Compositions and methods for spray drying adjuvanted vaccine emulsions
A thermostable dry powder vaccine composition with spray-dried antigen and adjuvant facilitates stable ambient storage and inhalable delivery, addressing distribution challenges and simplifying administration.
Patent Information
- Application Number
- JP2021569917
- Authority / Receiving Office
- JP · JP
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2019-05-25
- Filing Date
- 2020-05-26
- Publication Date
- 2025-12-02
- Estimated Expiration
- 2040-05-26
AI Technical Summary
The lack of vaccine formulation stability without refrigeration complicates stockpiling and distribution, especially to remote or developing regions, and the need for pre-mixing vaccines before administration increases the risk of loss and complexity.
A dry powder vaccine composition comprising an antigen, adjuvant, metabolizable oil, and excipients with particle sizes less than 120 μm, produced by spray drying, which is thermostable and can be administered via inhalation or reconstitution.
The composition maintains stability at ambient temperatures, simplifies administration, reduces refrigeration costs, and enables inhalable delivery, enhancing vaccine distribution and reducing loss risks.
Smart Images

Figure 0007778570000008 
Figure 0007778570000009 
Figure 0007778570000010
Abstract
Description
[Technical Field]
[0001] This document relates generally to dry powder compositions and methods for spray drying adjuvants and / or adjuvant / antigen emulsions. [Background technology]
[0002] Stockpiling vaccines in preparation for pandemics and providing vaccines to remote or developing regions is limited by the lack of vaccine formulation stability without refrigeration. This can make providing vaccines to developing countries difficult due to the lack of refrigeration availability, especially during transportation to remote areas. Eliminating the cold chain requirement for vaccines would significantly reduce storage and transportation costs and further simplify pandemic stockpiling. In addition, existing vaccines generally require mixing of the antigen with an adjuvant before administering the vaccine to a subject. Providing a single-vial vaccine that does not require mixing before administration would significantly reduce the risk of loss and simplify the vaccination process.
[0003] The subject matter discussed in the Background section should not be assumed to be prior art merely as a result of its mention in the Background section. Similarly, an understanding of the problems and causes of problems mentioned in the Background section or related to the subject matter of the Background section should not be assumed to have been previously recognized in the prior art. The subject matter in the Background section may simply represent a different approach and may itself be an invention. All publications, patents, and patent applications cited herein are incorporated by reference in their entirety for all purposes. Summary of the Invention
[0004] One aspect of the present invention is a dry powder vaccine composition comprising an effective amount of an antigen, an adjuvant, a metabolizable oil, and one or more excipients, wherein the particle size of the dry powder has a diameter of less than about 120 μm. Another aspect of the present invention is a dry powder vaccine composition comprising an effective amount of an adjuvant, a metabolizable oil, and one or more excipients, wherein the particle size of the dry powder has a diameter of less than about 120 μm. In some embodiments, the particles of the dry powder vaccine have a diameter of less than about 20 μm. In some embodiments, the one or more excipients are sugars selected from the group consisting of trehalose, lactose, raffinose, and lactulose. In some embodiments, the metabolizable oil is selected from squalene, synthetic squalene, grape seed oil, polyprenol, olive oil, or synthetic isoprenoid. In some embodiments, the adjuvant is a TLR4 agonist. In some embodiments, the composition is thermostable for at least one month at temperatures between about 8°C and about 60°C. In some embodiments, the composition is thermostable for at least 3 months, including at least 12 months, including at least 6 months.
[0005] In some embodiments, the composition further comprises 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC), 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (POPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), dipalmitoylphosphatidylcholine (DSPC), egg PC, lecithin, Tween, or a combination thereof. In some embodiments, the metabolizable oil is squalene. In some embodiments, the TLR4 agonist is MPL, 3d-MPL, or synthetic GLA. In some embodiments, the TLR4 agonist is GLA. In some embodiments, the particle size is less than about 120 μm, and the composition is inhalable. In some embodiments, the antigen is a polypeptide, a nucleic acid encoding a polypeptide, or a pathogen. In some embodiments, the dry powder is produced by spray drying.
[0006] Other aspects of the present invention include inhalable dry powder vaccine compositions comprising an effective amount of an adjuvant, a metabolizable oil, and one or more excipients, wherein the particle size of the dry powder has a diameter of less than about 120 μm. In some embodiments, the inhalable dry powder vaccine compositions comprise an effective amount of an antigen, an adjuvant, a metabolizable oil, and one or more excipients, wherein the particle size of the dry powder has a diameter of less than about 20 μm. In some embodiments, the particles of the inhalable dry powder vaccine have a diameter of less than about 10 μm or as low as 100 nm to 300 nm. In some embodiments, the composition is thermostable for at least one month at temperatures of about 8°C to about 60°C. In some embodiments, the composition comprises a shell-forming agent derived from the group of peptides or amino acids. In some embodiments, the shell-forming agent is leucine. In some embodiments, the composition comprises 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC), 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (POPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), dipalmitoylphosphatidylcholine (DSPC), egg PC, lecithin, Tween, or a combination thereof.
[0007] Another aspect of the present invention is a method for producing a thermostable dry powder vaccine composition, comprising spray-drying an oil-in-water emulsion to form a thermostable dry powder vaccine composition, the oil-in-water emulsion comprising (1) an antigen, (2) a metabolizable oil, (3) one or more excipients, (4) an adjuvant, and (5) a shell-forming agent. In some embodiments, the method comprises packaging the spray-dried vaccine in an aluminum bag with a double heat seal along with a desiccant pouch. In some embodiments, the oil-in-water emulsion further comprises a shell-forming agent. In some embodiments, the oil-in-water emulsion further comprises 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC), 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (POPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), egg PC, lecithin, Tween, or a combination thereof. In some embodiments, the method also includes spray drying the composition in a spray dryer using an atomization gas at predetermined process parameters to obtain a spray-dried powder vaccine. In some embodiments, the parameters include an atomization gas pressure of 10 psi, an atomization gas flow rate of 0.6 mL / min, and a drying gas flow rate of 200 SLPM.
[0008] Another aspect of the invention is a method of administering a thermostable dry powder therapeutic composition to a subject, comprising administering a thermostable dry powder vaccine via dry powder inhalation.
[0009] Another aspect of the invention is a method of administering a heat-stable dry powder vaccine composition to a subject, comprising: (1) reconstituting the dry powder vaccine with an aqueous diluent; and (2) administering the reconstituted dry powder vaccine via a parenteral route. In some embodiments, the heat-stable dry powder vaccine is any of the compositions provided herein.
[0010] Another aspect of the present invention is a method of administering a dry powder therapeutic composition to a subject, comprising administering a thermostable dry powder therapeutic via inhalation of the dry powder. The therapeutic immune response elicited by the method can be for the treatment of cancer. The method also includes parenterally administering the dry powder therapeutic after reconstitution. In some embodiments, the dry powder vaccine may demonstrate therapeutic benefit in diseases with a respiratory component, including, but not limited to, tuberculosis (TB), influenza (flu), respiratory syncytial virus (RSV), and lung cancer. In some embodiments, when delivery is via inhalation, the particle size is less than about 20 μm. In some embodiments, when delivery is via the respiratory route (such as the nose or lungs), the particle size is less than about 120 μm.
[0011] Any of the above embodiments may be used alone or together with each other in any combination. The inventions encompassed within this specification may also include embodiments that are only partially mentioned or suggested in this summary or abstract, or not mentioned or suggested at all. [Brief explanation of the drawings]
[0012] In the following drawings, like reference numerals are used to refer to like elements. The following figures show various examples of the present invention, but the present invention is not limited to the examples shown in the figures.
[0013] [Figure 1] Figure 1a shows a simplified schematic illustrating the functional principle of the nano spray dryer, and Figure 1b shows a simplified schematic of the packaging protocol to ensure humidity control during powder storage. [Figure 2]Plots showing A) squalene concentration, B) nanoemulsion diameter size, and C) nanoemulsion polydispersity index for reconstituted SD-TG powder (left) and reconstituted SD-TGI powder (right) stored at the indicated temperatures for 3 months. The legend indicates the storage temperature for the powders. Error bars indicate the standard deviation of three measurements. Abbreviations: SD-TG, spray-dried trehalose + Tris + GLA-SE; SD-TGI, spray-dried trehalose + Tris + GLA-SE + ID93; GLA, glucopyranosyl lipid adjuvant; SE, squalene oil-in-water emulsion. [Figure 3] SEM images of a) SD-TG microparticles, b) SD-TGI microparticles, c) 100 mg / ml spray-dried trehalose, and d) freeze-dried TT (freeze-dried lead candidate) are shown. Scale is provided on each image. Abbreviations: SD-TG, spray-dried trehalose + Tris + GLA-SE; SD-TGI, spray-dried trehalose + Tris + GLA-SE + ID93; GLA, glucopyranosyl lipid adjuvant; SE, squalene oil-in-water emulsion. [Figure 4] SEM images of cracked SD-TG microparticles are shown to illustrate the internal morphology. A scale is provided on each image. Abbreviations: SD-TG, spray-dried trehalose + Tris + GLA-SE; GLA, glucopyranosyl lipid adjuvant; SE, squalene oil-in-water emulsion. [Figure 5] Figure 1 shows SEM images of SD-TGI powder after 3 months of storage at 40°C demonstrating that a) the sample maintains its external morphology after accelerated storage, and b) the internal particle structure is maintained. A scale is provided on each image. Abbreviations: SD-TGI, spray-dried trehalose + Tris + GLA-SE + ID93; GLA, glucopyranosyl lipid adjuvant; SE, squalene oil-in-water emulsion. [Figure 6]Figure 1 shows SEM images of SD-TGI powder after 3 months of storage at 40°C demonstrating that a) the sample maintains its external morphology after accelerated storage, and b) the internal particle structure is maintained. A scale is provided on each image. Abbreviations: SD-TGI, spray-dried trehalose + Tris + GLA-SE + ID93; GLA, glucopyranosyl lipid adjuvant; SE, squalene oil-in-water emulsion. [Figure 7] Normalized Raman spectra of the SD-TG powder sample are shown, along with reference spectra of amorphous trehalose, squalene, 1 M Tris buffer at pH 7.5, and crystalline trehalose. Normalized residual spectra, obtained by subtracting the contributions of individual components from the raw measured SD-TG spectrum, are also shown. Abbreviations: SD-TGI, spray-dried trehalose + Tris + GLA-SE + ID93; GLA, glucopyranosyl lipid adjuvant; SE, squalene oil-in-water emulsion. [Figure 8] Figure 8 shows normalized Raman spectra of the SD-TGI powder formulations after 3 months of storage at 5, 25, and 40°C, as well as at time point 0. All samples shown were normalized according to the 460 cm peak. The residual spectrum obtained by subtracting the 3-month, 40°C spectrum from the spectrum obtained at time point 0 is also shown. The essentially straight remaining spectrum indicates that the SD-TGI powder stored at 40°C for 3 months does not have a significantly different solid phase than at the start of the stability study. Figure 8 shows a diagram of the Next Generation Impactor (NGI). The version shown has been combined with the Alberta Idealized Throat and can be used to model deposition in the human throat and lung. DETAILED DESCRIPTION OF THE INVENTION
[0014] Various embodiments of the present invention may be motivated by various deficiencies in the prior art, which may be discussed or suggested in one or more places herein, but embodiments of the present invention do not necessarily address any of these deficiencies. In other words, different embodiments of the present invention may address different deficiencies that may be discussed herein. Some embodiments may only partially address some or only one of the deficiencies that may be discussed herein, and some embodiments may not address any of these deficiencies.
[0015] In one aspect, spray drying is used to produce a dry powder vaccine containing an antigen or an adjuvant, or both. Thus, the present invention provides a dry powder vaccine composition comprising an effective amount of an antigen, an adjuvant, a metabolizable oil, and one or more excipients, wherein the particle size of the dry powder has a diameter of less than about 120 μm for respiratory delivery (e.g., nasal or pulmonary), or less than about 20 μm for respiratory delivery (e.g., by inhalation). In other embodiments, the dry powder vaccine does not have an antigen. In some embodiments, the dry powder vaccine does not have an adjuvant. In some embodiments, the dry powder vaccine has two or more antigens or adjuvants, or both. The dry powder vaccine can be formulated and spray-dried to create a particle size that facilitates administration via inhalation. Thus, in some embodiments, the dry powder vaccine has a particle size of less than about 20 μm, including but not limited to, 19 μm, 18 μm, 17 μm, 16 μm, 15 μm, 14 μm, 13 μm, 12 μm, 11 μm, 10 μm, 9 μm, 8 μm, 7 μm, 6 μm, 5 μm, 4 μm, 3 μm, 2 μm, 1 μm, less than 900 nm, less than 800 nm, less than 700 nm, less than 600 nm, less than 500 nm, less than 400 nm, less than 300 nm, less than 200 nm, and less than 100 nm. In some embodiments, the dry powder vaccine has a particle size of less than about 120 μm, including but not limited to, 110 μm, 100 μm, 90 μm, 80 μm, 70 μm, 60 μm, 50 μm, 40 μm, 30 μm, and 20 μm. In some embodiments, the formulation for an inhalable dry powder vaccine also includes a shell-forming agent (e.g., leucine). Another aspect of the invention is a method of making a heat-stable and / or inhalable dry powder vaccine composition.
[0016] As those skilled in the art will appreciate, the terms spray-dried vaccine, spray-dried adjuvant mixture, spray-dried vaccine composition, heat-stable spray-dried vaccine, dry powder vaccine, dry powder adjuvant, and dry powder vaccine composition are used interchangeably herein. These terms generally refer to a spray-dried powder containing an effective amount of an antigen, an adjuvant, a metabolizable oil, and one or more excipients, wherein the particle size of the dry powder has a diameter of less than about 50 μm. In some embodiments, the particle size of the dry powder has a diameter of less than about 20 μm. In some embodiments, the particle size of the dry powder has a diameter of less than 15 μm, including, but not limited to, less than 10 μm, less than 5 μm, less than 4 μm, less than 3 μm, less than 2 μm, less than 1 μm, less than 900 nm, less than 800 nm, less than 700 nm, less than 600 nm, less than 500 nm, less than 400 nm, less than 300 nm, less than 200 nm, and less than 100 nm. The vaccine can be administered as a dry powder (via inhalation) or after reconstitution (eg, via parenteral routes).
[0017] As provided herein, the spray-dried vaccine is heat stable. For example, the composition is stable at about 8°C to about 60°C, including, but not limited to, 10°C, 15°C, 20°C, 25°C, 30°C, 35°C, 40°C, 45°C, 50°C, and 55°C. Such compositions further comprise suitable excipients (carriers), such as pharmaceutically acceptable excipients including buffers, acids, bases, sugars, diluents, preservatives, shell-forming agents, cryopreservatives, etc., as are well known in the art and described herein.
[0018] Conversion of liquid materials, such as vaccines, into dry powders would reduce costs associated with refrigeration and transportation. Spray drying offers a unique solution because it allows powders to be engineered to have specific properties. As such, in the examples herein, spray drying was investigated as a method for encapsulating an adjuvanted tuberculosis vaccine formulated as an oil-in-water nanoemulsion within a dry powder. Successful encapsulation of the adjuvanted vaccine within non-aggregating, amorphous microparticles was achieved in a single replicate, with high retention of all components. The stability of the powder was investigated over a 3-month period at different temperatures. Results indicated that the powder was physically stable at all temperatures. Physicochemical analysis of the reconstituted powders showed that the nanoemulsion size was maintained for all samples, but there was a small loss of antigen and adjuvant over time upon storage at elevated temperatures. These proof-of-concept results demonstrate a novel method for adjuvanted vaccine encapsulation, with room for stability improvement through further formulation development. The use of spray drying also enables an inhalable delivery route.
[0019] In some aspects, the present invention provides a method for stimulating an immune response in a subject, comprising reconstituting a spray-dried vaccine composition described herein into an emulsion and administering the emulsion to a subject. In some embodiments, the emulsion is an oil-in-water emulsion. In some embodiments, the immune response is a non-specific immune response. In some embodiments, the immune response is an antigen-specific immune response. The methods described herein for stimulating an immune response, or the reconstituted heat-stable spray-dried vaccine composition described herein, can be used alone or in combination with other conventional treatment methods (e.g., chemotherapeutic agents). In another embodiment, the present invention provides a method for stimulating an immune response in a subject, comprising administering (via inhalation) a dry powder to a subject without reconstitution.
[0020] In some embodiments, the present invention provides methods for administering a therapeutic agent for the treatment of cancer, autoimmune diseases, etc. The method may include administering a therapeutic amount of a dry powder composition to the lungs or respiratory system via inhalation or other methods. The method may include reconstituting the dry powder composition and then parenterally administering the reconstituted composition.
[0021] In some embodiments, spray-dried vaccine compositions were tested, and the nanoemulsion size was maintained for all samples. This was a surprising result, as it was not known in the art that a nanoemulsion of a material that is liquid at room temperature could be converted to gel-microparticles and reconstituted to the same droplet size without significant loss. Previous attempts resulted in either significant loss or change in droplet size.
[0022] In some embodiments, reference herein to "about" a value or parameter includes (and describes) variations on the value or parameter itself. For example, a description referring to "about X" includes a description of "X."
[0023] definition It is understood that aspects and embodiments of the invention described herein include "comprising," "consisting of," and "consisting essentially of" aspects and embodiments.
[0024] An "individual" or "subject" is a mammal, more preferably a human. Mammals also include, but are not limited to, farm animals, sport animals, pets (such as cats, dogs, horses, etc.), primates, mice, and rats.
[0025] As used in this specification and the appended claims, the singular forms "a," "an," and "the" include plural references unless the context clearly dictates otherwise.
[0026] As used herein, "spray-dried emulsion" is used interchangeably with "dry powder vaccine," "dry powder," "dry powder adjuvant," "dry powder composition," "spray-dried composition," "spray-dried vaccine," "powder," and "dry emulsion."
[0027] As used herein, a "reconstituted" dry powder vaccine or vaccine refers to adding a liquid to a dry powder, which may be for the purpose of administering the vaccine or for the purpose of testing the vaccine.
[0028] As used herein, "spray drying" is a process that produces a powder through the drying of aerosolized solution droplets.
[0029] As used herein, excipients refer to substances other than the pharmacologically active drug that are included in the manufacturing process of a pharmacologically active drug or in the fill-finish process for storage or shipping. As used herein, "spray-drying excipients" or "excipients" may refer to substances other than the pharmacologically active drug that are included in the spray-drying process to contribute to the formation or formulation of a suitable powder structure. Excipients may include bulking agents, buffers, emulsifiers, or solubilizers.
[0030] GLA-SE is a vaccine adjuvant consisting of glucopyranosyl lipid adjuvant (GLA), a synthetic Toll-like receptor 4 agonist, formulated in a squalene-in-water emulsion (SE). GLA-SE enhances both TH1- and IgG2-skewed antibody responses to various vaccine antigens.
[0031] ID93 is a subunit TB vaccine candidate composed of four antigens representing distinct families of Mtb proteins. Rv1813 is a conserved hypothetical protein predicted to be upregulated under hypoxic growth and localized to the outer membrane. Rv2608 (PPE42) is a putative outer membrane-associated PPE (Pro-Pro-Glu (PPE) motif-containing) protein. Rv3619 (EsxV) and Rv3620 (EsxW) are secreted proteins belonging to the ESAT-6 family of virulence factors. The four ID93 antigens have been shown to be recognized in Mtb-exposed individuals.
[0032] Spray drying is a gentle method for producing powders with defined particle sizes from solutions, dispersions, and emulsions, used in pharmaceuticals, food, biotechnology, and other industrial material synthesis. Figure 1a shows a diagram of a typical spray drying technique, in which spray drying uses a drying gas to rapidly evaporate the solvent (or water) from atomized particles, leaving only the solid components of the solution (dry powder). The drying medium is typically air, but inert gases, such as nitrogen, can be used if the liquid is a flammable solvent or if the product is oxygen-sensitive.
[0033] Previously, limitations of spray drying were particle size (minimum 2 micrometers), yield (maximum approximately 70%), and sample volume (minimum 50 ml for laboratory-scale devices). Recently, the minimum particle size has been reduced to 300 nm, yields of up to 90% are possible, and samples as small as 1 ml can be achieved. These expanded limits are possible with new technological developments in spray heads, heating systems, and electrostatic particle collectors. To emphasize the small particle sizes possible with this new technology, it is described as "nano" spray drying. However, the smallest particles produced are in the submicrometer range common to fine particles, rather than ultrafine particles on the nanometer scale.
[0034] Common techniques The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology, recombinant DNA, biochemistry, and chemistry that are within the skill of the art, and such techniques are explained fully in the literature. See, for example, Molecular Cloning A Laboratory Manual, 2nd Ed., Sambrook et al., ed., Cold Spring Harbor Laboratory Press: (1989), DNA Cloning, Volumes I and II (D.N. Glover ed., 1985), Oligonucleotide Synthesis (M.J. Gait ed., 1984), Mullis et al., U.S. Patent No. 4,683,195, Nucleic Acid Hybridization (B.D. Hames & S.J. Higgins eds. 1984), B. Perbal, A Practical Guide To Molecular Cloning (1984), the article, Methods In Enzymology (Academic Press, Inc., NY), and Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1989).
