SARS-COV-2 t cell vaccines

Abstract

Some aspects of the disclosure relate to mRNA vaccines encoding chimeric proteins and variants thereof, including portions of coronavirus nucleocapsid (N), matrix (M), non- structural protein 3 (Nsp3), and / or Spike (S). Also provided are methods of using the vaccines.

Description

[0001] SARS-COV-2 T CELL VACCINES RELATED APPLICATIONS This application claims the benefit under 35 U.S.C. § 119(e) of U.S. Provisional Application No.63 / 509,650, filed June 22, 2023, and U.S. Provisional Application No. 63 / 58,2967, filed September 15, 2023, the contents of each of which are incorporated by reference herein in their entirety. REFERENCE TO AN ELECTRONIC SEQUENCE LISTING The contents of the electronic sequence listing (M137870281WO00-SEQ-NTJ.xml; Size: 232,186 bytes; and Date of Creation: June 18, 2024) are incorporated by reference herein in their entirety. BACKGROUND Human coronaviruses are highly contagious enveloped, positive-sense single-stranded RNA viruses of the Coronaviridae family. Two sub-families of Coronaviridae are known to cause human disease, the most important being the β-coronaviruses (betacoronaviruses). The β- coronaviruses are common etiological agents of mild to moderate upper respiratory tract infections. Outbreaks of novel coronavirus infections such as the infections caused by a coronavirus initially identified from the Chinese city of Wuhan in December 2019; however, have been associated with a high mortality rate. This recently identified coronavirus, referred to as Severe Acute Respiratory Syndrome Coronavirus 2 (SARS-CoV-2) (formerly referred to as a “2019 novel coronavirus,” or a “2019-nCoV”) has rapidly infected millions of people and caused a global pandemic. The pandemic disease that the SARS-CoV-2 virus causes has been named by World Health Organization (WHO) as COVID-19 (Coronavirus Disease 2019). The first genome sequence of a SARS-CoV-2 isolate (Wuhan-Hu-1; USA-WA1 / 2020 isolate) was released by investigators from the Chinese CDC in Beijing on January 10, 2020 at Virological, a UK-based discussion forum for analysis and interpretation of virus molecular evolution and epidemiology. The sequence was then deposited in GenBank on January 12, 2020, having Genbank Accession number MN908947.1. Subsequently, a number of SARS-CoV-2 strain variants have been identified, some of which are more infectious than the SARS-CoV-2 isolate. The emergence of SARS-CoV-2 variants with substitutions in the receptor binding domain (RBD) and N-terminal domain (NTD) of the viral S protein has raised concerns among scientists and health officials. The entry of coronavirus into host cells is mediated by interaction between the RBD of the viral S protein and host angiotensin-converting enzyme 2 (ACE2). Vaccine development has focused on inducing antibody responses against this region of SARS- CoV-2 S protein. More recently, a neutralization “supersite” has also been identified in the NTD. A significant decrease in vaccine efficacy has been correlated with amino acid substitutions in the RBD (eg, K417N, E484K, and N501Y) and NTD (eg, L18F, D80A, D215G, and Δ242-244) of the S protein. Some of the most recently circulating isolates containing these substitutions from the United Kingdom (B.1.1.7, Alpha), Republic of South Africa (B.1.351, Beta), Brazil (P.1 lineage, Gamma), New York (B.1.526, Iota), and California (B.1.427 / B.1.429 or CAL.20C lineage, Epsilon), have shown a reduction in neutralization from convalescent serum in pseudovirus neutralization (PsVN) assays and resistance to certain monoclonal antibodies. In particular, mutations in the NTD subdomain, and specifically the neutralization supersite, are most extensive in the B.1.351 lineage virus. See McCallum, M. et al. N-terminal domain antigenic mapping reveals a site of vulnerability for SARS-CoV-2. Cell, doi:10.1016 / j.cell.2021.03.028 (2021). Since the identification above the above isolates, Omicron BA.4 and BA.5 sub-variants were detected in samples from South Africa in January 2022 and February 2022, respectively. While BA.4 and BA.5 are two different Omicron sub-variants, they are usually discussed together for vaccine / immunization purposes, as they encode identical spike proteins. Early data from South Africa and genetic and epidemic surveillance in several countries indicated that BA.4 / BA.5 had substantial growth advantage over other SARS-CoV-2 circulating strains. This advantage was likely driven by new mutations in BA.4 / BA.5 spike that provided increased escape from pre-existing immunity in the populations acquired either via natural infection or vaccinations. In response, the European Centers for Disease Control and Prevention (ECDC) and the UK Health Security Agency (UKHSA) designated BA.4 / BA.5 as Variants of Concern (VOC) in May 2022. BA.5 became dominant variant in Portugal in May 2022, while BA.4 / BA.5 became dominant in the USA, France, UK, and Germany in June 2022. The recent emergence of SARS-CoV-2 variants (XBB.1.5 lineage; “Kraken”, and XBB.1.16 lineage, “Arcturus”) have raised concerns due to their increased rates of transmission and potential to circumvent immunity elicited by natural infection or vaccination. The XBB.1.5 variant (“Kraken”) is