing 20 nM of an internal standard (a structurally similar analog with a different mass) to 1 volume of the sample, followed by centrifugation at 6200 rpm for 10 minutes at 4°C. The supernatant was diluted with 1 volume of Milli-Q water containing 1% formic acid before injection into the LC-MS system. Individual plasma concentration-time profiles were analyzed by noncompartmental pharmacokinetics (NCA) in Phoenix v.6.4 (Pharsight Inc., Mountain View, CA, USA), and the resulting terminal half-lives (harmonic means) were determined. LC-MS analysis was performed using a Thermo Fisher Scientific (Bremen, Germany) TurboFlow HPLC system coupled to either a Q Exactive Orbitrap or an Altis Triple Quadrupole (TQ) mass spectrometer. The LC mobile phase consisted of A: MQ water with 5% organic solvent (50% methanol / 50% acetonitrile) and 1% formic acid, and B: MQ water with 95% organic solvent (50% methanol / 50% acetonitrile) and 1% formic acid. A Thermo Fisher Scientific (Bremen, Germany) TurboFlow Cyclone 0.5 x 100 mm column was used for extraction, followed by analytical elution on an XBridge Peptide BEH C18 300 Å, 3.5 μm, 2.1 x 50 mm column, both operated at 60 °C. Typically, 40-45% B and 75-80% B were used for loading and elution on the TurboFlow column, respectively, followed by a linear gradient elution on the analytical column, typically from about 45% B to 85% B over 2.33 min.The Orbitrap mass spectrometer was operated in positive ionization mode at a spray voltage of 4.0 kV using a Parallel Reaction Monitoring scan mode with an isolation window of 5 m / z for the most abundant charge state of the compound, with a resolution of 35 K on the Orbitrap MS. The TQ mass spectrometer was operated in positive ionization mode at a spray voltage of 4.0 kV using a Single Reaction Monitoring scan mode with Q1 and Q3 resolution of 1.2 (FWHM).

[0342] For every compound, an individual optimal fragmentation collision energy was found and used. The data were fitted to a linear calibration curve (1 / ×) which was used to calculate the concentration in plasma samples. 2 The data were processed using the Quan browser in the Xcalibur software from Thermo Fisher Scientific (Bremen, Germany) by fitting the data to a weighting factor ( ). Quality control samples were included. Deviations between nominal and calculated concentrations in standards and quality control samples were less than 15%.

[0343] result: [Table 18] As shown in Table 12, the GLP-1 / GIP / amylin receptor triple agonists of the present invention tested had a very long half-life (t 1 / 2 Based on these half-lives in minipigs, it is contemplated that a half-life in humans of at least one dose per week by liquid subcutaneous injection or at least one dose per day by oral tablet will be sufficient.

[0344] Example 7: Chemical stability evaluation in formulations Assays were performed to examine the extent of chemical degradation in vitro over time upon incubation at 37°C for 2 weeks.

[0345] Peptide solutions were prepared by dissolving the lyophilized powder in 8 mM phosphate buffer, pH 7.4, to a target of 1 mg / mL. The pH of the peptide solution was adjusted to 7.4 with 0.02 M HCl or 0.02 M NaOH. Samples were loaded into Agilent HPLC vials with fixed inserts. The vials were capped to prevent evaporation. The HPLC vials were incubated at 37°C, and samples were collected at different time points over a 2-week period, flash-frozen at -80°C, and stored at -20°C until analysis.

[0346] Sample analysis was performed using UPLC coupled with UV detection at 215 nm and MS (UPLC-UV-MS). 1 μL of sample was injected into a Waters Acquity UPLC equipped with a flow-through needle injection system onto a Waters Acquity CSH C18 column (1 × 150 mm) with 1.7 μm particle size and maintained at 55 °C. A flow rate of 100 μL / min was delivered with a binary solvent-controlled pump, with 0.1% formic acid in water as solvent A and 0.1% formic acid in acetonitrile as solvent B. Gradient elution was performed using 20% ​​B from 0 to 2 min, followed by 20 to 50% B from 2 to 20 min, for a total run time of 30 min. Peptide identity was confirmed by MS, and peak purity, area %, from the UV signal at 215 nm was plotted versus time, and the slope from the linear regression was used to calculate the purity loss per week (Table 13). [Table 19-1] [Table 19-2]