[0035] Characteristics of spray-dried adjuvant or antigen compositions Spray-dried compositions containing an antigen and / or adjuvant are provided herein. In some embodiments, the spray-dried composition is a dry powder vaccine composition. The dry powder vaccine composition can be an antigen composition, an adjuvant composition, and / or an antigen / adjuvant (1 vial) composition. The present invention describes that the antigen-adjuvant vaccine composition can be spray-dried and stored, maintained, or exposed to temperatures of about 8°C to about 60°C, and the composition can be administered in reconstituted form or as a dry powder via inhalation. Furthermore, when reconstituted, the composition can have one or more of the following characteristics: (1) maintain a desirable pH near physiological 7.4; (2) maintain a particle size of less than 120 μm with little or no aggregation; (3) exhibit no significant degradation or alteration of each active ingredient (e.g., antigen, adjuvant); and (4) be suitable for inducing or stimulating an immune response in a subject.
[0036] The thermal stability of the spray-dried (dry powder) vaccine compositions provided herein can be assessed in the spray-dried (powder) state or after reconstitution. The thermal stability of the spray-dried vaccine compositions provided herein can be assessed by visual observation and / or with the aid of one or more of the assays provided herein. These assays can provide an estimate of the integrity of the emulsion, antigen, and / or adjuvant after spray-drying and reconstitution.
[0037] The thermal stability assay and observation described herein can be carried out during spray drying, 1 hour after spray drying, 6 hours after spray drying, 12 hours after spray drying, 24 hours after spray drying, 36 hours after spray drying, 48 hours after spray drying, 1 week after spray drying, 2 weeks after spray drying, 1 month after spray drying, 2 months after spray drying, 3 months after spray drying, 4 months after spray drying, 6 months after spray drying, 12 months after spray drying, or later.Before carrying out the assay and observation, the composition can be maintained, stored, or exposed to a temperature of about 8 ° C or higher, for example, about 25 ° C or higher, about 37 ° C or higher, or about 50 ° C or higher, or about 60 ° C.
[0038] The thermal stability assays and observations described herein can be performed upon reconstitution of the dry powder composition, immediately after reconstitution, 1 hour after reconstitution, 6 hours after reconstitution, 12 hours after reconstitution, 24 hours after reconstitution, 36 hours after reconstitution, 48 hours after reconstitution, or 1 week after reconstitution.
[0039] Those skilled in the art will appreciate that the present invention is designed to provide dry powder vaccine compositions that can be stored and / or shipped at temperatures that more closely approximate ambient temperatures in the developed or developing world, and thus, in some embodiments, the spray-dried compositions are maintained, stored, or exposed to two or more temperatures or combinations of temperatures from about 8°C to about 60°C.
[0040] In some embodiments, the thermal stability of the dry powder vaccine compositions provided herein is assessed by visual observation prior to reconstitution as a dry powder. In other embodiments, the thermal stability of the dry powder vaccine compositions provided herein is assessed after reconstitution with the aid of one or more assays, e.g., biophysical and biochemical assays.
[0041] In some embodiments, the particle size of the dry powder or reconstituted vaccine is evaluated. For example, dynamic light scattering (DLS) can be used to evaluate emulsion particle size. In some embodiments, this is compared with the emulsion particle size before spray-drying, for example, in a liquid stable emulsion state before spray-drying. In some embodiments, the emulsion particle size is not compared with the particle size before spray-drying. In some embodiments herein, the particle size is determined by measuring the Z-average diameter (Z-average) of the liquid dry powder composition. In certain embodiments, a thermostable composition is indicated when a reconstituted liquid emulsion of a spray-dried composition maintained, stored, or exposed to a temperature of about 8° C. or greater has a particle size with a Z-average diameter of less than about 200 nm, less than about 190 nm, less than about 180 nm, less than about 170 nm, less than about 160 nm, less than about 150 nm, less than about 140 nm, less than about 130 nm, less than about 120 nm, less than about 110 nm, less than about 100 nm, or less than about 90 nm, less than about 80 nm, less than about 70 nm, or less than about 60 nm. In certain embodiments, the reconstituted emulsion has a particle size with a Z-average diameter range of about 100 nm to about 200 nm.
[0042] In some embodiments, the polydispersity index (PdI) is evaluated after the reconstitution of the spray-dried composition.For example, dynamic light scattering (DLS) can be used to evaluate PdI.In some embodiments, this is compared with the PDI of the liquid emulsion before spray drying, for example, in the liquid stable emulsion state before spray drying.
[0043] In some embodiments, the pH of the emulsion is assessed after reconstitution of the spray-dried (dry powder) composition, which in some embodiments is compared to the pH before spray drying, e.g., the pH of the liquid stable emulsion state before spray drying.
[0044] In some embodiments, the percent degradation or breakdown of antigen, adjuvant, and / or other components of the dry powder composition is assessed upon reconstitution or as a dry powder. In some embodiments, reverse-phase high-performance liquid chromatography (RP-HPLC) is used to assess chemical degradation of the components, if any. In one exemplary embodiment, chemical degradation of squalene, DMPC, and GLA is monitored by RP-HPLC. In other embodiments, gel-based Coomassie staining is used to assess degradation of the vaccine protein antigen, if any, of the spray-dried composition upon reconstitution. Thermostable compositions provided herein are those that exhibit about 25%, 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1% or less degradation, loss, or degradation of antigen and / or adjuvant or other components after reconstitution of a thermostable spray-dried composition maintained at a temperature of about 8°C or greater.
[0045] excipients The excipients of the present invention may be used alone or in combination with other excipients, including, but not limited to, shell-forming agents, buffering agents, solubilizing agents, tonicity agents, tonicity adjusters, surfactants, emulsifying agents, antimicrobial agents, and / or collapse temperature modifiers.
[0046] In some embodiments, an excipient is a substance other than the pharmacologically active drug that is included in the manufacturing process or fill-finish process for storage or shipping of the pharmacologically active drug, including, without limitation, spray drying, and is included in the finish pharmaceutical process.
[0047] In some embodiments, an excipient is a substance that is added to a liquid stable oil-in-water emulsion formulation before spray drying to produce a powder after spray drying. In some embodiments, an excipient is a substance that enhances the inhalability of the spray-dried formulation, such as by reducing the particle size of the spray-dried powder or by making it less likely that particles will adhere to each other or to tissues in the mouth, throat, or esophagus.
[0048] Suitable excipients for vaccine formulations and / or spray-dried vaccine or adjuvant formulations are known in the art (see, e.g., Bahetia et al., 2010: J. Excipients and Food Chem.: 1(1)41-54, Grabenstein J D. ImmunoFacts: Vaccines and Immunologic Drugs--2012 (37th revision). St Louis, Mo.: Wolters Kluwer Health, 2011 and, by Vaccine) and include buffers, solubilizers, tonicity agents, tonicity adjusters, surfactants, emulsifiers, antimicrobial agents, and / or collapse temperature modifiers.A list of excipients in currently approved vaccines can be found via the Centers for Disease Control (see "Vaccine Excipient & Media Summary. Excipients Included in US Vaccines, by Vaccine" at cdc.gov / vaccines / pubs / pinkbook / downloads / appendices / B / excipient-table-2.p-df., September 2013), and includes, without limitation, sucrose, D-mannose, D-fructose, dextrose, potassium phosphate, plasdone C, anhydrous lactose, microcrystalline cellulose, polacrilin potassium, magnesium stearate, cellulose acetate phthalate, alcohol, acetone, castor oil, FD&C Yellow Contains #6 aluminum lake dye, human serum albumin, fetal bovine serum, sodium bicarbonate, human diploid fibroblast culture (WI-38), Dulbecco's modified Eagle's medium, aluminum hydroxide, benzethonium chloride, formaldehyde, gluteraldehyde, amino acids, vitamins, inorganic salts, sugars, glycerin, asparagine, citric acid, potassium phosphate, magnesium sulfate, ammonium ferric citrate, lactose, aluminum potassium sulfate, aluminum hydroxyphosphate, aluminum potassium sulfate, peptone, bovine extract, thimerosal (trace amount), modified Mueller and Miller medium, beta-propiolactone, thimerosol (multidose vial only), sodium phosphate monobasic, sodium phosphate dibasic, potassium phosphate monobasic, potassium chloride, potassium glutamate, calcium chloride, sodium taurodeoxycholate, neomycin sulfate, polymyxin B, egg protein, lactalbumin hydrolysate, and neomycin sulfate.
[0049] buffer In some embodiments, the composition of the present invention comprises a buffer. Buffers useful as excipients in the present invention include Tris acetate, Tris base, Tris HCl, ammonium phosphate, citric acid, sodium citrate, potassium citrate, tartaric acid, sodium phosphate, zinc chloride, arginine, and histidine. In some embodiments, the buffer includes a pH adjuster such as hydrochloric acid, sodium hydroxide, and meglumine.
[0050] solubilizer In some embodiments, suitable solubilizing agents include complexing excipients such as ethylenediaminetetraacetic acid (EDTA), alphacyclodextrin, hydroxypropyl-β-cyclodextrin (HP-β-CD), etc. Surfactants may also be included as solubilizing excipients, including polysorbate 80 and Tween. Other cosolvents known in the art as solubilizing agents may be used, including tert-butyl alcohol, isopropyl alcohol, dichloromethane, ethanol, and acetone.
[0051] Tonicity agents for use as excipients in the present invention include glycerol, sodium chloride, sucrose, mannitol, and dextrose. Collapse temperature adjusters include dextran, hydroxyethyl starch, ficoll, and gelatin. Antimicrobial agents include benzyl alcohol, phenol, m-cresol, methylparaben, ethylparaben, and thimerosol.
[0052] Isotonic agents In some embodiments, the composition of the present invention comprises an isotonicity agent. In some embodiments, the isotonicity agent is glycerol. In one particular embodiment, the isotonicity agent is present in the oil-in-water emulsion formulation before spray drying or in the oil-in-water emulsion upon reconstitution at a concentration of about 0.36% v / v.
[0053] surfactants In some embodiments, the compositions of the present invention include a surfactant. In some embodiments, the surfactant is Pluronic F68. In some embodiments, the surfactant is present in a ratio of about 100:1 (oil:surfactant). In some embodiments, the surfactant is present in a concentration of about 0.018% w / v. In some embodiments, the surfactant is present in a concentration of about 0.0001% w / v, about 0.0005% w / v, about 0.001% w / v, about 0.005% w / v, about 0.01% w / v, about 0.011% w / v, about 0.012% w / v, about 0.013% w / v, about 0.014% w / v, about 0.015% w / v, about 0.016% w / v, about 0.017% w / v, about 0.018% w / v, about 0.019% w / v, or about It is present at a concentration of 0.02% w / v, about 0.03% w / v, about 0.04% w / v, about 0.05% w / v, about 0.06% w / v, about 0.07% w / v, about 0.08% w / v, about 0.09% w / v, about 0.1% w / v, about 0.2% w / v, about 0.3% w / v, about 0.4% w / v, about 0.5% w / v, about 0.6% w / v, about 0.7% w / v, about 0.8% w / v, about 0.9% w / v, or about 1% w / v. The percentages and ratios described herein refer to the ratios and percentages either in the oil-in-water emulsion formulation before spray drying, or in the dry powder, or in the dry powder after reconstitution.
[0054] emulsifier In some embodiments, the compositions of the present invention include an emulsifier. In some embodiments, the emulsifier is 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC). In some embodiments, the emulsifier is lecithin. In some embodiments, the emulsifier is present in a ratio of about 1:5 (emulsifier:oil). In some embodiments, the emulsifier is present in a concentration of about 0.38% w / v. In some embodiments, the emulsifier is about 0.002% w / v, about 0.005% w / v, about 0.010% w / v, about 0.015% w / v, about 0.020% w / v, about 0.025% w / v, about 0.030% w / v, about 0.035% w / v, about 0.040% w / v, about 0.045% w / v, about 0.050% w / v, about 0.055% w / v, about 0.060% w / v, about 0.065% w / v, about 0.070% w / v, about 0.075% w / v, about 0.080% w / v, about 0.085% w / v, about 0.090% w / v, about 0.095% w / v, about 0.10% w / v, about 0.15% w / v, or about 0.16% w / v. w / v, approx. 0.20%w / v, approx. 0.25%w / v, approx. 0.30%w / v, approx. 0.35%w / v, approx. 0.40%w / v, approx. 0.45%w / v , about 0.50%w / v, about 0.55%w / v, about 0.60%w / v, about 0.65%w / v, about 0.70%w / v, about 0.75%w / v, about 0. It is present at a concentration of about 80% w / v, about 0.85% w / v, about 0.90% w / v, about 0.95% w / v, about 1% w / v, about 2% w / v, about 3% w / v, about 4% w / v, about 5% w / v, about 6% w / v, about 7% w / v, about 7.5% w / v, about 8% w / v, about 9% w / v, or about 10% w / v. The percentages and ratios described herein refer to the ratios and percentages in either the oil-in-water emulsion formulation before spray drying or in the dry powder.
[0055] Adjuvants for use in heat-stable spray-dried vaccine compositions In some aspects of the invention provided herein, the compositions described herein (e.g., heat-stable spray-dried vaccines) include an adjuvant. In some embodiments, the adjuvant is provided alone, e.g., for use as a therapeutic agent. In other embodiments, the adjuvant is provided in combination with an antigen.
[0056] The adjuvant for use in the composition that modifies immune response is well known in the art.For example, the adjuvant for use in the composition described herein can comprise one or more of immunostimulatory adjuvants, delivery adjuvants, inorganic adjuvants or organic adjuvants.Non-limiting examples of the adjuvant for use in the composition described herein can be found in, among others, Barouch DH, 2008, Nature, 455(7213):613-9; Morrow et al., 2008, AIDS, 22(3):333-8 and McGeary et al., 2003, Peptide Sci., 9(7):405-181.
[0057] In some embodiments, the adjuvant used in the compositions described herein (e.g., heat-stable dry powder vaccines) is an immunostimulatory adjuvant. The immunostimulatory adjuvant can be an adjuvant that acts directly on the immune system, such as a cytokine, a TLR ligand, or a microbial toxin. In some embodiments herein, the adjuvant is a cytokine adjuvant. One or more cytokines may be suitable as adjuvants, alone or in combination with one or more additional adjuvants in the compositions described herein. Suitable cytokines include interferons (IFNs), interleukins (ILs), chemokines, colony-stimulating factors, or tumor necrosis factors. In some embodiments, the interferon is type I IFN, type II IFN, or type III IFN. In some embodiments, the interferon is Inala, Inbeat's, IFN-γ, or IFN-λ, and subtypes thereof (e.g., IFN-λ, IFN-λ2, and IFN-λ3). In some embodiments, the cytokine is an interleukin. Non-limiting examples of interleukins that can be used as adjuvants in the compositions described herein include IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-15, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-35, and IL-36. In some embodiments, the cytokine is a chemokine. In some embodiments, the chemokine is a CC chemokine, a CXC chemokine, a C chemokine, or a CX3C chemokine.Non-limiting examples of CC chemokines that can be used as adjuvants in the compositions described herein include CCL1, CCL2, CCL3, CCL4, CCL5, CCL6, CCL7, CCL7, CCL8, CCL9, CCL10, CCL11, CCL12, CCL13, CCL14, CCL15, CCL16, CCL17, CCL18, CCL19, CCL20, CCL21, CCL22, CCL23, CCL24, CCL25, CCL26, CCL27, and CCL28. Non-limiting examples of CXC chemokines that can be used in the compositions described herein include CXCL1, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11, CXCL12, CXCL13, CXCL14, CXCL15, CXCL16, and CXCL17. In some embodiments, the cytokine is a colony-stimulating factor. In some embodiments, the colony-stimulating factor is granulocyte-macrophage colony-stimulating factor (GM-CSF), granulocyte-colony-stimulating factor (G-CSF), or macrophage-colony-stimulating factor (M-CSF). In some embodiments, the cytokine is tumor necrosis factor. Non-limiting examples of tumor necrosis factor family proteins that can be used as adjuvants in the compositions described herein include TNF-α and 4-1BBL.
[0058] In some embodiments, the immunostimulatory adjuvant is a Toll-like receptor (TLR) ligand (e.g., a TLR agonist). One or more TLR ligands may be suitable as adjuvants alone or in combination with one or more additional adjuvants in the compositions described herein. TLRs include cell surface transmembrane receptors of the innate immune system that provide host cells with the initial recognition capability for a variety of conserved microbial molecular structures, such as those present in or on many infectious pathogens. (e.g. Armant et al.,2002 Genome Biol.3(8):reviews3011.1-3011.6, Fearon et al.,1996 Science 272:50, Medzhitov et al.,1997 Curr.Opin.Immunol.9:4, Luster 2002 Curr.Opin.Immunol.14:129, Lien et al. al.2003 Nat.Immunol.4:1162, Medzhitov,2001 Nat.Rev.Immunol.1:135, Takeda et al.,2003 Ann Rev Immunol.21:335, Takeda et al.2005 Int.Immunol.17:1, Kaisho et al.,2004 Microbes Infect.6:1388, Datta et al.,2003 J.Immunol.170:4102).
[0059] Induction of TLR-mediated signaling, which promotes the initiation of immune responses via the innate immune system, can be triggered by TLR agonists (i.e., TLR ligands) that engage cell surface TLRs. For example, lipopolysaccharide (LPS) can be a TLR agonist via TLR2 or TLR4 (Tsan et al., 2004 J. Leuk. Biol. 76:514, Tsan et al., 2004 Am. J. Physiol. Cell Physiol. 286:C739, Lin et al., 2005 Shock 24:206), poly(inosine-cytidine) (poly l:C) can be a TLR agonist via TLR3 (Salem et al., 2006 Vaccine 24:5119), and oligodeoxynucleotides containing CpG sequences (unmethylated cytosine-guanosine or "CpG" dinucleotide motifs, e.g., CpG 7909, Cooper et al., 2005 AIDS 19:1473, CpG 10101 Bayes et al. Methods Find Exp Clin Pharmacol 27:193, Vollmer et al. Expert Opinion on Biological Therapy 5:673, Vollmer et al., 2004 Antimicrob. Agents Chemother. 48:2314, Deng et al., 2004 J. Immunol. 173:5148) may be a TLR agonist via TLR9 (Andaloussi et al., 2006 Glia 54:526, Chen et al., 2006 J. Immunol. 177:2373), and peptidoglycan may be a TLR2 and / or TLR6 agonist (Soboll et al., 2006 Biol. Reprod. 75:131, Nakao et al., 2005 J. Immunol. 174:1566), 3M003 (also a source of related compounds 3M001 and 3M002, 3M Pharmaceuticals, St. Paul, Minn.4-amino-2-(ethoxymethyl)-α,α-dimethyl-6,7,8,9-tetrahydro-1H-imidazo[4,5-c]quinoline-1-ethanol hydrate, molecular weight 318 Da, from Gorden et al., 2005 J. Immunol. 174:1259) may be a TLR7 agonist (Johansen 2005 Clin. Exp. Allerg. 35:1591) and / or a TLR8 agonist (Johansen 2005), flagellin may be a TLR5 agonist (Feuillet et al., 2006 Proc. Nat. Acad. Sci. USA 103:12487), and profilin may be a TLR11 agonist (Hedhli et al., 2006 Proc. Nat. Acad. Sci. USA 103:12487). al., 2009, Vaccine, 27(16):2274-87), lipopeptides can be TLR1, TLR2, and / or TLR6 agonists (Gao et al., 2013, Vaccine, 31(26):2796-803), and hepatitis C antigens can act as TLR agonists via TLR7 and / or TLR9 (Lee et al., 2006 Proc. Nat. Acad. Sci. USA 103:1828; Horsmans et al., 2005 Hepatol. 42:724). Other TLR agonists are known (e.g., Schirmbeck et al., 2003 J. Immunol. 171:5198) and can be used in accordance with certain presently described embodiments.
[0060] For example, by way of background (see, e.g., U.S. Pat. No. 6,544,518), immunostimulatory oligonucleotides containing unmethylated CpG dinucleotides ("CpG") are known to be adjuvants when administered by both systemic and mucosal routes (WO 96 / 02555, EP 468520, Davis et al., J. Immunol., 1998. 160(2):870-876, McCluskie and Davis, J. Immunol., 1998, 161(9):4463-6). CpG is an abbreviation for the cytosine-guanosine dinucleotide motif present in DNA. The central role of the CG motif in immune stimulation was elucidated by Krieg, Nature 374, p 546 1995. Detailed analysis showed that the CG motif must be in a specific sequence context, and that such sequences are common in bacterial DNA but rare in vertebrate DNA. Immunostimulatory sequences are often purine, purine, C, G, pyrimidine, pyrimidine, and the dinucleotide CG motif is unmethylated, although other unmethylated CpG sequences are known to be immunostimulatory and can be used in certain embodiments of the present invention. When formulated into a vaccine, CpG can be administered in free solution with free antigen (WO96 / 02555, McCluskie and Davis, supra), or covalently bound to the antigen (PCT Publication No. 98 / 16247), or formulated with a carrier such as aluminum hydroxide (e.g., Davis et al., supra; Brazolot-Millan et al., Proc. Natl. Acad. Sci., USA, 1998, 95(26), 15553-8).
[0061] In some embodiments, the oligonucleotide for use as adjuvant of the present invention contains two or more dinucleotide CpG motifs separated by at least three, more preferably at least six or more nucleotides.The oligonucleotide of the present invention is typically deoxynucleotide.In preferred embodiments, the internucleotide in oligonucleotide is phosphorodithioate, or more preferably phosphorothioate bond, but phosphodiester and other internucleotide bond are also within the scope of the present invention, including the oligonucleotide with mixed internucleotide bond.The method for producing phosphorothioate oligonucleotide or phosphorodithioate is described in U.S. Patent No. 5,666,153, U.S. Patent No. 5,278,302 and WO95 / 26204.
[0062] Examples of preferred oligonucleotides have the sequences disclosed in the following publications, and for certain embodiments disclosed herein, the sequences preferably contain phosphorothioate-modified internucleotide linkages: (1) CPG 7909: Cooper et al., "CPG 7909 adjuvant improves hepatitis B virus vaccine seroprotection in antiretroviral-treated HIV-infected adults." AIDS, 2005 Sep. 23;19(14):1473-9; (2) CpG 10101: Bayes et al., "Gateways to clinical trials." Methods Find. Exp. Clin. Pharmacol. 2005 Apr. 27(3):193-219; and (3) Vollmer J., "Progress in drug development of immunostimulatory CpG oligodeoxynucleotide ligands for TLR9." Expert Opinion on Biological Therapy. 2005 May;5(5):673-682.
[0063] Alternative CpG oligonucleotides may include polymorphisms of the preferred sequences described in the publications cited above, differing in that they have minor nucleotide sequence substitutions, insertions, deletions, and / or additions. The CpG oligonucleotides utilized in certain embodiments of the present invention can be synthesized by any method known in the art (e.g., EP 468520). Conveniently, such oligonucleotides can be synthesized using an automated synthesizer. Oligonucleotides are typically deoxynucleotides. In preferred embodiments, the internucleotide linkages in the oligonucleotides are phosphorodithioate, or more preferably, phosphorothioate, although phosphodiesters are also within the scope of currently contemplated embodiments. Oligonucleotides containing different internucleotide linkages, such as mixed phosphorothioate phosphodiesters, are also contemplated. Other internucleotide linkages that stabilize the oligonucleotide can also be used.
[0064] In certain embodiments, the adjuvant is a TLR4 agonist. In some embodiments, the TLR4 agonist used in the compositions of the present invention comprises a glucopyranosyl lipid adjuvant (GLA), such as those described in U.S. Patent Publication Nos. 2007 / 021017, 2009 / 045033, 2010 / 037466, and 2010 / 0310602, the contents of which are incorporated herein by reference in their entirety. In some embodiments, the adjuvant used in the compositions of the present invention herein is an attenuated lipid A derivative (ALD). ALD is a lipid A-like molecule that has been modified or constructed so that the molecule exhibits less or different adverse effects than lipid A. These adverse effects include pyrogenicity, local Shwartzman reactivity, and toxicity, as assessed by chick embryo 50% lethal dose assay (CELD50). ALD useful in accordance with the present invention includes monophosphoryl lipid A (MLA) and 3-deacylated monophosphoryl lipid A (3D-MLA). MLA and 3D-MLA are known and need not be described in detail herein. For example, see U.S. Patent No. 4,436,727, issued March 13, 1984, assigned to Ribi ImmunoChem Research, Inc., which discloses monophosphoryl lipid A and its preparation. U.S. Patent No. 4,912,094 and Reexamination Certificate B1 U.S. Patent No. 4,912,094 to Myers et al., also assigned to Ribi ImmunoChem Research, Inc., embody 3-deacylated monophosphoryl lipid A and its preparation method.
[0065] In some embodiments, response modifiers such as imidazoquinolines and other immune response modifiers known in the art may also be included as adjuvants in certain presently disclosed embodiments. Certain preferred imidazoquinoline immune response modifiers include, by way of non-limiting example, resiquimod (R848), imiquimod, and gardiquimod (Hemmi et al., 2002 Nat. Immunol. 3:196; Gibson et al., 2002 Cell. Immunol. 218:74; Gorden et al., 2005 J. Immunol. 174:1259), and these and other imidazoquinoline immune response modifiers may also possess TLR agonist activity as described herein under appropriate conditions. Another immune response modifier is a nucleic acid-based double stem-loop immune modifier (dSLIM). Specific examples of dSLIMs contemplated for use in certain presently disclosed embodiments can be found in Schmidt et al., 2006 Allergy 61:56; Weihrauch et al. 2005 Clin Cancer Res. 11(16):5993-6001; Modern Biopharmaceuticals, J. Knablein (Editor). John Wiley & Sons, December 6, 2005. (dSLIMs are discussed on pages 183 to about 200), and Mologen AG (Berlin, FRG: [Retrieved online August 18, 2006, see the World Wide Web at mologen.com / English / 04.20-dSLIM.shtml]).
[0066] In some embodiments, the adjuvant used in the compositions described herein is a polysaccharide derived from bacteria or plants.Non-limiting examples of polysaccharide-based adjuvants that can be used alone or in combination with one or more additional adjuvants in the compositions described herein include glucan (e.g., beta-glucan), dextran (e.g., sulfated and diethylaminoethyl-dextran), glucomannan, galactomannan, levan, xylan, fructan (e.g., inulin), chitosan, endotoxin (e.g., lipopolysaccharide), Biobran MGN-3, polysaccharide from Actinidia eriantha, eldexomer, and variations thereof.
[0067] In some embodiments, the adjuvant used in the compositions described herein is a proteasome or a subunit thereof. In some embodiments, the adjuvant used in the compositions described herein comprises the same or different antigenic peptide sequences assembled around a lysine core. In some embodiments, the adjuvant used in the compositions described herein is a toxin (e.g., a bacterial toxin). In some embodiments, the toxin is derived from one or more bacteria selected from the group consisting of Escherichia coli, Vibrio cholera, Bordetella pertussis, and Bordetella parapertussis.
[0068] In some embodiments, the adjuvant used in the compositions described herein (e.g., heat-stable dry powder vaccines) is a delivery adjuvant. A delivery adjuvant can function as an adjuvant and / or deliver an antigen. Non-limiting examples of adjuvants that can be used alone or in combination with one or more additional adjuvants in the compositions described herein include mineral salts (e.g., calcium phosphate), emulsions (e.g., squalene in water), liposomes (e.g., DPPC:cholesterol liposomes), virosomes (e.g., immune-enhancing reconstituted influenza virosomes), and microspheres.
[0069] Other adjuvants for use in certain embodiments disclosed herein include block copolymers or biodegradable polymers, which refer to the class of polymeric compounds that those skilled in the art will be familiar with.The examples of block copolymers or biodegradable polymers that can be included in the compositions described herein include Pluronic® L121 (BASF Corp., Mount Olive, NJ, see, for example, Yeh et al., 1996 Pharm.Res.13:1693, U.S. Patent No. 5,565,209), CRL1005 (for example, Triozzi et al., 1997 Clin Canc.Res.3:2355), poly(lactic acid-co-glycolic acid) (PLGA), poly(lactic acid) (PLA), poly-(D,L-lactide-co-glycolide) (PLG) and poly I:C. (See, e.g., Powell and Newman, "Vaccine design--The Subunit and Adjuvant Approach," 1995, Plenum Press, New York).
[0070] In some embodiments, the adjuvant used in the compositions described herein (e.g., heat-stable dry powder vaccines) is an organic adjuvant. The organic adjuvant may be a biologically derived or chemically carbon-containing adjuvant. In some embodiments, the adjuvant is a peptide derived from a microbial cell wall (e.g., muramyl dipeptide and its polymorphs). In some embodiments, the adjuvant is trehalose 6,6'-dimycolate or a polymorph thereof. See Schweneker et al., 2013, Immunobiology, 218(4):664-73. In some embodiments, the adjuvant is stearyl tyrosine.
[0071] Saponins and saponin mimetics, including QS21 and structurally related compounds that provide similar effects, referred to herein as QS21 mimetics (see, e.g., U.S. Pat. No. 5,057,540, EP 0362279 B1, WO 95 / 17210), plant alkaloids such as tomatine, detergents such as (but not limited to) saponins, polysorbate 80, span 85 and stearyl tyrosine, imidazoquinoline immune response modifiers, and double stem-loop immune modifiers (dSLIMs, e.g., Weeratna et al., 2005 Vaccine 23:5263), may be used as adjuvants according to certain presently described embodiments.
[0072] In some embodiments, the adjuvant used in the compositions described herein is saponin or saponin mimic.Saponin-containing detergents are taught in, for example, U.S. Patent No. 6,544,518, Lacaille-Dubois, M and Wagner H. (1996 Phytomedicine 2:363-386), U.S. Patent No. 5,057,540, Kensil, Crit Rev Ther Drug Carrier Syst, 1996,12(1-2):1-55, and EP0362279B1.Particulate structures called immune stimulating complexes (ISCOMS), which contain Quil A (saponin) fractions, are hemolytic and are used in vaccine production (Morein, B., EP0109942B1).These structures have been reported to have adjuvant activity (EP0109942B1, WO96 / 11711). The hemolytic saponins QS21 and QS17 (HPLC-purified fractions of Quil A) have been described as potent systemic adjuvants, and methods for their production are disclosed in U.S. Pat. No. 5,057,540 and EP 0 362 279 B1. QS21 may comprise an HPLC-purified non-toxic fraction derived from the bark of Quillaja Saponaria Molina. The production of QS21 is disclosed in U.S. Pat. No. 5,057,540. (See also U.S. Pat. Nos. 6,936,255, 7,029,678, and 6,932,972.) These references also describe the use of QS7 (a non-hemolytic fraction of Quil-A) to act as a potent adjuvant for systemic vaccines. The use of QS21 is further described in Kensil et al. (1991. J. Immunology 146:431-437). Combinations of QS21 and polysorbates or cyclodextrins are also known (WO99 / 10008). Particulate adjuvant systems comprising fractions of QuilA such as QS21 and QS7 are described in WO96 / 33739 and WO96 / 11711.Other saponins that have been used in systemic vaccination studies include those derived from other plant species such as Gypsophila and Saponaria (Bomford et al., Vaccine, 10(9):572-577, 1992).
[0073] In some embodiments, the adjuvant is an "immunostimulating complex," known as an ISCOMS (e.g., U.S. Pat. Nos. 6,869,607, 6,846,489, 6,027,732, 4,981,684), including the saponin-derived ISCOMATRIX®, which is commercially available, for example, from Iscotec (Stockholm, Sweden) and CSL Ltd. (Parkville, Victoria, Australia).
[0074] Escin is another detergent related to saponins for use in the adjuvant compositions of the embodiments disclosed herein. Escin is described in the Merck index (12th Ed.: entry 3737) as a mixture of saponins occurring in the seeds of the horse chestnut tree, Aesculus hippocastanum. Its isolation has been described by chromatography and purification (Fiedler, Arzneimittel-Forsch. 4, 213 (1953)) and by ion exchange resins (Erbring et al., U.S. Pat. No. 3,238,190). A fraction of escin (also known as aescin) has been purified and shown to be biologically active (Yoshikawa M, et al. (Chem Pharm Bull (Tokyo) 1996 August; 44 (8): 1454-1464)).
[0075] Digitonin is another detergent, also listed as a saponin in the Merck index (12th Ed., entry 3204), derived from the seeds of Digitalis purpurea and purified according to the procedure described by Gisvold et al., J. Am. Pharm. Assoc., 1934, 23, 664, and Rubenstroth-Bauer, Physiol. Chem., 1955, 301, 621.
[0076] In some embodiments, the adjuvant used in the compositions described herein (e.g., heat-stable dry powder vaccines) is an inorganic adjuvant. Inorganic adjuvants can be, for example, mineral salts, emulsions, and adjuvants that are not generally carbon-based, such as calcium phosphate. Mineral salt adjuvants contemplated herein include, but are not limited to, aluminum-based compounds such as aluminum phosphate and aluminum hydroxide. As used herein, calcium phosphate adjuvants include, but are not limited to, calcium ions (Ca2+) together with orthophosphate (PO43-), metaphosphate (PO3-), or pyrophosphate (PO74-).
[0077] Also as mentioned above, one type of adjuvant for use in the compositions described herein can be an aluminum adjuvant, commonly referred to as "alum." Alum adjuvants are based on aluminum oxyhydroxide, aluminum hydroxyphosphate, or various proprietary salts. Vaccines using alum adjuvants can include vaccines for tetanus strains, HPV, hepatitis A, inactivated poliovirus, and other antigens described herein. Alum adjuvants are advantageous because they have a good safety record, enhance antibody responses, stabilize antigens, and are relatively simple to produce on a large scale. (Edelman 2002 Mol. Biotechnol. 21:129-148; Edelman, R. 1980 Rev. Infect. Dis. 2:370-383.)
[0078] In some embodiments, the compositions of the present invention include an adjuvant. In some embodiments, the adjuvant is a TLR4 agonist. In some embodiments, the adjuvant is present at a concentration of about 0.5 μg / mL to about 12 mg / mL. In some embodiments, the adjuvant is present at a concentration of about 0.5 μg / mL, about 1 μg / mL, about 2 μg / mL, about 3 μg / mL, about 4 μg / mL, about 5 μg / mL, about 6 μg / mL, about 7 μg / mL, about 8 μg / mL, about 9 μg / mL, about 10 μg / mL, about 20 μg / mL, about 30 μg / mL, about 40 μg / mL, about 50 μg / mL, about 60 μg / mL, about 70 μg / mL, about 80 μg / mL, about 90 μg / mL, or about 100 μg / mL. In some embodiments, the adjuvant is MPL or GLA as described herein. In some embodiments, the adjuvant is present at a concentration of about 0.5 mg / mL, about 1 mg / mL, about 2 mg / mL, about 3 mg / mL, about 4 mg / mL, about 5 mg / mL, about 6 mg / mL, about 7 mg / mL, about 8 mg / mL, about 9 mg / mL, about 10 mg / mL, about 11 mg / mL, or about 12 mg / mL.
[0079] Adjuvants suitable for use in certain compositions described herein (e.g., heat-stable spray-dried vaccine compositions) include commercially available adjuvants such as Freund's incomplete and complete adjuvant (Difco Laboratories, Detroit, Mich.), Merck Adjuvant 65 (Merck and Company, Inc., Rahway, NJ), AS-2 and its derivatives (SmithKline Beecham, Philadelphia, Pa.), AddaVax (InvivoGen), MF59 (Norvartis), AS03 (GlaxoSmithKline), AS01B (GlaxoSmithKline), AS02A (GlaxoSmithKline).
[0080] Some embodiments provided herein include compositions (e.g., heat-stable dry powder vaccine compositions) containing one adjuvant and at least one additional adjuvant different from the first adjuvant. For example, the compositions provided herein can include GLA and a second adjuvant other than GLA. In some embodiments, the compositions provided herein include two, three, four, or five adjuvants. In some embodiments, the compositions provided herein include two adjuvants.
[0081] Adjuvants described herein include adjuvants that can modify (i.e., statistically significantly increase or decrease, and in certain embodiments, enhance or improve) the potency and / or longevity of an immune response when administered to a subject, such as a human (e.g., a human patient), non-human primate, mammal, or another higher eukaryote with a recognized immune system. (See, e.g., Powell and Newman, "Vaccine design—The Subunit and Adjuvant Approach," 1995, Plenum Press, New York.) In certain embodiments disclosed herein, GLA and a desired antigen, and optionally one or more adjuvants, can modify, e.g., induce or enhance, an immune response directed against the desired antigen.
[0082] Antigens for use in heat-stable spray-dried (dry powder) vaccine compositions In some embodiments, the thermostable vaccine compositions are used to induce or enhance immune reactivity or responses in a host to an antigen.
[0083] In some embodiments, the antigen, such as an autoimmune antigen, an allergen, or a cancer antigen, may already be present in the host, and the vaccine composition may comprise only a stable emulsion and, optionally, an adjuvant that, when administered, induces or enhances immune reactivity against the antigen already present in the subject. As used herein, this administration of a vaccine composition comprising a heat-stable spray-dried adjuvant composition for inducing an immune response against an antigen already present in the host is a monotherapy.
[0084] In some embodiments, the vaccine compositions described herein comprise one or more antigens.
[0085] Antigens for use in certain embodiments of the compositions described herein, as well as in methods for producing and using such compositions, can be any target epitope, molecule (including a biomolecule), molecular complex (including a molecular complex containing a biomolecule), intracellular assembly, cell, or tissue against which it is desired to induce or enhance immune reactivity in a subject. Frequently, the term antigen refers to a polypeptide antigen of interest. However, as used herein, antigen can also refer to a recombinant construct (e.g., an expression construct) encoding a polypeptide antigen of interest. In certain preferred embodiments, the antigen is, can be derived from, or can be immunologically cross-reactive with, an epitope, biomolecule, cell, or tissue associated with an infectious pathogen and / or infectious disease, cancer, autoimmune disease, allergy, asthma, or any other condition in which stimulation of an antigen-specific immune response is desirable or would be beneficial.
[0086] In some embodiments, the antigen may be present at any concentration sufficient to induce or enhance immune reactivity in a subject at a desired level, including, but not limited to, about 1 μg / mL to about 5 mg / mL, about 1 μg / mL to about 2 mg / mL, about 2.5 μg / mL to about 1 mg / mL, about 5 μg / mL to about 500 μg / mL, about 10 μg / mL to about 500 μg / mL, 0.1 μg / mL to about 250 μg / mL, about 1 μg / mL to about 250 μg / mL, about 2.5 μg / mL to about 250 μg / mL, about 5 μg / mL to about 250 μg / mL, about 10 μg / mL to about 250 μg / mL, 0.1 μg / mL to about 250 μg / mL, The antigen may be present in a concentration range of about 0.1 μg / mL to about 10 mg / mL, including about 1 μg / mL to about 100 μg / mL, about 1 μg / mL to about 100 μg / mL, about 2.5 μg / mL to about 100 μg / mL, about 5 μg / mL to about 100 μg / mL, 0.1 μg / mL to about 50 μg / mL, about 1 μg / mL to about 50 μg / mL, about 2.5 μg / mL to about 50 μg / mL, 0.1 μg / mL to about 2.5 μg / mL, about 1 μg / mL to about 2.5 μg / mL, or about 0.1 μg / mL to about 10 μg / mL. The concentrations provided refer to the concentration of the antigen in either the oil-in-water emulsion formulation before spray drying, or in the dry powder, or in the dry powder upon reconstitution.
[0087] In certain embodiments, the compositions described herein (e.g., heat-stable spray-dried vaccine compositions) comprise an antigen or antigenic composition capable of eliciting an immune response against a human or other mammalian pathogen, the antigen or antigenic composition being an antigen from a virus such as from HIV-1, (such as tat, nef, gp120, or gp160), a human herpesvirus, e.g., gD or a derivative thereof, or an immediate early protein such as ICP27 from HSV1 or HSV2, cytomegalovirus (particularly human) (such as gB or a derivative thereof), rotavirus (including live attenuated viruses), Epstein-Barr virus (such as gp350 or a derivative thereof), varicella-zoster virus (such as gp1, II, and IE63), or hepatitis B virus (e.g., hepatitis B surface antigen or a derivative thereof), hepatitis A virus, hepatitis C virus, and and hepatitis E virus, or from other viral pathogens such as paramyxoviruses: respiratory syncytial virus (such as F and G proteins or derivatives thereof), parainfluenza virus, measles virus, mumps virus, human papillomaviruses (e.g., HPV6, 11, 16, 18, etc.), flaviviruses (e.g., yellow fever virus, dengue virus, tick-borne encephalitis virus, Japanese encephalitis virus), or influenza virus (whole live or inactivated virus, split influenza virus, grown in eggs or MDCK cells, or whole flu virosomes (described by Gluck, Vaccine, 1992, 10, 915-920), or purified or recombinant proteins thereof, e.g., HA, NP, NA, or M proteins, or combinations thereof).