[0347] All GLP-1 / GIP / amylin receptor triple agonists tested in this assay demonstrate acceptable chemical stability with acceptable degradation rates in aqueous buffer (37°C) (less than 6% loss of purity per week). The majority of the GLP-1 / GIP / amylin receptor triple agonists tested demonstrate good chemical stability with less than 3.0% loss of purity per week, or even better chemical stability (less than 1.5% loss of purity per week). Therefore, the GLP-1 / GIP / amylin receptor triple agonists of the present invention are considered chemically stable in solution.

[0348] Example 8: Subchronic treatment in diet-induced obese (DIO) rats The purpose of this example was to evaluate the in vivo effects of selected triple agonists on pharmacodynamic parameters such as body weight and food intake in diet-induced obese (DIO) mice. Animals were treated once daily by subcutaneous injection with a liquid formulation of the triple agonist being tested, and the effects on body weight and food intake (daily and cumulative) were evaluated.

[0349] Diet-induced obese male rats (Sprague Dawley) were purchased from Charles River (Ecully, France). Rats were initially housed in pairs at room temperature with free access to a 45% high-fat diet (D12451, Research Diets, Inc., NJ) on a 12:12-h light-dark cycle with lights on at 06:00. Two weeks before the start of the study, rats were switched to a reversed light-dark cycle (12:12 h) with lights on from 21:00 to 09:00. Five days before the start of treatment, animals were weighed and underwent MRI scans (EchoMRI™, TX, USA) to obtain body composition data. Rats were divided into seven groups (n = 8) matched for body weight and fat mass (P > 0.91 between groups for both body weight and fat mass tested by one-way ANOVA followed by Tukey's multiple comparison test), ensuring that no two rats were from the same group. Group details are shown in Table 14 below. A group of age-matched normoweight controls, fed a standard chow diet (Altromin 1324, Altromin International) throughout life, was included as a reference. At the start of the study, the mean body weight of DIO rats was 958 ± 16.4 g (mean ± SEM). The mean body weight of normoweight controls was 796 ± 21.4 g (mean ± SEM). Body weight and daily food intake were collected by manual weighing (0-1 h before darkness for 4 days prior to the start of treatment (pre-treatment / baseline phase)). Following this, rats were sham-handled (restrained at the neck skin) to acclimate them to the dosing procedure during treatment. Diet was changed daily during the baseline and treatment phases. The treatment phase lasted for 4 weeks (28 days) with daily subcutaneous injections (QD, subcutaneous) at a volume of 0.5 ml / kg.

[0350] Compounds of the invention were formulated in the following vehicle: 8 mM phosphate, 250 mM glycerol, 0.007% polysorbate 20, pH 7.4 (depending on the dose: 0.6 nmol / ml, 2 nmol / ml, 6 nmol / ml, 12 nmol / ml, and 20 nmol / ml). Rats were dosed with NovoPen® (Novo Nordisk, Bagsvaerd, Denmark) immediately after weighing and 0-1 hour before the onset of the dark phase. Two test compounds were titrated to a maintenance dose of either 3 nmol / kg or 10 nmol / kg, as shown in Table 14. [Table 20]

[0351] The results of this study are shown in Figures 1, 2, and 3 and in Table 15. Table 15 shows the effects on cumulative food intake, absolute body weight, and relative body weight of DIO rats treated daily for up to 28 days with vehicle and compounds 52 or 77 of the invention (3 nmol / kg and 10 nmol / kg, respectively) according to the dose titration schedule shown in Table 14. [Table 21]

[0352] The second column of Table 15 shows the cumulative food intake (in kcal) from days 0-28 of treatment. DIO rats received a subcutaneous dose once daily according to the titration schedule described in Table 14. Data are presented as mean ± SEM, n=6-8. These results are also shown in Figure 3. It can be seen that treatment with GLP-1 / GIP / amylin receptor triple agonist compounds 52 and 77 induced a reduction in food intake.