[0088] In some embodiments, a composition described herein (e.g., a heat-stable spray-dried vaccine composition) comprises an antigen or antigenic composition capable of eliciting an immune response against a human or other mammalian pathogen, the antigen or antigenic composition being Neisseria spp., including N. gonorrhea and N. meningitidis (e.g., capsular polysaccharides and conjugates thereof, transferrin-binding protein, lactoferrin-binding protein, PilC, adhesins); S. pyogenes (e.g., M protein or fragments thereof, C5A protease, lipoteichoic acid), S. agalactiae, S. mutans; H. ducreyi; Moraxella spp., including M. catarrhalis, also known as Branhamella catarrhalis (e.g., high- and low-molecular-weight adhesins and invasins); Bordetella spp., including B. pertussis (e.g., pertactin, pertussis toxin or derivatives thereof, filamentous hemagglutinin, adenylate cyclase, fimbriae). spp., B. parapertussis and B. bronchiseptica; Mycobacterium spp., including M. tuberculosis (e.g., ESAT6, antigen 85A, --B, or --C), M. bovis, M. leprae, M. avium, M. paratuberculosis, M. smegmatis; Legionella spp., including L. pneumophila; Escherichia spp., including enterotoxigenic E. coli (e.g., colonization factors, heat-labile toxins or derivatives, heat-stable toxins or derivatives), enterohemorrhagic E. coli, enteropathogenic E. coli (e.g., Shiga-like toxins or derivatives); Vibrio spp., including S. sonnei, S. dysenteriae, S. flexnerii; Shigella spp; including Y. enterocolitica (e.g., Yop proteins), Y. pestis, Y. pseudotuberculosis, Yersinia spp; C. jejuni (e.g., toxins, adhesins, and invasins) and C.Campylobacter spp., including coli; Salmonella spp., including S. typhi, S. paratyphi, S. choleraesuis, S. enteritidis; Listeria spp., including L. monocytogenes; Helicobacter spp., including H. pylori (e.g., urease, catalase, vacuolating toxin); Pseudomonas spp., including P. aeruginosa; Staphylococcus spp., including S. aureus, S. epidermidis; Enterococcus spp., including E. faecalis, E. faecium; Clostridium, including C. tetani (e.g., tetanus toxin and derivatives), C. botulinum (e.g., botulinum toxin and derivatives), C. difficile (e.g., clostridial toxins A or B and derivatives). Bacillus spp., including B. anthracis (e.g., botulinum toxin and its derivatives); Corynebacterium spp., including C. diphtheriae (e.g., diphtheria toxin and its derivatives); Borrelia spp., including B. burgdorferi (e.g., OspA, OspC, DbpA, DbpB), B. garinii (e.g., OspA, OspC, DbpA, DbpB), B. afzelii (e.g., OspA, OspC, DbpA, DbpB), B. andersonii (e.g., OspA, OspC, DbpA, DbpB), and B. hermsii; Ehrlichia spp., including E. equi and the agent of human granulocytic ehrlichiosis; Rickettsia, including R. rickettsii spp.; including C. trachomatis (e.g., MOMP, heparin-binding protein), C. pneumoniae (e.g., MOMP, heparin-binding protein), C. psittaci; Chlamydia spp.; including L. interrogans; Leptospira spp.; including T. pallidum (e.g., rare outer membrane protein), T. denticola, T. hyodysenteriae; Treponema spp.; or other bacterial pathogens.
[0089] In certain embodiments, the compositions described herein (e.g., heat-stable spray-dried vaccine compositions) comprise antigens or antigenic compositions capable of eliciting an immune response against a human or other mammalian pathogen, wherein the antigen or antigenic composition is derived from one or more parasites, such as Plasmodium spp., including P. falciparum; Toxoplasma spp., including T. gondii (e.g., SAG2, SAGS, Tg34); Entamoeba spp., including E. histolytica; Babesia spp., including B. microti; Trypanosoma spp., including T. cruzi; Giardia spp., including G. lamblia; Leshmania spp., including L. major; Pneumocystis spp., including P. carinii; Trichomonas spp., including T. vaginalis (see, e.g., John, D.T. and Petri, W.A., Markell and Voge's Medical Parasitology--9th Ed., 2006, WB Saunders, Philadelphia, Bowman, DD, Georgis' Parasitology for Veterinarians-8th Ed., 2002, WB Saunders, Philadelphia), or (i) nematode infections (including but not limited to Enterobius vermicularis, Ascaris lumbricoides, Trichuris trichiura, Necator americanus, Ancylostoma duodenale, Wuchereria bancrofti, Brugia malayi, Onchocerca volvulus, Dracanculus medinensis, Trichinella spiralis, and Strongyloides stercoralis), (ii) trematode infections (including but not limited to Schistosoma mansoni, Schistosoma haematobium, Schistosoma japonicum, Schistosoma mekongi, Opisthorchis sinensis, Paragonimus sp., Fasciola hepatica, Fasciola magna, Fasciola (iii) cestode infections (including, but not limited to, Taenia saginata and Taenia solium). Certain embodiments may therefore contemplate vaccine compositions comprising antigens derived from Schistosoma spp., Schistosoma mansonii, Schistosoma haematobium, and / or Schistosoma japonicum, or from yeasts such as Candida spp., including C. albicans, Cryptococcus spp., including C. neoformans.
[0090] In some embodiments, the compositions described herein comprise at least two heterologous polypeptides of Mycobacterium species of the Mycobacterium tuberculosis complex. Mycobacterium species of the M. tuberculosis complex include species traditionally considered to cause the disease tuberculosis, as well as environmental and opportunistic Mycobacterium species that cause tuberculosis and pulmonary disease in immunocompromised patients, such as those with AIDS, e.g., Mycobacterium tuberculosis (Mtb), Mycobacterium bovis, or Mycobacterium africanum, BCG, Mycobacterium avium, Mycobacterium intracellulare, Mycobacterium celatum, Mycobacterium genavense, Mycobacterium haemophilum, Mycobacterium kansasii, Mycobacterium simiae, Mycobacterium vaccae, Mycobacterium fortuitum, and Mycobacterium scrofulaceum (see, e.g., Harrison's Principles of Internal Medicine, volume 1). 1, pp. 1004-1014 and 1019-1020). Sequences of antigens from Mycobacterium species are readily available. For example, the Mycobacterium tuberculosis sequence can be found in Cole et al., Nature 393:537 (1998), and can be found on websites such as those maintained by the Wellcome Trust, the Sanger Institute, and the Institute Pasteur.
[0091] Other specific antigens of M. tuberculosis that can be used in the compositions described herein are, for example, Th Ra12, Tb H9, Tb Ra35, Tb38-1, Erd 14, DPV, MTI, MSL, mTTC2, and hTCC1 (WO99 / 51748).
[0092] M. tuberculosis proteins also include fusion proteins and polymorphisms thereof, in which at least two, preferably three, polypeptides of M. tuberculosis are fused into a larger protein. In certain embodiments, fusion proteins include Ra12-TbH9-Ra35, Erd14-DPV-MTI, DPV-MTI-MSL, Erd14DPV-MTI-MSL-mTCC2, Erd14-DPV-MTI-MSL, DPV-MTI-MSL-mTCC2, and TbH9-DPV-MTI (WO99151748). Other antigens that can be used include the antigens, antigen combinations, and fusion proteins described in US2010 / 0129391 and WO2008 / 124647.
[0093] In certain embodiments, the compositions described herein comprise an isolated fusion protein comprising a combination of two or more covalently linked M. tuberculosis antigens, or immunogenic fragments thereof, wherein the antigens are selected from the group consisting of Rv0164, Rv0496, Rv2608, Rv3020, Rv3478, Rv3619, Rv3620, Rv1738, Rv1813, Rv3810, Rv2389, Rv2866, Rv3876, Rv0054, Rv0410, Rv065 Rv1626, Rv0733, Rv2520, Rv1253, Rv1980, Rv3628, Rv1884, Rv3872, Rv3873, Rv151 1, and Rv3875, and antigens having at least 90% identity to any of the foregoing sequences.
[0094] In certain embodiments, the compositions described herein comprise an ID93 fusion protein comprising a sequence having at least 90% identity to the antigens Rv2608, Rv3619, Rv3620, and Rv1813, or a combination of antigens. The ID93 antigen is described in U.S. Patent Application No. 2016 / 0324783 (Single Vial Vaccine Formulation), published November 10, 2016, and incorporated herein by reference in its entirety as SEQ ID NOs: 1-8. In another embodiment, the composition comprises an ID93 fusion protein comprising the antigens Rv2608, Rv3619, Rv3620, and Rv1813, wherein the antigen sequences are derived from M. tuberculosis. In another embodiment, the ID93 fusion protein comprises the sequence set forth in SEQ ID NO: 1, or a sequence having at least 90% identity thereto. In some embodiments, the fusion protein comprises the sequence set forth in SEQ ID NO: 2, or a sequence having at least 90% identity thereto. In some embodiments, the therapeutic vaccine comprises a combination of Mycobacterium antigens Rv2608, Rv3620, and Rv1813, or a fusion protein comprising a sequence having at least 90% identity to the combination of antigens. In some embodiments, the Mycobacterium antigens Rv2608, Rv3620, and Rv1813 are M. tuberculosis antigens Rv2608, Rv3620, and Rv1813. In some embodiments, the fusion protein comprises a sequence set forth in SEQ ID NO:3 or 4, or a sequence having at least 90% identity to SEQ ID NO:3 or SEQ ID NO:4. In some embodiments, antigen Rv1813 comprises the amino acid sequence of SEQ ID NO:5. In some embodiments, antigen Rv3620 comprises the amino acid sequence of SEQ ID NO:6. In some embodiments, antigen Rv2608 comprises the amino acid sequence of SEQ ID NO:7. In some embodiments, antigen Rv3619 comprises the amino acid sequence of SEQ ID NO:8. Those skilled in the art will understand that one or more N-terminal amino acids may be removed, such as the signal sequence. These sequences are described in U.S. Patent No. 8,486,414, which is incorporated herein by reference.In some embodiments, the composition comprises an ID93 fusion protein, or a polynucleotide encoding same, which comprises four antigens belonging to a family of Mtb proteins associated with virulence (Rv2608, Rv3619, Rv3620) or latency (Rv1813), as described in U.S. Patent Application Publication No. 2010 / 0129391 (specifically incorporated herein by reference in its entirety).
[0095] In some embodiments, the compositions described herein comprise Chlamydia antigens. Chlamydia antigens include, for example, high molecular weight protein (HWMP) (WO99 / 17741), ORF3 (EP366412), and putative membrane protein (Pmp). Other Chlamydia antigens of the composition can be selected from the group described in WO99128475. In some embodiments, the compositions described herein comprise antigens from Streptococcus spp., including S. pneumoniae (e.g., capsular polysaccharides and conjugates thereof, PsaA, PspA, streptolysin, choline-binding protein), and the protein antigen pneumolysin (Biochem Biophys Acta, 1989, 67, 1007; Rubins et al., Microbial Pathogenesis, 25, 337-342), as well as mutant detoxified derivatives thereof (WO90 / 06951; WO99 / 03884). Other bacterial antigens are derived from Haemophilus spp., including type B H. influenzae (e.g., PRP and its conjugates), nontypeable H. influenzae, e.g., OMP26, high molecular weight adhesins, P5, P6, protein D and lipoprotein D, and fimbrin and fimbrin-derived peptides (U.S. Pat. No. 5,843,464), or multiple copy polymorphs or fusion proteins thereof.
[0096] Derivatives of hepatitis B surface antigen are well known in the art and include, inter alia, PreS1, Pars2 S antigens described in European Patent Applications EP-A-414374, EP-A-0304578, and EP-198474. In some embodiments, the compositions described herein comprise the HIV-1 antigen, gp120, particularly when expressed in CHO cells. In further embodiments, the compositions comprise gD2t as defined above.
[0097] In some embodiments, the compositions described herein comprise antigens derived from human papillomaviruses (HPV) thought to cause genital warts (e.g., HPV6 or HPV11) and HPV viruses that cause cervical cancer (e.g., HPV16 and HPV18). In some embodiments, the compositions are genital wart preventative or therapeutic vaccines comprising L1 particles or capsomeres, and fusion proteins comprising one or more antigens selected from HPV6 and HPV11 proteins E6, E7, L1, and L2. Particular forms of fusion proteins include L2E7, as disclosed in WO96 / 26277, and protein D(1 / 3)-E7, as disclosed in GB9717953.5 (PCT / EP98 / 05285). In some embodiments, the compositions are HPV cervical infection or cancer preventative or therapeutic vaccines comprising HPV16 or 18 antigens. For example, L1 or L2 antigen monomer, or L1 or L2 antigen together presented as virus-like particle (VLP), or L1 protein alone presented in VLP or capsomere structure. Such antigen, virus-like particle and capsomere are known per se. For example, see WO94 / 00152, WO94 / 20137, WO94 / 05792 and WO93 / 02184.
[0098] Additional early proteins can be included alone or as fusion proteins, such as E7, E2, or preferably F5; some embodiments include VLPs containing an L1E7 fusion protein (WO96 / 11272). In some embodiments, the HPV16 antigen comprises the early proteins E6 or F7, or a combination thereof, fused to a protein D carrier to form a protein D-E6 or E7 fusion from HPV16, or a combination of E6 or E7 with L2 (WO96 / 26277). Alternatively, the HPV16 or 18 early proteins E6 and E7 can be presented in a single molecule, preferably a protein D-E6 / E7 fusion. Such compositions (e.g., heat-stable spray-dried vaccine compositions) can optionally contain either or both of the E6 and E7 proteins before HPV18, preferably in the form of a protein D-E6 or protein D-E7 fusion protein or a protein D E6 / E7 fusion protein. The compositions of the present invention may further comprise antigens derived from other HPV strains, preferably HPV31 or 33.
[0099] The compositions of the present invention may further comprise antigens derived from parasites that cause malaria. For example, antigens derived from Plasmodia falciparum include RTS, S, and TRAP. RTS is a hybrid protein containing substantially all of the C-terminal portion of the circumsporozoite (CS) protein of P. falciparum linked to the surface (S) antigen of hepatitis B virus via four amino acids of the preS2 portion of the hepatitis B surface antigen. Its complete structure is disclosed in International Patent Application No. PCT / EP92 / 02591, published as WO93 / 10152, which claims priority from UK Patent Application No. 9124390.7. When expressed in yeast, RTS is produced as a lipoprotein particle, and when coexpressed with the S antigen from HBV, it produces a mixed particle known as RTS, S.
[0100] TRAP antigens are described in International Patent Application No. PCT / GB89 / 00895, published as WO 90 / 01496. One embodiment of the present invention is a malaria vaccine in which the antigenic preparation comprises a combination of RTS, S, and TRAP antigens. Other malaria parasite antigens that are likely candidates for components of multi-stage malaria vaccines are P. faciparum MSP1, AMA1, MSP3, EBA, GLURP, RAP1, RAP2, Sequestrin, PfEMP1, Pf332, LSA1, LSA3, STARP, SALSA, PfEXP1, Pfs25, Pfs28, PFS27125, Pfs16, Pfs48 / 45, Pfs230, and their analogs in Plasmodium spp.
[0101] Certain embodiments disclosed herein are directed to antiviral agents that inhibit or inhibit the growth of Actinobacteria, such as M. tuberculosis or M. leprae, or another mycobacterium; bacteria, such as members of the Salmonella, Neisseria, Borrelia, Chlamydia, or Bordetella genera; viruses, such as herpes simplex virus, human immunodeficiency virus (HIV), feline immunodeficiency virus (FIV), cytomegalovirus, varicella-zoster virus, hepatitis virus, Epstein-Barr virus (EBV), respiratory syncytial virus, human papillomavirus (HPV), and cytomegalovirus. any virus; HIV, such as HIV-1 or HIV-2; fungi, such as Aspergillus, Blastomyces, Coccidioides, and Pneumocysti, or yeasts, including Candida species, such as C. albicans, C. glabrata, C. krusei, C. lusitaniae, C. tropicalis, and C. parapsilosis; parasites, such as protozoa, e.g., Plasmodium species, including P. falciparum, P. vivax, P. malariae, and P. ovale; or Acanthamoeba, Entamoeba Antigens derived from at least one infectious pathogen, such as a bacterium, virus, or fungus, including another parasite such as one or more of Entamoeba histolytica, Angiostrongylus, Schistosoma mansonii, Schistosoma haematobium, Schistosoma japonicum, Cryptosporidium, Ancylostoma, Entamoeba histolytica, Entamoeba coli, Entamoeba dispar, Entamoeba hartmanni, Entamoeba polecki, Wuchereria bancrofti, Giardia, and Leishmania are contemplated.
[0102] For example, in embodiments of compositions containing antigens derived from Borrelia sp., the antigens may include nucleic acids, pathogen-derived antigens or antigenic preparations, recombinantly produced proteins or peptides, and chimeric fusion proteins. One such antigen is OspA. OspA may be the complete mature protein in its lipidated form (Lipo-OspA) biosynthesized in a host cell, or alternatively, a nonlipidated derivative. Such nonlipidated derivatives include a nonlipidated NS1-OspA fusion protein containing the first 81 N-terminal amino acids of the nonstructural protein (NS1) of influenza virus, and the complete OspA protein; another, MDP-OspA, is a nonlipidated form of OspA with three additional N-terminal amino acids.
[0103] Compositions and methods for identifying subjects suspected of having or being at risk of having an infection with an infectious pathogen described herein are known in the art.
[0104] For example, the bacterium Mycobacterium tuberculosis causes tuberculosis (TB). The bacterium usually attacks the lungs, but can also attack the kidneys, spine, and brain. If not properly treated, TB disease can be fatal. The disease is spread from person to person through the air when an infected person sneezes or coughs. In 2003, over 14,000 cases of TB were reported in the United States.
[0105] While tuberculosis can generally be controlled using long-term antibiotic therapy, such treatment is not sufficient to prevent the spread of the disease, and concerns exist regarding the potential selection of antibiotic-resistant strains. Infected individuals may be asymptomatic for some time but contagious. In addition, compliance with treatment regimens is important, but patient behavior is difficult to monitor. Some patients do not complete the course of treatment, which can lead to ineffective treatment and the development of drug resistance. (See, e.g., U.S. Patent No. 7,087,713.)
[0106] Currently, vaccination with live bacteria is the most efficient method for inducing protective immunity against tuberculosis. The most common Mycobacterium used for this purpose is Bacillus Calmette-Guérin (BCG), a non-pathogenic strain of bovine Mycobacterium. However, the safety and efficacy of BCG are a source of controversy, and some countries, such as the United States, do not vaccinate the general public. Diagnosis is generally achieved using a skin test involving intradermal exposure to tuberculin PPD (protein purified derivative). Antigen-specific T cell responses result in measurable induration at the injection site by 48–72 hours after injection, indicating exposure to Mycobacterium antigens. Sensitivity and specificity are issues with this test, but it cannot distinguish BCG-vaccinated from infected individuals (e.g., U.S. Patent No. 7,087,713).
[0107] Macrophages have been shown to act as the primary effectors of M. tuberculosis immunity, while T cells are key inducers of such immunity. The crucial role of T cells in protecting against M. tuberculosis infection is demonstrated by the frequent occurrence of M. tuberculosis in human immunodeficiency virus (HIV)-associated CD4 T cell depletion, which is associated with AIDS infection. Mycobacterium-reactive CD4 T cells have been shown to be potent producers of gamma interferon (IFN-γ), which in turn has been shown to induce the antimycobacterial effects of macrophages in mice. The role of IFN-γ in humans is less clear, but studies have shown that 1,25-dihydroxyvitamin D3, alone or in combination with IFN-γ or tumor necrosis factor-α, activates human macrophages to inhibit M. tuberculosis infection. Furthermore, IFN-γ is known to stimulate human macrophages to produce 1,25-dihydroxyvitamin D3. Similarly, IL-12 has been shown to play a role in stimulating resistance to M. tuberculosis infection. For a review of the immunology of M. tuberculosis infection, see Chan and Kaufmann, in Tuberculosis: Pathogenesis, Protection and Control, Bloom (ed.), ASM Press, Washington, DC (1994).
[0108] Existing compounds and methods for diagnosing tuberculosis or inducing protective immunity against tuberculosis include the use of polypeptides containing at least one immunogenic portion of one or more Mycobacterium proteins and DNA molecules encoding such polypeptides. Diagnostic kits containing such polypeptides or DNA sequences and appropriate detection reagents can be used to detect Mycobacterium infection in patients and biological samples. Antibodies against such polypeptides are also provided. In addition, such compounds can be formulated into compositions described herein for immunization against Mycobacterium infection. (U.S. Patent Nos. 6,949,246 and 6,555,653)
[0109] Although malaria was eradicated from many parts of the world in the 1960s, the disease persists, and new strains of the disease resistant to existing drugs are emerging. Malaria is a major public health problem in over 90 countries. Nine out of 10 cases of malaria occur in sub-Saharan Africa. Over one-third of the world's population is at risk, with 350 to 500 million people infected with malaria each year. This year, 45 million pregnant women are at risk of contracting malaria. Of those already infected, over one million die each year from preventable diseases. The majority of these deaths are among children in Africa.
[0110] Malaria is usually transmitted through the bite of an infected female Anopheles mosquito. To transmit, the mosquito must be infected by feeding on the blood of a person already infected with malaria. Malaria is caused by a parasite, and clinical symptoms of the disease include fever and flu-like symptoms, such as chills, headache, muscle aches, and fatigue. These symptoms may be accompanied by nausea, vomiting, and diarrhea. Malaria can also cause anemia and jaundice due to the loss of red blood cells.
[0111] Infection with Plasmodium falciparum, a type of malaria, can cause kidney failure, seizures, confusion, coma, and death if not promptly treated.
[0112] In vitro diagnostic methods for malaria in an individual are known, which involve contacting tissue or biological fluid taken from the individual with a molecule or polypeptide composition comprising one or more peptide sequences having all or part of one or more T epitopes of a protein resulting from the infectious activity of P. falciparum, under conditions that allow for an in vitro immunological reaction between the composition and antibodies that may be present in the tissue or biological fluid, and in vitro detection of the antigen-antibody complexes formed (see, e.g., U.S. Pat. No. 7,087,231).
[0113] Expression and purification of recombinant Plasmodium falciparum (3D7) AMA-1 ectodomain has been described. Previous methods have produced highly purified proteins that retain the folding and disulfide bridges of the native molecule. Recombinant AMA-1 is useful as a diagnostic reagent, in antibody production, and as a protein for use alone or as part of a vaccine to prevent malaria. (U.S. Patent No. 7,029,685) Polynucleotides encoding species-specific P. vivax malaria peptide antigens, which are proteins or fragments of proteins secreted into the plasma of susceptible mammalian hosts after infection, have been described in the art, as have monoclonal or polyclonal antibodies against these antigens. Peptide antigens, monoclonal antibodies, and / or polyclonal antibodies are utilized in assays used to diagnose malaria and determine whether Plasmodium vivax is the species causing the infection. (U.S. Patent No. 6,706,872) Species-specific P. vivax malaria peptide antigens, which are proteins or fragments of proteins secreted into the plasma of susceptible mammalian hosts after infection, have also been reported, as have monoclonal or polyclonal antibodies against these antigens. Peptide antigens, monoclonal antibodies, and / or polyclonal antibodies are utilized in assays used to diagnose malaria and determine whether Plasmodium vivax is the species causing the infection (see, e.g., U.S. Patent No. 6,231,861).
[0114] Recombinant Plasmodium falciparum (3D7) AMA-1 ectodomain has also been expressed by a method that produces a highly purified protein that retains the folding and disulfide bridges of the native molecule. Recombinant AMA-1 is useful as a diagnostic reagent, for use in antibody production, and as a vaccine. (U.S. Patent No. 7,060,276) Similarly, recombinant Plasmodium falciparum (3D7) MSP-1, which retains the folding and disulfide bridges of the native molecule, 42 The expression and purification of recombinant MSP-1 is known. 42 are useful as diagnostic reagents, for use in antibody production, and as vaccines. (US Pat. No. 6,855,322).
[0115] A diagnostic method for detecting human malaria infection that identifies subjects suspected of having or at risk of having an infection with a malaria infectious agent is thus known in accordance with these and related disclosures. Specifically, for example, a blood sample is combined with a reagent containing 3-acetylpyridine adenine dinucleotide (APAD), a substrate (e.g., lactate or lactic acid), and a buffer. The reagent is designed to detect the presence of a unique glycolytic enzyme produced by the malaria parasite. This enzyme is known as parasite lactate dehydrogenase (PLDH). PLDH is easily distinguishable from host LDH using the above-described reagent. Combining the reagent with the parasitic blood sample results in a reduction of APAD. However, APAD is not reduced by host LDH. The reduced APAD can then be detected by various techniques, including spectral, fluorescent, electrophoretic, or colorimetric analysis.
[0116] Detection of reduced APAD by the aforementioned methods provides a positive indication of malaria infection (e.g., U.S. Patent No. 5,124,141). In another methodology for diagnosing malaria, a polypeptide containing a characteristic amino acid sequence derived from the Plasmodium falciparum antigen GLURP is recognized in a test sample by specific antibodies raised against or reactive with the polypeptide (U.S. Patent No. 5,231,168).
[0117] Leishmaniasis is a widespread parasitic disease frequently endemic in the Indian subcontinent, Africa, and Latin America, and is a World Health Organization priority for vaccine development. The Leishmania parasite causes a complex of distinct diseases, including fatal infections of the internal organs and severe skin disease. One of the most devastating forms of leishmaniasis is a disfiguring infection of the nose and mouth. The number of leishmaniasis cases is increasing and is currently uncontrollable in many areas. Leishmaniasis is also increasing in some developed countries, particularly in southern Europe, as a result of HIV infection. Available drugs are toxic, expensive, and require prolonged daily injections.
[0118] Leishmania is a protozoan parasite that lives in macrophages, or white blood cells of the immune system. The parasite is transmitted by the bite of small blood-sucking insects (sandflies), which are difficult to control because they inhabit vast areas of the globe.
[0119] Visceral leishmaniasis is the most dangerous of the three manifestations of the disease. It is estimated that approximately 500,000 new cases of the visceral form (kala-azar or "deadly disease") occur each year. Currently, over 200 million people are at risk of contracting visceral leishmaniasis. Over 90% of visceral leishmaniasis cases occur in India, Bangladesh, Sudan, Brazil, and Nepal. Most deaths occur in children. Those with the cutaneous form are often left permanently disfigured.
[0120] Leishmania infections are difficult to diagnose and typically involve histopathological analysis of tissue biopsy specimens, however, several serological and immunological diagnostic assays have been developed. (U.S. Patent No. 7,008,774, Senaldi et al., (1996) J. Immunol. Methods 193:9 5, Zijlstra, et al., (1997) Trans. R. Soc. Trop. Med. Hyg. 91:671 673, Badaro, et al. al.,(1996)J.Inf.Dis.173:758 761, Choudhary,S.,et al.,(1992)J.Comm.Dis.24:32 36,Badaro,R.,et al.,(1986)Am.J.Trop.Med.Hyg.35:72 78,Choudhary,A.,et al.,(1990)Trans.R.Soc.Trop.Med.Hyg.84:363 366, and Reed, SG, et al., (1990) Am. J. Trop. Med. Hyg. 43:632-639). Promastigotes release metabolic products into the culture medium to produce conditioned medium. These metabolic products are immunogenic to the host. (See Schnur, LF, et al., (1972) Isl. J. Med. Sci. 8:932-942; Sergeiev, VP, et al., (1969) Med. Parasitol. 38:208-212; El-On, J., et al., (1979) Exper. Parasitol. 47:254-269; and Bray, RS, et al., (1966) Trans. R. Soc. Trop. Med. Hyg. 60:605-609; U.S. Patent No. 6,846,648; U.S. Patent No. 5,912,166; U.S. Patent No. 5,719,263; U.S. Patent No. 5,411,865).
[0121] In some embodiments, the antigen is a Leishmania antigen described in US2009 / 0041798, US2009 / 0291099, U.S. Patent No. 8,410,258, U.S. Patent No. 8,231,881, and WO2012 / 064659, which are incorporated herein by reference. In some embodiments, the antigen is a fusion polypeptide comprising at least a Leishmania sterol 24-c-methyltransferase (SMT) polypeptide sequence and a Leishmania non-specific nucleoside hydrolase (NH) polypeptide sequence. In some embodiments, the Leishmania NH polypeptide sequence comprises at least an immunogenic portion of a sequence having at least 90% identity to the Leishmania NH sequences of L. donovani, L. infantum, and L. major. In some embodiments, the Leishmania NH polypeptide sequence comprises at least an immunogenic portion of a sequence selected from the group consisting of SEQ ID NOs: 1, 3, and 5, or a sequence having at least 90% identity thereto. In some embodiments, the Leishmania SMT polypeptide sequence comprises at least an immunogenic portion of a sequence having at least 90% identity to the Leishmania SMT sequences of L. donovani, L. infantum, and L. major. In some embodiments, the Leishmania SMT polypeptide sequence comprises at least an immunogenic portion of a sequence selected from the group consisting of SEQ ID NOs: 7, 9, and 11, or a sequence having at least 90% identity thereto. In some embodiments, the fusion polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 13, or a sequence having at least 90% identity thereto. The sequences of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 13 are provided in WO2012 / 064659 and US2012 / 0114688, which are incorporated herein by reference.
[0122] Approximately 40 million people worldwide are infected with HIV, the virus that causes AIDS. Approximately 3 million people die from the disease each year, 95% of whom are in the developing world. Nearly 5 million people become infected with HIV each year. Currently, sub-Saharan Africans bear the highest burden of the disease, but it is rapidly spreading to other countries, such as India, China, and Russia. The epidemic is spreading most rapidly among minority populations. In the United States, more than 950,000 cases of AIDS have been reported since 1981. AIDS strikes people during their reproductive years. Women are at increased risk of HIV / AIDS for both biological and social reasons.
[0123] AIDS is caused by the human immunodeficiency virus (HIV), which kills and damages cells of the body's immune system, gradually destroying the body's ability to fight infections and certain cancers. HIV is most commonly spread through unprotected sex with an infected partner. The most robust solution to the problem is to prevent the virus from spreading. Creating a safe, effective, and affordable HIV vaccine is one way to achieve this goal. Worldwide, less than one in five people at high risk of HIV infection have access to effective prevention.
[0124] Methods for diagnosing HIV infection are known, including viral culture, PCR of definitive nucleic acid sequences from patient specimens, and antibody testing for the presence of anti-HIV antibodies in patient serum (see, e.g., U.S. Patent Nos. 6,979,535, 6,544,728, 6,316,183, 6,261,762, and 4,743,540).
[0125] According to certain other embodiments disclosed herein, the compositions and methods of use may include antigens derived from cancer cells, such as those that may be useful in immunotherapeutic treatment of cancer. For example, the compositions may find utility in tumor rejection antigens, such as those of prostate, breast, colorectal, lung, pancreatic, renal, or melanoma cancers. Exemplary cancer or cancer cell-derived antigens include MAGE 1, 3, and MAGE 4, or other MAGE antigens such as those disclosed in WO99 / 40188, PRAME, BAGE, Lage (also known as NY Eos 1), SAGE, and HAGE (WO99 / 53061), or GAGE (Robbins and Kawakami, 1996 Current Opinions in Immunology 8, pp. 628-636; Van den Eynde et al., International Journal of Clinical & Laboratory Research (1997 & 1998); Correale et al. (1997), Journal of the National Cancer Institute 89, p. 293). These non-limiting examples of cancer antigens are expressed in a wide range of tumor types, such as melanoma, lung cancer, sarcoma, and bladder cancer. See, e.g., U.S. Patent No. 6,544,518. Other tumor-specific antigens are suitable for use in the compositions described herein, including, but not limited to, GM2, GM3, or conjugates thereof to carrier proteins, or antigens for use in GLA vaccine compositions to elicit or enhance anti-cancer immune responses can be self-peptide hormones, such as full-length gonadotropin hormone-releasing hormone (GnRH, WO95 / 20600), short 10 amino acid long peptides, useful in the treatment of many cancers.
[0126] In another embodiment, use prostate antigen, such as prostate specific antigen (PSA), PAP, PSCA (for example, Proc.Nat.Acad.Sci.USA 95(4)1735-1740 1998), PSMA, or in preferred embodiment, the antigen known as prostase (for example, Nelson, et al., Proc.Natl.Acad.Sci.USA (1999)96:3114-3119, Ferguson, et al. Proc.Natl.Acad.Sci.USA 1999.96,3114-3119, WO98 / 12302, U.S. Patent No. 5,955,306, WO98 / 20117, U.S. Patent No. 5,840,871 and U.S. Patent No. 5,786,148, WO00 / 04149). Other prostate specific antigens are known from WO98 / 137418 and WO / 004149. Another is STEAP (PNAS 96 14523 14528 7-12 1999).
[0127] Other tumor-associated antigens useful in the context of the present invention include Plu-1 (J Biol. Chem 274(22)15633-15645, 1999), HASH-1, HasH-2, Cripto (Salomon et al. Bioessays 199,21:61-70, U.S. Pat. No. 5,654,140), and Criptin (U.S. Pat. No. 5,981,215). In addition, antigens particularly relevant to vaccines in cancer therapy also include tyrosinase and survivin.
[0128] The embodiments disclosed herein relating to compositions comprising cancer antigens may be useful for any cancer characterized by tumor-associated antigen expression, such as HER-2 / neu expression or other cancer-specific or cancer-associated antigens.
[0129] The diagnosis of cancer in subjects suspected of having cancer or at risk of having cancer can be achieved by any of a wide range of art-recognized methodologies, which may vary depending on various factors, including clinical symptoms, the degree of progression of cancer, the type of cancer, and other factors.Examples of cancer diagnosis include histopathological, histocytochemical, immunohistocytochemical, and immunohistopathological examination of patient samples (e.g., blood, skin biopsy, other tissue biopsy, surgical specimen, etc.), PCR testing of defined genetic (e.g., nucleic acid) markers, circulating cancer-related antigens or cells with such antigens, or serological testing of antibodies with defined specificity, or other methodologies that those skilled in the art will be familiar with. See, for example, U.S. Patent Nos. 6,734,172, 6,770,445, 6,893,820, 6,979,730, 7,060,802, 7,030,232, 6,933,123, 6,682,901, 6,587,792, 6,512,102, 7,078,180, 7,070,931, JP5-328975, Waslylyk et al., 1993 Eur. J Bioch. 211(7):18.
[0130] Compositions and methods according to certain embodiments of the invention may also be used to prevent or treat autoimmune diseases, including diseases, conditions, or disorders in which a host's or subject's immune system detrimentally mediates an immune response directed against "self" tissues, cells, biomolecules (e.g., peptides, polypeptides, proteins, glycoproteins, lipoproteins, proteolipids, lipids, glycolipids, nucleic acids such as RNA and DNA, oligosaccharides, polysaccharides, proteoglycans, glycosaminoglycans, etc., and other molecular components of the subject's cells and tissues), or epitopes (e.g., specific immunologically defined recognition structures such as those recognized by antibody variable region complementarity-determining regions (CDRs) or by T-cell receptor CDRs).
[0131] Autoimmune diseases are therefore characterized by abnormal immune responses involving either cells or antibodies directed against normal autologous tissues. Autoimmune diseases in mammals can generally be classified into two distinct categories: cell-mediated diseases (i.e., T cell) or antibody-mediated disorders. Non-limiting examples of cell-mediated autoimmune diseases include multiple sclerosis, rheumatoid arthritis, Hashimoto's thyroiditis, type I diabetes (juvenile-onset diabetes), and autoimmune uveoretinitis. Antibody-mediated autoimmune disorders include, but are not limited to, myasthenia gravis, systemic lupus erythematosus (or SLE), Graves' disease, autoimmune hemolytic anemia, autoimmune thrombocytopenia, autoimmune asthma, cryoglobulinemia, thrombotic thrombocytopenic purpura, primary sclerosing cholangitis, and pernicious anemia. Antigens associated with systemic lupus erythematosus are small nuclear ribonucleoproteins (snRNPs); those associated with Graves' disease are thyrotropin receptors, thyroglobulin, and other components of thyroid epithelial cells (Akamizu et al., 1996; Kellerman et al., 1995; Raju et al., 1997; and Texier et al., 1992); those associated with pemphigus are cadherin-like pemphigus antigens such as desmoglein 3 and other adhesion molecules (Memar et al., 1996; Stanley, 1995; Plott et al., 1994; and Hashimoto, 1993); and those associated with thrombotic thrombocytopenic purpura are platelet antigens. (See, e.g., U.S. Pat. No. 6,929,796; Gorski et al. (Eds.), Autoimmunity, 2001, Kluwer Academic Publishers, Norwell, Mass.; Radbruch and Lipsky, P.E. (Eds.) Current Concepts in Autoimmunity and Chronic Inflammation (Curr. Top. Microbiol. and Immunol.) 2001, Springer, NY.)
[0132] Autoimmunity plays a role in over 80 different diseases, including type 1 diabetes, multiple sclerosis, lupus, rheumatoid arthritis, scleroderma, and thyroid disease. Strong quantitative estimates of the prevalence of most autoimmune diseases are lacking. Recent studies conducted in the late 1990s reveal that autoimmune diseases are the third most common major illness in the United States, with the most common autoimmune diseases affecting over 8.5 million Americans. Current estimates of disease prevalence range from 5 to 8 percent of the U.S. population. Most autoimmune diseases disproportionately affect women. Women are 2.7 times more likely than men to suffer from autoimmune diseases. Women are more susceptible to autoimmune diseases, and men appear to have higher levels of natural killer cell activity than women. (Jacobsen et al., Clinical Immunology and Immunopathology, 84:223-243, 1997.)
[0133] Autoimmune diseases develop when the immune system mistakes self-tissue for non-self and launches inappropriate attacks. The body can be affected in different ways by autoimmune diseases, including, for example, the intestine (Crohn's disease) and the brain (multiple sclerosis). It is known that autoantibodies attack self-cells or self-tissues and impair their function, resulting in autoimmune diseases, and that autoantibodies can be detected in patients' serum before the actual onset of autoimmune diseases (e.g., the appearance of clinical signs and symptoms). Thus, the detection of autoantibodies allows for early detection or recognition of the existence of autoimmune diseases or the risk of developing them. Based on these findings, various autoantibodies against autoantigens have been discovered, and autoantibodies against autoantigens have been measured in clinical trials (e.g., U.S. Patent Nos. 6,919,210, 6,596,501, 7,012,134, and 6,919,078), although other autoimmune diagnostics may involve the detection of related metabolites (e.g., U.S. Patent No. 4,659,659) or immunological reactivity (e.g., U.S. Patent Nos. 4,614,722 and 5,147,785, 4,420,558, 5,298,396, 5,162,990, 4,420,461, 4,595,654, 5,846,758, and 6,660,487).
[0134] In certain embodiments, the compositions of the present invention may be particularly applicable to the treatment of elderly and / or immunosuppressed individuals, including renal dialysis subjects, chemotherapy and / or radiation therapy subjects, transplant recipients, etc. Such individuals generally exhibit a reduced immune response to vaccines, and therefore, use of the compositions of the present invention may enhance the immune response achieved in these subjects.
[0135] In another embodiment, the antigen(s) used in the compositions of the present invention include antigens associated with respiratory diseases, such as those caused or exacerbated by bacterial infections (e.g., pneumococcus), for the prevention and treatment of conditions such as chronic obstructive pulmonary disease (COPD). COPD is physiologically defined by the presence of irreversible or partially reversible airway obstruction in patients with chronic bronchitis and / or emphysema (Am J Respir Crit Care Med. 1995 November; 152(5 Pt 2):577-121). Exacerbations of COPD are often caused by bacterial (e.g., pneumococcus) infections (Clin Microbiol Rev. 2001 April; 14(2):336-63).
[0136] Oils for use in heat stable compositions Certain embodiments contemplate compositions described herein that include oils, which in some such embodiments may contribute to adjuvant activity, and in other such embodiments may additionally or alternatively provide a pharmaceutically acceptable carrier or excipient.Any number of suitable oils are known and can be selected for inclusion in compositions based on the present disclosure.Examples of such oils include, but are not limited to, squalene, synthetic squalene, biosynthetic squalene, mineral oil, grape seed oil, synthetic isoprenoids, biosynthetic isoprenoids, polyprenol, olive oil, cholesterol, and mannide monooleate.
[0137] The oils contemplated herein can be used in emulsion systems, which are referred to as emulsion adjuvants. Emulsion adjuvants include oil-in-water, water-in-oil, or water-in-oil-in-water mixtures. Without being bound by theory, such emulsion adjuvants can function by enabling sustained release of antigens to provide sustained stimulation of the immune system. Certain emulsion adjuvants can also be used as delivery systems for other adjuvants, including immunostimulatory adjuvants such as, but not limited to, CpG oligodeoxynucleotides (CpG ODN), glucopyranosyl lipid adjuvant (GLA), monophosphoryl lipid A (MLA), and 3-deacylated monophosphoryl lipid A (3D-MLA). Specific emulsion systems for formulating adjuvant compositions, including single-phase or multi-phase emulsion systems, have been described. Oil-in-water emulsion adjuvants themselves have been shown to be useful as adjuvant compositions (EP 0 399 843 B), and combinations of oil-in-water emulsions and other active agents have been described as vaccine adjuvants (WO 95 / 17210, WO 98 / 56414, WO 99 / 12565, WO 99 / 11241). Other oil emulsion adjuvants have been described, including water-in-oil emulsions (U.S. Pat. No. 5,422,109, EP 0 480 982 B2) and oil-in-water emulsions (U.S. Pat. No. 5,424,067, EP 0 480 981 B).
[0138] Oil emulsion adjuvants for use in the present invention can be natural or synthetic, mineral or organic. Examples of mineral and organic oils will be readily apparent to those skilled in the art. In certain embodiments, the compositions of the present invention (e.g., heat-stable spray-dried vaccines) comprise an oil-in-water emulsion in which the adjuvant is incorporated into the oil phase. For oil-in-water compositions to be suitable for human administration, the oil phase of the emulsion system preferably comprises a metabolizable oil. The meaning of the term metabolizable oil is well known in the art. Metabolizable can be defined as "capable of being converted by metabolism" (Dorland's Illustrated Medical Dictionary, WB Saunders Company, 25th edition (1974)). The oil can be any plant oil, vegetable oil, fish oil, animal oil, or synthetic oil that is not toxic to the recipient and can be converted by metabolism. Nuts (e.g., peanut oil), seeds, and grains are common sources of vegetable oils. Synthetic oils can also be used.
[0139] For example, squalene (2,6,10,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene) is an unsaturated oil found in large amounts in shark liver oil and in smaller amounts in olive oil, wheat germ oil, rice bran oil, and yeast, and is a particularly preferred oil for use in the present invention. Squalene is a metabolizable oil due to its role as an intermediate in the biosynthesis of cholesterol (Merck index, 10th Edition, entry no. 8619). Exemplary metabolizable oils useful in accordance with the present invention include, but are not limited to, squalene, soybean oil, sesame oil, and caprylic / capric triglyceride (MIGLYCOL 810 oil). In one embodiment, the metabolizable oil comprises squalene. In another embodiment, the metabolizable oil comprises one or more yeast-derived isoprenoids, such as yeast-derived squalene or related yeast-derived isoprenoid structures.