[0353] The third column of Table 15 shows the absolute body weights (g) of rats dosed with vehicle, Compound 52, or Compound 77 (at 3 nmol / kg and 10 nmol / kg, respectively) on days 0 and 28 of the treatment period. DIO rats received a single subcutaneous dose per day according to the titration schedule described in Table 14. Data are presented as mean ± SEM, n = 6-8. The last column of Table 15 shows the body weights of DIO rats during the 28-day treatment period with Compounds 52 and 77 (at 3 nmol / kg and 10 nmol / kg, respectively) as a percentage of day 0 (% body weight). For example, a relative body weight of 80% on day 28 means that the rat retained only 80% of its body weight on day 0, or in other words, the rat lost 20% of its initial body weight (day 0). DIO rats received a single subcutaneous dose per day according to the titration schedule described in Table 14. Data are presented as mean ± SEM, n = 6-8. These results are also shown in Figure 1. It can be seen that treatment with the GLP-1 / GIP / amylin receptor triple agonist compounds 52 and 77 induced a reduction in absolute and relative body weight.

[0354] Table 15 shows that treatment with GLP-1 / GIP / amylin receptor triple agonist Compounds 52 and 77 at all concentrations induced a reduction in food intake that led to weight loss. Treatment with the same concentrations (3 nmol / kg or 10 nmol / kg) of GLP-1 / GIP / amylin receptor triple agonist Compounds 52 and 77 induced a similar reduction in food intake that led to a similar weight loss. The effects of reduced food intake and weight loss were concentration-dependent, with smaller reductions in food intake and weight loss at 3 nmol / kg and greater reductions in food intake and weight loss at 10 nmol / kg.

[0355] The present invention is not limited to the specific methodology, protocol and reagent described herein, which can be changed without departing from the scope of this disclosure.It should be understood that the terms used herein are only intended to describe specific embodiments and are therefore not intended to be limiting.Unless otherwise defined, all technical and scientific terms used herein have the same meaning as those commonly understood by those skilled in the art.

[0356] The elements of the present invention have been described above. These elements have been enumerated using specific embodiments. However, it will be understood that the embodiments may be combined in any manner and in any number to create additional embodiments that fall within the scope of the present disclosure. The various described examples and preferred embodiments should not be construed as limiting the invention to only the explicitly described embodiments. The description should be understood to support and encompass embodiments that combine the explicitly described embodiment with any number of the disclosed and / or preferred elements. Furthermore, unless the context dictates otherwise, any permutation and combination of all elements described in this application should be considered to be disclosed by the description of this application.

[0357] Documents cited throughout the text of this specification (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, etc.), whether supra or infra, are hereby incorporated by reference in their entirety. Nothing herein should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior invention.

[0358] While certain features of the invention have been illustrated and described herein, many modifications, substitutions, changes, and equivalents will now occur to those skilled in the art. It is, therefore, to be understood that the appended claims are intended to cover all such modifications and changes that fall within the true spirit of the invention.

Claims

1. A GLP-1 / GIP / amylin receptor triple agonist, Compound 52 【Chemical 1】 or Compound 55 【Chemistry 2】 or Compound 58 【Chemistry 3】 or Compound 68 【Chemistry 4】 or Compound 77 【Chemistry 5】 or Compound 101 【Chemistry 6】 A GLP-1 / GIP / amylin receptor triple agonist.

2. Compound 52 【Chemistry 7】 2. The GLP-1 / GIP / amylin receptor triple agonist of claim 1, wherein

3. Compound 68 【Chemistry 8】 2. The GLP-1 / GIP / amylin receptor triple agonist of claim 1, wherein

4. Compound 77 【Chemistry 9】 2. The GLP-1 / GIP / amylin receptor triple agonist of claim 1, wherein

5. A pharmaceutical composition comprising the GLP-1 / GIP / amylin receptor triple agonist of any one of claims 1 to 4 and one or more pharmaceutically acceptable excipients.

6. 6. A pharmaceutical composition according to claim 5 for use as a medicament.

7. 6. The pharmaceutical composition of claim 5, for use in treating a subject with an initial body mass index (BMI) of 25 or greater, 27 or greater, or 28 or greater, or 30 or greater, optionally in the presence of at least one weight-related comorbidity.

Images