[0140] In some embodiments, the compositions of the present invention comprise a metabolizable oil present at a concentration of 0.01% to 5% v / v, about 0.01% to 4% v / v, about 0.01% to 3% v / v, about 0.01% to 2% v / v, about 0.01% to 1% v / v, or about 0.01% to 0.5% v / v. In some embodiments, the metabolizable oil is present at a concentration of about 0.01% v / v, about 0.05% v / v, about 0.1% v / v, about 0.5% v / v, about 1% v / v, about 1.5% v / v, about 2% v / v, about 2.5% v / v, about 3% v / v, about 3.5% v / v, about 4% v / v, about 4.5% v / v, about 5% v / v, about 6% v / v, about 7% v / v, about 8% v / v, about 9% v / v, about 10% v / v, about 11% v / v, about 12% v / v, about 13% v / v, about 14% v / v, about 15% v / v, about 16% v / v, about 17% v / v, about 18% v / v, about 19% v / v, or about 20% v / v. In some embodiments, the metabolizable oil is present at a concentration of about 2% v / v. In some embodiments, the metabolizable oil is present at a concentration of less than 1% v / v. The percentages listed refer to the percentages in either the oil-in-water emulsion formulation before spray drying, the dry powder after spray drying, or the reconstituted dry powder.
[0141] The size of the oil droplets found within a stable oil-in-water emulsion is preferably less than 1 micron and may range from substantially 30 to 600 nm, preferably substantially from about 30 to 500 nm in diameter, and most preferably substantially from 150 to 500 nm in diameter, particularly about 150 nm in diameter as measured by photon correlation spectroscopy. In this regard, 80% of the oil droplets by number should be within the preferred range, more preferably more than 90%, and most preferably more than 95% of the oil droplets by number are within the defined size range.
[0142] The hydrophilic-lipophilic balance (HLB) of an emulsion allows for the estimation of the hydrophilic or lipophilic power of a surfactant. The HLB of an amphiphilic molecule is generally calculated as follows: HLB = (weight of 20X hydrophilic moiety) / (weight of amphiphilic molecule). HLB can have values ranging from 0 (for the most lipophilic molecules) to 20 (for the most hydrophilic molecules). Depending on the chemical composition of the surfactant (e.g., the addition of ethoxyl groups or alkene oxides), this estimation can change and the range of HLB values can increase (e.g., LUTROL F68® has an HLB of 29). In a surfactant mixture, the HLB of the mixture is the sum of the HLBs of each surfactant, balanced by their weight ratios: HLB = (HLB surfactant X × weight surfactant X) + (HLB surfactant Y × weight surfactant Y) / (weight surfactant X + weight surfactant Y). In one embodiment of an emulsion prepared according to the present invention, the final HLB of the emulsion is about 9 to about 12, preferably about 9.5 to about 11.5, and more preferably about 10 to about 11.5. In some embodiments, the HLB of the emulsion is about 10.5 to about 11.0. Methods for generating oil-in-water emulsions are well known to those skilled in the art. Typically, the method involves mixing the oil phase with a suitable surfactant, such as a PBS / TWEEN 80® solution, followed by homogenization using a homogenizer. For example, a method involving passing the mixture through a syringe needle one, two, or more times may be suitable for homogenizing small volumes of liquid. Similarly, the emulsification process using a microfluidizer (M110S microfluidics device, up to 50 passes, maximum pressure input of 6 bar (output pressure of about 850 bar) for 2 minutes) can be adapted to generate small or large volumes of emulsion. This adaptation can be achieved by routine experimentation, including measuring the resulting emulsion, until a preparation with the required oil droplet diameter is achieved.
[0143] therapeutic composition In some embodiments, the spray-dried composition is a therapeutic composition and is useful for therapeutic purposes. Thus, in some embodiments, the described compositions include dry powder compositions and further include a bioactive agent for the treatment of a disease, condition, or disorder. In some embodiments, the agent is useful for the treatment or prevention of allergies, cancer, infectious diseases, autoimmunity, or addiction. In some embodiments, the agent is useful for stimulating, enhancing, and / or modulating an immune response. Thus, although described herein as an "antigen," the bioactive agent may also activate other therapeutic and immune responses.
[0144] In some aspects of the disclosed embodiments, the composition comprises a cancer antigen or a nucleic acid encoding a cancer antigen. In some embodiments, a vaccine composition comprising a cancer antigen will be useful against any cancer characterized by tumor-associated antigen expression, such as HER-2 / neu expression, or other cancer-specific or cancer-associated antigens.
[0145] Compositions and methods according to certain embodiments of the present disclosure may also be used to prevent or treat autoimmune diseases, including diseases, conditions, or disorders in which a host's or subject's immune system detrimentally mediates an immune response directed against "self" tissues, cells, biomolecules (e.g., peptides, polypeptides, proteins, glycoproteins, lipoproteins, proteolipids, lipids, glycolipids, nucleic acids such as RNA and DNA, oligosaccharides, polysaccharides, proteoglycans, glycosaminoglycans, etc., and other molecular components of the subject's cells and tissues), or epitopes (e.g., specific immunologically defined recognition structures such as those recognized by antibody variable region complementarity-determining regions (CDRs) or by T-cell receptor CDRs).
[0146] Autoimmune diseases are therefore characterized by abnormal immune responses involving either cells or antibodies directed against normal autologous tissues. Autoimmune diseases in mammals can generally be classified into two distinct categories: cell-mediated diseases (i.e., T cell) or antibody-mediated disorders. Non-limiting examples of cell-mediated autoimmune diseases include multiple sclerosis, rheumatoid arthritis, Hashimoto's thyroiditis, type I diabetes (juvenile-onset diabetes), and autoimmune uveoretinitis. Antibody-mediated autoimmune disorders include, but are not limited to, myasthenia gravis, systemic lupus erythematosus (or SLE), Graves' disease, autoimmune hemolytic anemia, autoimmune thrombocytopenia, autoimmune asthma, cryoglobulinemia, thrombotic thrombocytopenic purpura, primary sclerosing cholangitis, and pernicious anemia. Antigens associated with systemic lupus erythematosus are small nuclear ribonucleoproteins (snRNPs); those associated with Graves' disease are thyrotropin receptors, thyroglobulin, and other components of thyroid epithelial cells; those associated with pemphigus are cadherin-like pemphigus antigens such as desmoglein 3 and other adhesion molecules; and those associated with thrombotic thrombocytopenic purpura are platelet antigens.
[0147] The compositions provided herein can be used, for example, to induce protective immunity against tuberculosis, and include the use of polypeptides containing at least one immunogenic portion of one or more Mycobacterium proteins, as well as DNA and RNA molecules encoding such polypeptides. In addition, such compounds can be formulated into vaccines and / or pharmaceutical compositions for immunization against Mycobacterium infection.
[0148] In other embodiments, compositions of the present disclosure include antigens associated with respiratory diseases, such as those caused or exacerbated by bacterial infections (e.g., pneumococcus), for the prevention and therapy of conditions such as chronic obstructive pulmonary disease (COPD). Other diseases with a respiratory component that can be treated include, but are not limited to, tuberculosis (TB), influenza (flu), respiratory syncytial virus (RSV), and lung cancer.
[0149] In addition to direct in vivo procedures, ex vivo procedures can be used in which cells are removed from the host, modified, and placed in the same or another host animal. In the ex vivo context, it will be clear that any of the above compositions can be used to introduce the nucleic acid molecule encoding the antigen into tissue cells. Protocols for viral, physical, and chemical incorporation methods are well known in the art.
[0150] In some embodiments, the compositions of the present disclosure are useful for enhancing or eliciting an immune response in a host, patient, or cell culture. As used herein, the term "subject" refers to any mammal. The patient may be suffering from an infectious disease, cancer such as breast cancer, or an autoimmune disease, or may be normal (i.e., free of detectable disease and / or infection). A "cell culture" is any preparation containing immunocompetent cells or isolated cells of the immune system (including, but not limited to, T cells, macrophages, monocytes, B cells, and dendritic cells). Such cells may be isolated by any of a variety of techniques well known to those skilled in the art (e.g., Ficoll-Hypaque density centrifugation). The cells may (but need not) have been isolated from a patient suffering from cancer and may be reintroduced into the patient after treatment.
[0151] Uses of Pharmaceutical and Therapeutic Thermostable Compositions In another aspect, provided herein is a method for stimulating an immune response in a subject, comprising administering to the subject a reconstituted spray-dried vaccine composition described herein. The method may further comprise the step of reconstituting the heat-stable spray-dried vaccine composition into an oil-in-water emulsion prior to administration.
[0152] In another aspect, provided herein is a method for stimulating a therapeutic response in a subject, comprising administering to the subject a reconstituted spray-dried vaccine composition described herein. The method may further comprise reconstituting the heat-stable spray-dried vaccine composition into an oil-in-water emulsion prior to administration. In some embodiments, the therapeutic response is for the treatment or prevention of an allergy, cancer, infectious disease, autoimmunity, or addiction.
[0153] In another embodiment, provided herein is a method for stimulating an immune response in a subject, comprising administering a spray-dried vaccine or adjuvant powder via an inhalable method.
[0154] In another embodiment, provided herein is a method for stimulating an immune response in a subject, comprising administering a spray-dried vaccine or adjuvant powder via an inhalable method. In some embodiments, the therapeutic response is for the treatment or prevention of allergies, cancer, infectious diseases, autoimmunity, or addiction.
[0155] In some embodiments, the present invention is useful for treating diseases that have a respiratory component, including antigens associated with tuberculosis (TB), influenza (flu), respiratory syncytial virus (RSV), and lung cancer (or treatment thereof).
[0156] Thus, the present invention is useful for enhancing or eliciting an immune response in a host, patient, or subject, or in cell culture. The patient may be suffering from an infectious disease, cancer such as breast cancer, or an autoimmune disease, or may be normal (i.e., free of detectable disease and / or infection). A "cell culture" is any preparation containing immunocompetent cells or isolated cells of the immune system (including, but not limited to, T cells, macrophages, monocytes, B cells, and dendritic cells). Such cells may be isolated by any of a variety of techniques well known to those skilled in the art (e.g., Ficoll-Hypaque density centrifugation). The cells may (but need not) have been isolated from a patient suffering from cancer and may be reintroduced into the patient after treatment.
[0157] Administration route The present invention relates to methods and compositions for vaccination, therapeutic treatment, and prevention of conditions such as infectious diseases, cancer, or autoimmune diseases. The methods of the present invention include administration routes, including parenteral and non-parenteral administration. Parenteral administration routes include, but are not limited to, oral, buccal, sublingual, topical, transdermal, ocular, otic, nasal, rectal, inhalation, and intravaginal routes. Injectable methods include, but are not limited to, parenteral administration routes, intravenous, intramuscular, subcutaneous, intraperitoneal, intraspinal, intrathecal, intraventricular, intraarterial, and other injection routes. These inventions contemplate compositions that can provide controlled, sustained, or sustained release of antigens and / or adjuvants over a predetermined period of time.
[0158] In some embodiments, the vaccination composition is a dry powder composition, and administration involves reconstituting the dry powder vaccine with an aqueous diluent prior to administration of the vaccine and parenterally administering the reconstituted vaccine. In some embodiments, the adjuvant vaccine composition is reconstituted separately from the antigen composition and mixed prior to administration. In some embodiments, the reconstituted vaccine is administered immediately. In other embodiments, the dry powder vaccine is administered as a dry powder, for example, via inhalation. In some embodiments, the method of inhalation involves use of an inhaler. In some embodiments, the inhaler is an active or passive dry powder inhaler or a pressurized metered dose inhaler. In some embodiments, the dry powder formulation is administered directly to the lungs.
[0159] formulation Although the formulation embodiments herein are dry powder formulations and / or reconstituted dry powder formulations, it should be understood that such formulations, process steps, and materials may vary somewhat, and the invention is not limited to the specific formulations, process steps, and materials disclosed herein.
[0160] Formulations are known to those skilled in the art and include, but are not limited to, formulations such as tablets, coated tablets, chewable tablets, effervescent tablets, pellets, capsules, syrups, suppositories, injectable formulations, and dispersions of active agents in media that are insoluble in physiological fluids or where release of the antigen and / or adjuvant is released after degradation of the formulation due to mechanical, chemical, or enzymatic activity.
[0161] Kits and Pharmaceutical Packs In certain embodiments, kits containing the vaccine compositions described herein are also contemplated, which may be provided in one or more containers. In one embodiment, all components of the vaccine composition are present together in a single container, although embodiments of the invention are not intended to be so limited, and two or more containers are also contemplated.
[0162] The container according to such kit embodiments can be any suitable vessel, vessel, vial, ampoule, tube, cup, box, bottle, flask, jar, dish, well of a single-well or multi-well apparatus, reservoir, tank, etc., or other device in which the compositions disclosed herein can be placed, stored, and / or transported and accessed for removal of the contents. Typically, such containers can be made of materials that are compatible with the intended use and from which retrieval of contained contents can be easily accomplished. Preferred examples of such containers include glass and / or plastic sealed or resealable tubes and ampoules, including those with rubber septa or other sealing means compatible with removal of contents using a needle and syringe.
[0163] Such containers may be made of, for example, glass or chemically compatible plastic or resin, which allows for efficient recovery of materials from the container, and / or may be made of or coated with a material that protects the materials from degrading conditions, such as, for example, ultraviolet light or temperature extremes, or from the introduction of undesirable contaminants, including microbial contaminants. The containers are preferably sterile or sterilizable, and are made of a material that will be compatible with any carriers, excipients, solvents, vehicles, etc., that may be used to suspend or dissolve the vaccine compositions and / or immunological adjuvant compositions and / or antigens and / or recombinant expression constructs, etc., described herein.
[0164] The present invention will be more fully understood by reference to the following examples. However, they should not be construed as limiting the scope of the present invention. It is understood that the examples and embodiments described herein are for illustrative purposes only. The various embodiments described above can be combined to provide further embodiments. Various modifications or variations in light thereof will become apparent to those skilled in the art from the foregoing description and are intended to be included within the spirit and scope of this application and the appended claims. [Example]
[0165] Conversion of liquid materials, such as vaccines, into dry powders reduces costs associated with refrigeration and transportation. Spray drying offers a unique solution because it allows powders to be engineered to have specific properties. For example, the use of spray drying as a dry powder processing method allows the resulting powder to be engineered to control properties such as flowability, size, and morphology. In Examples 1-4, spray drying was investigated as a method for encapsulating an adjuvanted tuberculosis vaccine formulated as an oil-in-water nanoemulsion within a dry powder. Successful encapsulation of the adjuvanted vaccine within non-aggregating, amorphous microparticles was achieved in a single replicate with high retention of all components. Powder stability over three months at different temperatures demonstrated that the powders were physically stable at all temperatures. Physicochemical analysis of the reconstituted powders showed that the nanoemulsion size was maintained for all samples, but there was a loss of antigen and agonist over time upon storage at elevated temperatures. This was a surprising result, as it was not known in the art that nanoemulsions of materials that are liquid at room temperature could be converted to gel-microparticles and reconstituted to the same droplet size without significant loss. In Example 4, the use of spray drying was investigated for an inhalable delivery route.
[0166] The methods in Examples 1-4 used spray-dried vaccines or adjuvants to characterize the dry powder and reconstituted vaccine formulations for stability and other important features that determine the feasibility of spray-dried formulations. The engineered particles should encapsulate the nanoemulsion within amorphous microparticles for long-term stability. Two formulations were spray-dried and evaluated for stability: a GLA-SE vehicle spray-dried with trehalose and Tris buffer (SD-TG) and a GLA-SE vehicle containing ID93 protein spray-dried with trehalose and Tris buffer (SD-TGI). Inhalable formulations may further contain leucine.
[0167] ID93 is a potent T helper cell (T) vaccine designed to combat tuberculosis (TB) in all ages. H 1) It was used because it is a recombinant protein composed of four Mycobacterium tuberculosis (Mtb) antigens that induce an immune response [3]. The antigens are combined with glucopyranosyl lipid A (GLA) squalene oil-in-water emulsion (SE), and GLA-SE is an adjuvant system formulated as a nanoemulsion [3]. In its 2018 Global Tuberculosis Report, the World Health Organization (WHO) stated that TB is the leading cause of death from a single infectious agent [4]. The only currently licensed TB vaccine to prevent Mtb infection, Baccille Calmette-Guérin (BCG), is effectively implemented for immunization of children in 158 countries, but there is currently no effective vaccine for preventing TB in adults [4]. GLA-SE + ID93 vaccine dose studies in mice, guinea pigs, and nonhuman primates demonstrated significant efficacy in induced T H The adjuvant component was used because human clinical studies showed that vaccination with a GLA-SE + ID93 formulation induced a higher antibody response than vaccination with ID93 alone [5].
[0168] Production of dry powder vaccines by spray drying oil-in-water emulsions The following formulations and methods were used to produce dry powder spray dried vaccine and / or adjuvant compositions.
[0169] [Table 1]
[0170] The formulations were generated using in silico modeling for particle design. Trehalose was used as an excipient. Trehalose is a disaccharide used as an excipient to stabilize biologics and was selected as the excipient used in this study. A relatively high solute concentration (100 mg / ml) of the excipient was utilized.
[0171] Because the physical stability of an amorphous material is closely related to its molecular mobility, which is a function of storage temperature, it was possible to design for stability at a maximum temperature.
[13] Storage below the Kausman temperature, i.e., the temperature at which molecular mobility is not important, will maximize physical stability. The Kausman temperature is T g Based on the formulation goal of long-term stability at 37°C, the T of the spray-dried powder g must be ≥ 88°C. As described by the Gordon-Taylor equation
[14] , the T of a sugar-water mixture g can be determined based on their mass fractions and the empirical parameter k. Chen et al.
[15] modeled the trehalose-water glass transition curve by fitting literature data to the Gordon-Taylor equation and determined a k of 5.2.
[0172] The moisture content of the final spray-dried powder was manipulated using moisture sorption data for trehalose, which indicates that subjecting trehalose powder to an outlet relative humidity of 10% would result in a moisture content of approximately 2-3%
[16]
[17] . Based on this trehalose-water plasticization curve
[15] and moisture sorption data
[16]
[17] , the relative humidity at the dryer outlet and collection point must be <10% to ensure physical stability. Similarly, to prevent crystallization of the resulting powder, the outlet temperature should be <T gBased on these calculations, the processing parameters were calculated so that the outlet temperature was approximately 36°C and the outlet relative humidity was 7%. A relatively low drying gas temperature was also selected to prevent possible evaporation of the nanoemulsion during the spray-drying process. It should be noted that these calculations were made based on data for powders produced from trehalose-water systems, and that the particles in this work would theoretically consist of approximately 17% GLA-SE emulsion.
[0173] Chemicals were formulated as follows: GLA-SE vehicle in water and ID93 protein in water were formulated by IDRI (Seattle, WA, USA). Trehalose dihydrate (Trehalose) and HPLC-grade water were purchased from Fisher Scientific (Ottawa, ON, Canada). Tris(hydroxymethyl)aminomethane (Tris) and hydrochloric acid (HCl) were purchased from Sigma-Aldrich (Oakville, ON, Canada). Vials of the lead lyophilized vaccine candidate (TT) [8] were provided by IDRI (Seattle, WA, USA) for comparison.
[0174] Example 1 Raw material preparation The raw material preparation was as follows: ID93 (1.2 mg / ml ID93 protein) was stored in small aliquots at -80°C prior to use. Similarly, a stock concentration of GLA-SE solution (10% [v / v] squalene, 50 μg / mL GLA) was stored in a refrigerator prior to use (see also
[27]
[28] for the preparation of stock GLA-SE). The raw material was prepared by mixing 40 mM Tris with 200 mg / ml trehalose in HPLC water, followed by pH adjustment to 7.5 ± 1 using hydrochloric acid. Mass was measured using one of two balances (Model XS4002S, Mettler Toledo, Mississauga, ON, Canada) or (Model ME204E, Mettler Toledo, Mississauga, ON, Canada), depending on the required mass of a given component. GLA-SE or GLASE + ID93 protein was diluted with HPLC-grade water to 2x working concentrations (4% [v / v] squalene, 20 μg / mL GLA, 8 μg / mL ID93) for the formulations SD-TG and SD-TGI, respectively. The two solutions were then mixed 1:1 so that the final composition of the solution before spray drying was 100 mg / mL trehalose, 20 mM Tris, 2% [v / v] squalene, 10 μg / mL GLA for SD-TG, and an additional 4 μg / mL ID93 protein for SD-TGI. The target excipient composition for SD-TG and SD-TGI was 20 mM Tris, 10% [w / v] trehalose.
[0175] Example 2 Spray Drying Process Spray drying was performed using a custom research spray dryer from Particle Engineering Group
[19] . The spray dryer had the following components: a two-fluid atomizer, a drying chamber (30 L volume), a cyclone separator, a sub-micron cutoff size at 400 SLPM (standard liters per minute), a double-walled collection vessel with a thermostat system, a peristaltic pump, a process gas heater, a gas source (compressed air), a process control system, and process sensors and data acquisition systems. The feedstock was atomized using a customized version of a Buchi B-191 two-fluid atomizer (Buchi Labortechnik, AG, Flawil, Switzerland), which has been characterized elsewhere
[20] . Processing conditions were determined based on in silico modeling. The feedstock was fed into the atomizer at a rate of 0.6 ml / min using a peristaltic pump (Model 77200-60, Cole-Parmer, Montreal, QC, Canada) to produce an air-to-liquid ratio of 8. The atomized droplets were dried in air flowing at 200 SLPM with a drying gas temperature of 65°C. The dried powder was separated from the air by a cyclone, and the powder was collected in glass jars. These jars were sealed and stored in an environmental chamber (Model CEO 910W-4, Lunaire Limited, Williamsport, PA, USA) set at 25°C and 7% RH until packaging (1-2 days). Laboratory PPE, including a respirator, was worn during the spray-drying process to minimize the risk of inhaling the dry powder.
[0176] Example 3 Packaging and Storage The spray-dried formulations were packaged and stored using the following protocol. Packaging - An intensive packaging process was utilized to prevent moisture uptake in the powder during stability studies. Generally, appropriate packaging was used to preserve the integrity of the pharmaceutical powder; otherwise, the powder may be exposed to moisture, thereby inactivating the biological components for protein unlabeling. Packages containing vials of powder were placed in temperature storage. Packaging preparation involved placing silica gel pouches in an environmental chamber (Model CEO 910W-4; Lunaire Limited, Williamsport, PA, USA) set at 25 °C and 7% RH for 3-4 days to equilibrate the desiccant to the spray dryer outlet relative humidity. Simultaneously, an equal number of silica gel pouches were equilibrated to 0% RH in a conditioned glove box. The relative humidity of the environment was monitored using a digital hydrometer (M170 measuring indicator with HMP77B humidity and temperature probe, Vaisala, Vantaa, Finland).
[0177] The packaging process was carried out in a custom glove box set to 0% RH. The powder was measured into low-binding snap-cap tubes (product Z768820, Sigma-Aldrich, Oakville, ON, Canada), which were then placed in an aluminum bag along with a 7% RH desiccant pouch. This aluminum bag was then double-heat sealed and placed in another aluminum bag along with a 0% RH desiccant pouch. This outer bag was also double-heat sealed. A simplified schematic summarizing the process is shown in Figure 1. The powder was stored as follows: packages for low-temperature stability (5°C) were placed in a refrigerator (model SCGP-1804, VWR, Edmonton, AB, Canada). Packages for 25°C and 40°C storage were placed in two separate incubators (model 414005-120, VWR, Edmonton, AB, Canada). For the former, the incubator setpoint was 25°C, but the temperature controller fluctuated between 25 and 28°C.
[0178] Example 4 Yield and production rate Powder yield and production rate results are as follows: In silico calculations predicted a nominal solids throughput of 75 mg / min. Powder production for stability studies showed that the actual production rates for producing SD-TG and SD-TGI powders were 49 mg / min and 45 mg / min, respectively. A yield of 60% of theoretical is typical for small-scale spray drying. However, the current formulation and processing parameters, determined by in silico modeling, were targeted to maximize encapsulation efficiency. In some embodiments, larger agglomerates can be removed by cyclone filtration. In some embodiments, increased yield can be achieved by adding a dispersing agent to the formulation.
[0179] Example 5 Characterization of spray-dried dry powder vaccine compositions The preservation and chemical integrity of the emulsions were studied to determine if any solutes were lost during the spray drying process. Formulation development and appropriate processing parameters were selected to prevent significant changes in emulsion size during the process, either through evaporation of the oil component or coalescence of the emulsion. Therefore, analyses were completed to compare the chemical and colloidal properties of the blended liquid SD-TG and SD-TGI ingredients and the reconstituted powders discussed in Example 1. These measured properties of the formulations before and after spray drying are shown in Table 2.
[0180] The dried and reconstituted powders were characterized using methods such as scanning electron microscopy, Karl Fischer calorimetry, Raman spectroscopy, HPLC, ELISA, SDS-PAGE, and pH and osmolality tests as follows:
[0181] A. Dry Powder Characterization Dry powder characterization used scanning electron microscopy and Raman spectroscopy, as well as Karl Fischer calorimetry. In all cases, results are reported as the mean ± standard deviation of replicate measurements. The number of replicates for each method is indicated. A two-tailed Student's t-test was used for analysis, and statistically significant differences were reported at p<0.05.
[0182] For scanning electron microscopy, powder samples were mounted directly onto aluminum SEM stubs (Product 16111, Ted Pella, Inc., Redding, CA, USA) in a manner that intentionally produced cracked particles. These samples were placed in a desiccator connected to an in-house vacuum for 2–4 days to remove exposed nano-oil droplets and prevent damage to the imaging equipment. After this process, the samples were sputtered with a coating of 80% gold and 20% palladium (Leica ACE600 Carbon / Metal Coater, Concord, ON, Canada) to a thickness of 10–15 nm. Images of the particles were captured with a Zeiss Sigma field emission scanning electron microscope (Zeiss Sigma FE-SEM, Carl Zeiss, Oberkochen, Germany). Images ranging from 500 to 20,000x magnification were taken at a working distance of 5.3–6.3 mm using an accelerating voltage of 3–4 kV.
[0183] Raman spectroscopy was utilized to evaluate the solid state of the powders and obtain reference spectra using a custom dispersive Raman spectroscopy system. The system includes a 671 nm diode-pumped solid-state laser (Ventus Solo MPC6000, Laser Quantum, Stockport, UK) and a series of filters to optimize and clean up the signal before it reaches the spectrograph. A detailed description of the companion instrument, also developed by the Particle Engineering Group, and the analytical methodology can be found in other publications
[22] . Components with low mass fractions (approximately 1% of the sample) cannot be detected. Samples were placed in a sealed sample chamber under nitrogen to prevent moisture exposure, and as such, all spectra were acquired at temperatures between 22.0 and 23.0 °C and <5% RH. In addition to the measured SD-TG and SD-TGI powder samples, Raman spectral analysis was also performed on amorphous and crystalline trehalose powder samples as references. Similarly, reference spectra were also obtained for liquid samples of squalene in water and 200 mg / ml Tris buffer, pH-adjusted to 7.5.
[0184] Karl Fischer calorimetry was used to measure the moisture content of powders by mass using a Karl Fischer coulometric titrator (Model C30, Mettler Toledo, Mississauga, ON, Canada), and the results were expressed as a percentage based on the measured sample mass. The water content in the sample was calculated by measuring the current required to react all the water in the sample. Samples were analyzed using a modified version of the default Stromboli coulometry method. For each set of tests, two "blank" vials were used to obtain a baseline of the ambient moisture content at the time of the experiment. The moisture content of the powder was determined by measuring and averaging two vials of the same powder. Analysis of the experiment to determine the moisture content of a Hydranal water standard (Honeywell, Mexico City, Mexico) showed a mechanical variance of 0.3%.
[0185] B. Reconstituted Powder CharacterizationThe spray-dried powder was reconstituted as follows: each vial containing 108 mg of pre-agglomerated and packaged powder was reconstituted with 0.8 ml of water at the time of testing, resulting in a concentration similar to that of the liquid drug product. Each test was performed in triplicate on the reconstituted powder. Replicate measurements of the raw material were made from the same vial. The reconstituted powder was characterized by dynamic light scattering, HPLC, ELISA, SDS-PAGE, pH, and osmolality as follows: dynamic light scattering was used to determine the mean hydrodynamic diameter of the emulsions, and a Malvern Zetasizer APS (Malvern, UK) to determine their polydispersity. Liquid raw material measurements were for one replicate analyzed three times. GLA and squalene quantification was achieved using reverse-phase HPLC analysis. These tests were performed using a 1200 Series HPLC device (Agilent Technologies) for separation and a Corona Charged Aerosol Detector (CAD) (ESA Biosciences, Chelmsford, MA, USA) for analyte detection. Liquid feed measurements were performed in two replicates, analyzed once. ELISA was used to identify antigen content before and after spray drying by plating the samples and quantifying ID93 content using a specific antibody. Liquid feed measurements were performed in one replicate, analyzed three times. SDS-PAGE was used to measure the presence and integrity of ID93 protein in the samples based on the presence or intensity of bands, respectively. ID93 integrity was quantified by comparing band intensity with a stock control of ID93 protein. To determine the pH, a 300 μL aliquot of the reconstituted powder was measured using an Orion ROSS Ultra Semi-micro pH Electrode (Thermo Scientific, Waltham, MA, USA) to determine the sample pH. The pH meter was calibrated before each measurement using 4.00, 7.00, and 10.00 standards. Measurements of the liquid feed consisted of one replicate.The osmolality of the reconstituted powder was measured using an osmometer (Model 2020, Advanced Instruments, Norwood, MA, USA). Measurements of the liquid material consisted of one replicate.
[0186] Example 6 Stability Study of Spray-Dried Dry Powder Vaccine Compositions The formulation from Example 1 was studied for chemical, colloidal, and physical stability at various temperatures. Many of the methods used for characterization were also used to assess stability. Therefore, Example 2 provides the methods used for stability studies. Stability is important because emulsion instability can cause inactivation and reduced concentrations of the adjuvant (TLR4 agonist, such as GLA), thereby reducing the immune response generated by the adjuvant system. In addition, emulsion instability can also result in the emulsion forming larger droplets [6]. This can also reduce the immune response because larger particles are cleared from the body more quickly. Furthermore, emulsions larger than 4 μm can cause changes in blood pressure and increase the likelihood of embolism [7]. The GLA-SE adjuvant is stable as a refrigerated liquid; therefore, the current adjuvanted ID93 vaccine candidate is administered in clinical studies in a two-vial system consisting of rehydrated lyophilized ID93 and liquid adjuvant, which are mixed prior to administration [8].
[0187] Example 7 Chemical and colloidal stability The stability of the spray-dried powder was evaluated based on pre-established criteria discussed in Table 1. Stability at higher temperatures such as 37°C for 3 months indicated long-term stability at room temperature.
[0188] [Table 2]
[0189] The results, shown in Table 2, show a comparison of the raw liquid and reconstituted powders, demonstrating high encapsulation efficiency. The results demonstrate high retention of the squalene component (>90%) for both formulations. Surprisingly, the droplet size of the reconstituted emulsion was nearly identical to that of the raw emulsion, and the content remained nearly unchanged. This means that these nanoemulsions can be spray-dried without their destruction or loss of oil (which is liquid). While smaller emulsions have been shown to be more stable over time than larger ones [6], this success has not been seen with these nanoemulsions. Furthermore, the polydispersity index, GLA content, and pH did not change significantly (p>0.05) over the course of spray drying for both formulations, indicating a low number of emulsions agglomerating. The retention of GLA and ID93 content indicates that these components did not degrade over the course of spray drying, which was particularly successful because these components are sensitive to thermal stress. The low ID93 content in the SD-TGI powder may be due to protein binding to the sides of the raw container during compounding.
[0190] Although analysis immediately after spray drying showed high retention (see Example 2), the applicability of spray-dried emulsions as vaccines depends on nanoemulsion stability over time, so the stability of the powder over time was also investigated. Mlalila et al.'s
[24] experiments spray-drying lipid nanoparticles initially showed a similar diameter scale to GLA-SE, but after 1 month of storage in a desiccator, nanoparticle size increased 2-8-fold. The stability study included storage of spray-dried powder at several storage temperatures: -20°C, 2-8°C, 25°C, and 40°C. For each temperature, powders were reconstituted at given time points and evaluated for squalene content, emulsion diameter, polydispersity index, GLA concentration, ID93 concentration, and pH. Osmolality was measured initially and after 3 months for all storage temperatures.
[0191] The profile of the squalene content of the GLA-SE vehicle over the course of the 3-month stability study is shown in Figure 2. Squalene content decreased for both powder formulations at all storage temperatures. After 3 months of storage at 40°C, the squalene content of SD-TG decreased from 18.8 ± 0.3 mg / ml to 15.8 ± 0.4 mg / ml (16% loss), and for SD-TGI it decreased from 17.3 ± 0.6 mg / ml to 15.7 ± 0.8 mg / ml (9% loss). Emulsion diameters remained essentially unchanged, from 96.9 ± 0.2 nm to 97.7 ± 0.5 nm (only a 1% increase) and from 97.6 ± 1.1 nm to 99 ± 0.9 nm for SD-TG and SD-TGI, respectively. PDI did not change significantly over the course of 3 months at any given storage temperature (p > 0.05). As such, these changes are all within the stability criteria for squalene previously described: <20% squalene loss, <50% emulsion size change, and polydispersity index <0.2. Compared to a 3-month stability study at 37°C conducted on a potential lyophilized candidate, the spray-dried powder performed equally well with respect to particle size change [8]. Additionally, the performance of the spray-dried candidate was significantly better than the current two-vial clinical presentation, the liquid single-vial, and the proof-of-concept lyophilized candidate, the latter of which underwent an 84% particle size change [8]. GLA retention was high (87–93% retained) after 3 months for both powders at -20°C and 2–8°C storage. However, after 3 months of storage at 25°C, the GLA content decreased from 9.5±0.4 μg / ml to 8.7±0.2 μg / ml (12% loss) for the SD-TG formulation and from 9.0±0.4 μg / ml to 7.2±0.1 μg / ml (19% loss) for the SD-TGI formulation. Similarly, at 40°C, the GLA content decreased to 5.8±0.2 μg / ml (40% loss) for the SD-TG formulation and to 5.1±0.3 μg / ml (43% loss) for the SD-TGI formulation.
[0192] SDS-PAGE results confirmed that ID93 was present at all storage temperatures. Analysis with imaging software quantified the remaining ID93 protein as a percentage of the control compared to the ID93 + GLA-SE control. Using this analysis, after 3 months of storage, the amount of ID93 protein in the SD-TGI formulation was found to be 83 ± 19% at -20°C, 66.5 ± 11% at 2-8°C, 40 ± 5% at 25°C, and 44 ± 3% at 40°C.
[0193] Overall, the pH of the reconstituted liquids tended to decrease over time at all temperatures. However, the pH remained between 7.41 and 7.61 for the reconstituted SD-TG and SD-TGI. The maximum change was 0.16 pH units. In comparison, the liquid, vial, and POC samples stored at 37°C for 3 months showed a larger pH decrease of 0.2 to 0.8 pH units. [8] Alternatively, osmolality increased slightly over time for all samples. For SD-TG samples, osmolality increased by 2 to 4%, with the smallest change occurring at 40°C and the largest change occurring at -20°C storage. Osmolality increased by 3 to 9% for the reconstituted SD-TGI powder, with the smallest change occurring at 40°C and the largest change occurring at 2 to 8°C storage.
[0194] Although the spray dried formulation experienced some loss of GLA and ID93 protein outside of the formulation target, dry powder characterization results indicated that the particles remained physically stable at all temperatures.
[0195] B. Physical stability Particle morphology analysis of SEM images showed that spray-drying the formulations produced polydisperse samples, with microparticles ranging in geometric diameter from approximately 1 to 20 μm. SEM images of SD-TG and SD-TGI, shown in Figures 3a and 3b, respectively, indicated that the spray-dried microparticles were spherical, non-aggregated, and had surfaces ranging from smooth to slightly dimpled. Additionally, the similarity of these microparticles indicated that the presence of protein did not affect the particle structure. For comparison, shown in Figure 3c, 100 mg / mL trehalose microparticles spray-dried under the same conditions had very similar external particle morphology to the SD-TG and SD-TGI formulations: spherical, non-aggregated particles with smooth or slightly dimpled surfaces. The SD-TG and SD-TGI particles were also slightly larger than the trehalose particles, which is expected to be due to the increased solids content of the SD-TG and SD-TGI formulations.
[0196] SEM images of SD-TG, SD-TGI, and trehalose cracked microparticles all showed that these particles could be hollow or solid, with varying shell thicknesses within a given sample. However, the internal structure of this shell differed from that of spray-dried trehalose. While trehalose particles exhibited a solid shell, the interior of SD-TG and SD-TGI particles contained numerous voids within the trehalose structure. These voids, shown in the SEM images of SD-TG and SD-TGI, also appeared in images of the freeze-dried TT formulation (Figure 3d). Considering that the size of these voids also appeared to be approximately nanoemulsion size, it is possible that the voids were left behind by the evaporated nanoemulsion. Higher magnification images of the surface showed relatively few voids on the surface of the particles, indicating that some, but not significant, of the nanoemulsion had been lost due to accumulation on the outer surface of the particles.
[0197] Figure 5 shows the SD-TGI formulation after 3 months of storage at different storage temperatures. The lower magnification in Figure 5a shows
[0198] This shows that the sample stored at 40°C maintained its external particle structure. The microparticles remained polydisperse, spherical, and non-agglomerated. The lack of particle fusion and shape change indicated physical stability. As shown in Figure 5b, the internal structure of the particles was maintained after storage at 40°C, as the voids left by the nanoemulsion were clearly distinct. The slight spheroidization of the external features, shown at higher magnification, indicates that powder mobility was not insignificant. The GLA-SE component was powder T g may have dropped below the predicted temperature of about 90°C.
[0199] Powder moisture content was determined as follows: the initial moisture content of the powder on a wet basis was measured to be 2.6 ± 0.1%. Moisture content after 3 months of storage at 5, 25, and 40°C was 2.7%, 2.4%, and 2.1%, respectively; all values were ± 0.1%; these changes were determined to be statistically insignificant (p > 0.05). Due to the high temperature and relatively large amount of headspace in the vials used for Karl Fischer experiments, slight powder drying at higher temperatures is not unexpected. It was notable that 5°C samples stored in a refrigerator with an internal environment > 30% RH showed no moisture uptake. This lack of moisture uptake was particularly interesting and indicated that the implemented packaging system was very robust. As previously mentioned, protein degradation in spray-dried powders is associated with crystallization of these powders; therefore, protein degradation may contribute to the T value of the powder. g This can be mitigated by preventing moisture uptake by these powders, thereby preventing any degradation of the powder's moisture content.
[0200] Solid-state analysis involved Raman spectroscopy of the SD-TG and SD-TGI powders at various time points within the stability study to confirm the presence of components within the samples and determine any changes in the solid state. The sample spectrum of SD-TG powder obtained at time 0, as well as reference spectra of amorphous trehalose, squalene, Tris pH 7.5, and crystalline trehalose, are shown in Figure 7. The ID93 protein component contribution was not included in the analysis because its low mass fraction (approximately 0.003%) was not within the detection limit of the Raman system. Reference spectra were also obtained for other components of GLA-SE, but their mass fractions in the samples were also outside the detection limit. Examination of the sample spectrum showed that the trehalose component was completely amorphous, as indicated by the presence of peaks at 425, 460, 560, 865, 935, and 1145 cm in the sample. -1 This is evident by the presence of characteristic peaks of amorphous trehalose at approximately 395, 455, 695, 980, and 1235 cm, to name a few. -1 The presence of squalene in the sample was further supported by the absence of a characteristic peak of crystalline trehalose at 1400 cm. -1 Trehalose was identified by its characteristic peak appearing at 1325 and 1460 cm. The solid state of trehalose is further confirmed by the low normalized intensity of the residual spectra, shown in Figures 6a and 6b, which show SEM images of SD-TGI powder after 3 months of storage at 40 °C, demonstrating that a) the sample maintains its external morphology after accelerated storage and b) the internal particle structure is maintained. Scales are provided on each image. Abbreviations: SD-TGI, spray-dried trehalose + Tris + GLA-SE + ID93; GLA, glucopyranosyl lipid adjuvant; SE, squalene oil-in-water emulsion. In Figure 7, the residual spectra were obtained by subtracting reference spectra for amorphous trehalose (81% mass fraction), squalene (14% mass fraction), and Tris (2% mass fraction) from the sample spectrum. Although a DMPC (3% mass fraction) reference spectrum could not be obtained, the peaks at 1325 and 1460 cm in the residual spectrum were clearly visible. -1 The presence of the peak at
[25] is likely due to this component of the GLA-SE vehicle.
[0201] Similar analyses were completed on the SD-TGI powder, confirming that the trehalose component was amorphous, as well as the presence of squalene and Tris buffer in the sample. It was expected that SD-TG and SD-TGI would have similar results, as the only difference in formulation between the samples was the presence of ID93 in the latter.
[0202] Sample spectra of SD-TGI at time point 0 and after 3 months of storage at 5, 25, and 40°C are shown in Figure 8. All spectra appear very similar, indicating that the solid state of the powder did not change significantly over the course of the stability study. Indeed, deconvolution of SD-TG and SD-TGI spectra collected at different points in the stability study confirmed that all samples showed the presence of squalene and Tris, and that trehalose remained amorphous. This suggests that if the moisture content was not increased, the manipulated TGI g This is consistent with the moisture content data, as trehalose was unlikely to crystallize because temperatures were >88 °C. The spectrum remaining after subtracting the SD-TGI spectrum collected after 3 months at 40 °C from the time point 0 spectrum (Figure 8) showed that the extremely low normalized remaining spectrum indicated that the two samples were remarkably similar, thus indicating that the solid phase of the powder was maintained over this period, despite the thermal stresses applied to the powder.
[0203] Spray-dried oil-in-water formulations containing trehalose as an excipient were evaluated for stability to assess the feasibility of encapsulating nanoemulsions within amorphous microparticles for long-term storage. Two formulations of adjuvanted tuberculosis vaccines were tested for stability: a composition of the adjuvant system formulated as an oil-in-water emulsion, and a composition combining the adjuvant system with a vaccine protein. In silico modeling was used in conjunction with known trehalose data to predict processing conditions with increased likelihood of success, thereby reducing the need for trial-and-error experimental studies. Comparison of the formulated raw material and the reconstituted spray-dried powder demonstrated that emulsion integrity, both in terms of size and concentration, was preserved. Similarly, the adjuvant and protein were shown to have similar concentrations after spraying. These results strongly suggest that vaccine efficacy was preserved throughout spray drying due to the preservation of physicochemical properties exhibited upon reconstitution.
[0204] These spray-dried powders were then evaluated for stability over a 3-month period up to 40°C through characterization of the reconstituted powder and the dried powder itself. Results indicated that the powders maintained physical stability at all temperatures after 3 months. Similarly, emulsion size and polydispersity did not change significantly at all temperatures for both formulations, and performance in these studies was significantly better than the lyophilized proof-of-concept and comparable to the lead lyophilized candidate. [8] GLA preservation was comparable to the proof-of-concept version.
[0205] The demonstrated potential of the product indicates that it is particularly useful for applications requiring long-term stability at room temperature, such as global health applications. Formulating the adjuvant, with or without antigen, as a dry powder and reconstituting it immediately before administration would significantly reduce costs associated with transportation and storage. Furthermore, spray drying is a viable alternative to freeze-drying due to its lower processing costs
[10] .
[0206] Example 8 Spray-dried formulations for pulmonary delivery After demonstrating the feasibility of spray drying for vaccine compositions in Examples 1-8, experiments were performed to refine the formulation to produce particle sizes suitable for pulmonary delivery (inhalation). Spray drying, unlike freeze-drying, allows for the manipulation of properties such as particle size. This opens the door to other delivery routes, such as pulmonary (inhalation), rather than intramuscular injection.
[0207] Inhalable particles require specific properties for successful administration, including: 1. an aerodynamic particle size of less than 20 μm, including 2-3 μm, which may be obtainable by reducing the solids content and manipulating spray drying parameters, and 2. high dispersibility to create wrinkled, hollow particles, which can be obtained by incorporating L-leucine as an excipient at a concentration greater than 0.25 mass fraction.
[0208] The following formulations were made for spray-dried ID93 and GLA adjuvants. Initially, the antigen ID93 was not included in the inhalable formulations (LN-23-32 and LN-23-33) due to the difficulty of measuring the pH of small amounts. Trehalose and GLA-SE concentrations were prepared at one-third of those used for freeze-drying and spray-drying TT (see LN-23-17 in Table 3 below). LN-23-33 was formulated with leucine as a shell-forming agent.
[0209] [Table 3]
[0210] Table 4 provides preliminary particle size results using a dry powder inhaler in the form of the Alberta Idealized Throat (Next Generation Impactor) shown in Figure 8. The following were analyzed: (1) emitted dose from the inhaler (%), (2) total lung deposition (TLD) (%) (representing loss to the mouth-throat), (3) mass median aerodynamic diameter, MMAD (μm), and (4) geometric standard deviation, GSD. MMAD refers to the diameter of the dry particle. Two inhalable formulations were tested: LN-23-32 and LN-23-33 (containing leucine).
[0211] The results in Table 3 compare the concentrations of components from three formulations before and after spray drying. Two inhalable formulations (LN-23-32 and LN-23-33) were compared to the dried injectable formulation LN-23-17. The results in Table 3 show that leucine increased yields based on the mass of components recovered after spray drying.
[0212] [Table 4]
[0213] The results in Table 4 show that the formulation containing leucine (LN-23-33) provided the best emitted dose from the inhaler, and the total lung deposition showed that fewer particles were lost in the mouth and throat (more particles reached the lungs), indicating that the formulation with leucine provided the best results for the aerosolized vaccine composition.
[0214] The method used to characterize the spray-dried inhalable formulation was carried out as discussed in Example 2 for the spray-dried (dry powder) vaccine composition therein. For example, to determine pH, a 300 μL aliquot of the reconstituted powder was measured using an Orion ROSS Ultra Semi-micro pH Electrode (Thermo Scientific, Waltham, MA, USA) to determine the sample pH. The pH meter was calibrated before each measurement using 4.00, 7.00, and 10.00 standards. Measurements of the liquid feedstock consisted of one replicate. The osmolality of the reconstituted powder was measured using an osmometer (Model 2020, Advanced Instruments, Norwood, MA, USA). Measurements of the liquid feedstock consisted of one replicate. SD represents standard deviation. Particle size was determined by measuring the Z-average diameter (Z-Aved) of the liquid dry powder composition (see Zavg in Table 5). GLA and squalene quantification was achieved using reverse-phase HPLC analysis. The test was performed using a 1200 series HPLC device for separation and a Corona Charged Aerosol Detector (CAD) for analyte detection. Liquid feed measurements were performed in duplicate. The polydispersity index (PdI) was assessed after reconstitution of the spray-dried composition. For example, dynamic light scattering (DLS) can be used to assess PdI.
[0215] Table 5 shows the results of testing the inhalable formulations compared to the injectables. The results showed high retention (low % loss) of squalene and GLA, indicating that these components were not degraded over the course of spray drying and that particle diameter (Zavg) was maintained. The polydispersity index (PdI) did not change significantly, indicating low emulsion agglomeration.
[0216] [Table 5]
[0217] The results in Table 5 show that LN-23-33, an inhalable formulation containing 1% leucine, doubled in particle size upon reconstitution, and the sample was polydisperse. However, this result is unlikely to reduce efficacy, as the powder vaccine is intended for use as an inhalable dry powder without reconstitution. Furthermore, given that the reconstitution volume may not be strictly accurate, the GLA content was approximately as expected. Thus, a heat-stable inhalable adjuvant composition with the desired characteristics was successfully produced. Inhalable formulations LN-23-33 and LN-23-32 can be used to produce exemplary inhalable formulations containing active amounts of the antigen ID93 or another antigen. Other results with the spray-dried formulations in Examples 1-3 showed that the addition of antigen did not affect particle size and stability. ID93 content can be quantified using SDS-PAGE and ELISA. Total solids content can be varied between different formulations containing ID93 by reducing the amount of trehalose, GMP, squalene, DMPC, and / or leucine to maintain a particle size suitable for inhalable delivery. Thus, the inhalable formulation of Example 4 can be used with antigens such as ID93 for inhalable vaccines.
[0218] Alternatives and Extensions Each embodiment disclosed herein can be used or otherwise combined with any of the other embodiments disclosed. Any element of any embodiment can be used in any embodiment.
[0219] Although the present invention has been described with reference to particular embodiments, it will be understood by those skilled in the art that various changes may be made and equivalents may be substituted for the elements thereof without departing from the true spirit and scope of the invention. In addition, modifications may be made without departing from the essential teachings of the invention.
[0220] [Table 6-1]
[0221] [Table 6-2] Table 6: ID93 sequences (SEQ ID NOs: 1-8) Sequence ID93 fusion polypeptide with optional His tag (SEQ ID NO: 1) MGSSHHHHHHSSGLVPRGSHMTINYQFGDVDAHGAMIRAQAGSLEAEHQA IISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGN NMAQTDSAVGSSWAGTHLANGSMSEVMMSEIAGLPIPPIIHYGAIAYAPS GASGKAWHQRTPARAEQVALEKCGDKTCKVVSRFTRCGAVAYNGSKYQGG TGLTRRAAEDDAVNRLEGGRIVNWACNELMTSRFMTDPHAMRDMAGRFEV HAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNML HGVRDGLVRDANNYEQQEQASQQILSSVDINFAVLPPEVNSARIFAGAGL GPMLAAASAWDGLAEELHAAAGSFASVTTGLAGDAWHGPASLAMTRAASP YVGWLNTAAGQAAQAAGQARLAASAFEATLAATVSPAMVAANRTRLASLV AANLLGQNAPAIAAAEAEYEQIWAQDVAAMFGYHSAASAVATQLAPIQEG LQQQLQNVLAQLASGNLGSGNVGVGNIGNDNIGNANIGFGNRGDANIGIG NIGDRNLGIGNTGNWNIGIGITGNGQIGFGKPANPDVLVVGNGGPGVTAL VMGGTDSLLPLPNIPLLEYAARFITPVHPGYTATFLETPSQFFPFTGLNS LTYDVSVAQGVTNLHTAIMAQLAAGNEVVVFGTSQSATIATFEMRYLQSL PAHLRPGLDELSFTLTGNPNRPDGGILTRFGFSIPQLGFTLSGATPADAY PTVDYAFQYDGVNDFPKYPLNVFATANAIAGILFLHSGLIALPPDLASGV VQPVSSPDVLTTYILLPSQDLPLLVPLRAIPLLGNPLADLIQPDLRVLVE LGYDRTAHQDVPSPFGLFPDVDWAEVAADLQQGAVQGVNDALSGLGLPPP WQPALPRLFST ID93 Fusion polypeptide (SEQ ID NO: 2) MTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAAC QGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGTHLAN GSMSEVMMSEIAGLPIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVAL EKCGDKTCKVVSRFTRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGR IVNWACNELMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNIS GAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQA SQQILSSVDINFAVLPPEVNSARIFAGAGLGPMLAAASAWDGLAEELHAA AGSFASGWVTTGLAGDAWHGPASLAMTRAASPYVLNTAAGQAAQAAGQAR LAASAFEATLAATVSPAMVAANRTRLASLVAANLLGQNAPAIAAAEAEYE QIWAQDVAAMFGYHSAASAVATQLAPIQEGLQQQLQNVLAQLASGNLGSG NVGVGNIGNDNIGNANIGFGNRGDANIGIGNIGDRNLGIGNTGNWNIGIG ITGNGQIGFGKPANPDVLVVGNGGPGVTALVMGGTDSLLPLPNIPLLEYA ARFITPVHPGYTATFLETPSQFFPFTGLNSLTYDVSVAQGVTNLHTAIMA QLAAGNEVVVFGTSQSATIATFEMRYLQSLPAHLRPGLDELSFTLTGNPN RPDGGILTRFGFSIPQLGFTLSGATPADAYPTVDYAFQYDGVNDFPKYPL NVFATANAIAGILFLHSGLIALPPDLASGVVQPVSSPDVLTTYILLPSQD LPLLVPLRAIPLLGNPLADLIQPDLRVLVELGYDRTAHQDVPSPFGLFPD VDWAEVAADLQQGAVQGVNDALSGLGLPPPWQPALPRLFST ID83 fusion polypeptide with optional His tag (SEQ ID NO: 3) MGSSHHHHHHSSGLVPRGSHMGTHLANGSMSEVMMSEIAGLPIPPIIHYG AIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRFTRCGAVAYN GSKYQGGTGLTRRAAEDDAVNRLEGGRIVNWACNELMTSRFMTDPHAMRD MAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAF RNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSVDINFAVLPPEVNSAR IFAGAGLGPMLAAASAWDGLAEELHAAAGSFASVTTGLAGDAWHGPASLA MTRAASPYVGWLNTAAGQAAQAAGQARLAASAFEATLAATVSPAMVAANR TRLASLVAANLLGQNAPAIAAAEAEYEQIWAQDVAAMFGYHSAASAVATQ LAPIQEGLQQQLQNVLAQLASGNLGSGNVGVGNIGNDNIGNANIGFGNRG DANIGIGNIGDRNLGIGNTGNWNIGIGITGNGQIGFGKPANPDVLVVGNG GPGVTALVMGGTDSLLPLPNIPLLEYAARFITPVHPGYTATFLETPSQFF PFTGLNSLTYDVSVAQGVTNLHTAIMAQLAAGNEVVVFGTSQSATIATFE MRYLQSLPAHLRPGLDELSFTLTGNPNRPDGGILTRFGFSIPQLGFTLSG ATPADAYPTVDYAFQYDGVNDFPKYPLNVFATANAIAGILFLHSGLIALP PDLASGVVQPVSSPDVLTTYILLPSQDLPLLVPLRAIPLLGNPLADLIQP DLRVLVELGYDRTAHQDVPSPFGLFPDVDWAEVAADLQQGAVQGVNDALS GLGLPPPWQPALPRLFST ID83 fusion polypeptide (SEQ ID NO: 4) HLANGSMSEVMMSEIAGLPIPPIIHYGAIAYAPSGASGKAWHQRTPARAE QVALEKCGDKTCKVVSRFTRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRL EGGRIVNWACNELMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASA QNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQ QEQASQQILSSVDINFAVLPPEVNSARIFAGAGLGPMLAAASAWDGLAEE LHAAAGSFASVTTGLAGDAWHGPASLAMTRAASPYVGWLNTAAGQAAQAA GQARLAASAFEATLAATVSPAMVAANRTRLASLVAANLLGQNAPAIAAAE AEYEQIWAQDVAAMFGYHSAASAVATQLAPIQEGLQQQLQNVLAQLASGN LGSGNVGVGNIGNDNIGNANIGFGNRGDANIGIGNIGDRNLGIGNTGNWN IGIGITGNGQIGFGKPANPDVLVVGNGGPGVTALVMGGTDSLLPLPNIPL LEYAARFITPVHPGYTATFLETPSQFFPFTGLNSLTYDVSVAQGVTNLHT AIMAQLAAGNEVVVFGTSQSATIATFEMRYLQSLPAHLRPGLDELSFTLT GNPNRPDGGILTRFGFSIPQLGFTLSGATPADAYPTVDYAFQYDGVNDFP KYPLNVFATANAIAGILFLHSGLIALPPDLASGVVQPVSSPDVLTTYILL PSQDLPLLVPLRAIPLLGNPLADLIQPDLRVLVELGYDRTAHQDVPSPFG LFPDVDWAEVAADLQQGAVQGVNDALSGLGLPPPWQPALPRLFST Rv1813 (SEQ ID NO: 5) MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGL PIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRF TRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGRIVNWACN Rv3620 (SEQ ID NO: 6) MTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAE ATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS Rv2608 (SEQ ID NO: 7) MNFAVLPPEVNSARIFAGAGLGPMLAAASAWDGLAEELHAAAGSFASVTT GLAGDAWHGPASLAMTRAASPYVGWLNTAAAGQAAQAAGQARLAASAFEAT LAATVSPAMVAANRTRLASLVAANLLGQNAPAIAAAEAEYEQIWAQDVAA MFGYHSAASAVATQLAPIQEGLQQQLQNVLAQLASGNLGSGNVGVGNIGN DNIGNANIGFGNRGDANIGIGNIGDRNLGIGNTGNWNIGIGITGNGQIGF GKPANPDVLVVGNGGPGVTALVMGGTDSLLPLPNIPLLEYAARFITPVHP GYTATFLETPSQFFPFTGLNSLTYDVSVAQGVTNLHTAIMAQLAAGNEVV VFGTSQSATIATFEMRYLQSLPAHLRPGLDELSFTLTGNPNRPDGGILTR FGFSIPQLGFTLSGATPADAYPTVDYAFQYDGVNDFPKYPLNVFATANAI AGILFLHSGLIALPPDLASGVVQPVSSPDVLTTYILLPSQDLPLLVPLRA IPLLGNPLADLIQPDLRVLVELGYDRTAHQDVPSPFGLFPDVDWAEVAAD LQQGAVQGVNDALSGLGLPPPWQPALPRLF Rv3619 (SEQ ID NO: 8) MTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAAC QGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
Claims
1. 1. A spray-dried vaccine composition in the form of a dry powder comprising gel-microparticles comprising an effective amount of an antigen, an adjuvant, and a metabolizable oil, the metabolizable oil being present in an oil-in-water emulsion that is liquid at room temperature, and one or more excipients, wherein the particle size of the dry powder has a diameter of less than about 120 μm, the excipient is trehalose, the metabolizable oil is squalene, the adjuvant is glucopyranosyl lipid adjuvant (GLA), the squalene and the GLA form a GLA-squalene oil-in-water emulsion (GLA-SE), and the spray-dried vaccine composition exhibits colloidal stability as measured by the droplet size of the oil-in-water emulsion after reconstitution of the dry powder not being significantly different from the droplet size of the oil-in-water emulsion before spray drying.
2. 2. The spray-dried vaccine composition of claim 1, wherein the dry powder has a moisture content of about 2-3%.
3. 3. The spray-dried vaccine composition of claim 1 or 2, wherein the particles of the dry powder have a diameter of less than about 20 μm.
4. 4. The spray-dried vaccine composition of claim 3, wherein the particle size of the dry powder has a diameter of less than about 10 μm.
5. 5. The spray-dried vaccine composition of claim 4, wherein the particle size of the dry powder has a diameter of about 100 nm to 300 nm.
6. The spray-dried vaccine composition according to any one of claims 1 to 5, wherein the spray-dried vaccine composition is inhalable.
7. The spray-dried vaccine composition of any one of claims 1 to 6, wherein the adjuvant is a TLR4 agonist.
8. 8. The spray-dried vaccine composition of any one of claims 1 to 7, wherein the spray-dried vaccine composition is thermostable at a temperature of from about 8°C to about 60°C for at least 1 month, at least 3 months, at least 6 months, or at least 12 months.
9. The spray-dried vaccine composition of any one of claims 1 to 8, wherein the spray-dried vaccine composition maintains a stable nanoemulsion size after reconstitution.
10. 10. The spray-dried vaccine composition of claim 9, wherein the droplet size of the oil-in-water emulsion before spray drying and after reconstitution is about 100 nm.
11. 11. The spray dried vaccine composition of any one of claims 1 to 10, wherein the spray dried vaccine composition exhibits colloidal stability as measured by the polydispersity index (PDI) of the oil-in-water emulsion after reconstitution of the dry powder not being significantly different from the oil-in-water emulsion PDI before spray drying.
12. 12. The spray-dried vaccine composition of any one of claims 1 to 11, further comprising 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC), 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (POPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), dipalmitoylphosphatidylcholine (DSPC), egg PC, lecithin, Tween, or a combination thereof.
13. The spray-dried vaccine composition of any one of claims 1 to 12, wherein the antigen is a polypeptide, a nucleic acid encoding a polypeptide, or a pathogen.
14. A spray-dried vaccine composition according to any one of claims 1 to 13, further comprising a shell-forming agent.
15. 15. The spray-dried vaccine composition of claim 14, wherein the shell-based agent is a peptide, an amino acid, or leucine.
16. 1. A method for producing a heat-stable dry powder vaccine composition, comprising the step of spray-drying an oil-in-water emulsion in a spray dryer using an atomizing gas under process parameters such that the dry powder comprises gel-fine particles, to obtain a dry powder, wherein the oil-in-water emulsion comprises (1) an antigen, (2) a metabolizable oil that is liquid at room temperature, (3) one or more excipients, (4) an adjuvant, and (5) a shell-forming agent, wherein the metabolizable oil is squalene, the excipient is trehalose, and the adjuvant is glucopyranosyl lipid adjuvant (GLA), wherein the squalene and the GLA form a GLA-squalene oil-in-water emulsion (GLA-SE), and wherein the spray-dried vaccine composition exhibits colloidal stability as measured by the droplet size of the oil-in-water emulsion after reconstitution of the dry powder not being significantly different from the droplet size of the oil-in-water emulsion before spray drying.
17. 17. The method of claim 16, wherein the oil-in-water emulsion further comprises 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC), 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (POPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), egg PC, lecithin, Tween, or a combination thereof.
18. 18. The method of claim 16 or 17, wherein the process parameters include an atomization gas pressure of 10 psi, an atomization gas flow rate of 0.6 mL / min, and a drying gas flow rate of 200 SLPM.
19. 19. The method of any one of claims 16 to 18, wherein the process parameters include an outlet temperature of about 36°C.
20. The method of any one of claims 16 to 19, wherein the process parameters include an outlet humidity of about 7%.
21. The spray-dried vaccine composition of any one of claims 1 to 15, which is administered via inhalation or respiratory delivery.
22. 16. The spray-dried vaccine composition of any one of claims 1 to 15, wherein (1) the spray-dried vaccine is reconstituted with an aqueous diluent; and (2) the reconstituted dry powder vaccine is administered via a parenteral route.
23. A therapeutic agent for respiratory diseases, comprising the dry powder according to any one of claims 1 to 15, and administered by inhalation.
24. 24. The therapeutic agent according to claim 23, wherein the respiratory disease is tuberculosis (TB), influenza, respiratory syncytial virus infection (RSV), or lung cancer.
25. 10. The spray-dried vaccine composition of claim 9, wherein the spray-dried vaccine composition is stable at about 40°C for about 3 months.
Citation Information
Patent Citations
Single vial vaccine formulation
JP2017502962A