derived from the BA.2 Omicron subvariant and has increased apparent transmissibility compared to ancestral SARS-CoV-2 strains. The XBB.1.5 Spike protein includes 38 substitutions and 4 amino acid deletions, relative to the wild-type Spike protein sequence of the Wuhan-Hu-1 isolate. These substitutions include G252V and F486P. The XBB.1.16 variant (“Arcturus”) is derived from the BA.2 Omicron subvariant and includes 39 substitutions and 4 deletions in the Spike protein, relative to the wild-type Spike protein sequence of the Wuhan-Hu- 1 isolate. These substitutions include T478R, which increases viral infectivity. SUMMARY A monovalent SARS-CoV-2 Spike (S) protein-encoding mRNA vaccine (developed by Moderna Therapeutics) has been demonstrated to be highly efficacious in prevention of symptomatic COVID-19 disease and severe disease. However, T cell responses to SARS-CoV-2 antigens other than the S protein, such as the Nucleocapsid (N), Matrix (M), and Non-structural protein 3 (Nsp3) play important roles in anti-betacoronavirus immunity, including reducing the severity and duration of infections. Moreover, emerging SARS-CoV-2 variants (e.g., the XBB.1.5 lineage; “Kraken”, and XBB.1.16 lineage, “Arcturus”) frequently have altered Spike proteins that evade antibodies elicited by exposure to ancestral Spike proteins, such as through immunization or prior infection, but T cell epitopes in other proteins are more often conserved between variants and ancestral strains. Vaccination approaches for eliciting T cell responses to such non-Spike proteins, alone or in combination with approaches for generating anti-Spike antibodies, therefore allow robust immune responses that maintain anti-betacoronavirus immunity in the face of Spike protein evolution among circulating SARS-CoV-2 strains. Accordingly, some aspects relate to a composition comprising a lipid nanoparticle and a messenger RNA (mRNA) comprising an open reading frame encoding a SARS-CoV-2 chimeric protein comprising: a SARS-CoV-2 N protein portion; a SARS-CoV-2 NSP3 protein portion; and a SARS-CoV-2 M protein portion comprising one or more transmembrane domains. In some embodiments, the SARS-CoV-2 protein portion comprises a truncated or modified N-terminal domain of a full-length SARS-CoV-2 N protein and a C-terminal domain of the full-length SARS-CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104-143 of the full-length SARS- CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to the amino acids 43-87 of the full-length SARS-CoV-2 N protein. In some embodiments, the first and second N-terminal domain amino acid sequences are connected by a linker. In some embodiments, the linker is a glycine linker or a glycine-serine linker. In some embodiments, the SARS-CoV-2 N protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213-366 of the SARS-CoV-2 N protein. In some embodiments, the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO: 84. In some embodiments, the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO: 92. In some embodiments, the SARS-CoV-2 NSP3 protein portion comprises two or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein. In some embodiments, the SARS-CoV-2 NSP3 protein portion comprises 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein. In some embodiments, the CD8+ T cell epitopes occur in a different order in the SARS- CoV-2 NSP3 protein portion, relative to the order of the epitopes in a full-length SARS-CoV-2 NSPR3 protein. In some embodiments, one or more junctional epitopes present in a concatenated amino acid sequence consisting of two or more CD8+ T cell epitopes are not present in the SARS-CoV-2 NSP3 protein portion. In some embodiments, the full-length SARS-CoV-2 NSP3 protein comprises the amino acid sequence of SEQ ID NO: 85. In some embodiments, the SARS-CoV-2 NSP3 protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 93. In some embodiments, the SARS-CoV-2 protein portion does not comprise an N-terminal glycosylation site, relative to a full-length SARS-CoV-2 M protein. In some embodiments, the SARS-CoV-2 M protein portion comprises, in N-to-C terminal order, one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and a β- sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 96. In some embodiments, the SARS-CoV-2 M protein portion comprises, in N-to-C terminal order, a β-sheet domain of a full-length SARS-CoV-2 M protein, and one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the β-sheet domain is connected to one or more transmembrane domains by a linker. In some embodiments, the linker is a glycine or glycine-serine linker. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 97. In some embodiments, the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO: 86. In some embodiments, two or more of the N protein portion, the NSP3 protein portion, and the M protein portion are separated by a linker. In some embodiments, the N protein portion and the NSP3 protein portion are separated by a first linker, and / or the NSP3 protein portion and the M protein portion are separated by a second linker. In some embodiments, the N protein portion and the M protein portion are separated by a first linker, and / or the M protein portion and the NSP3 protein portion are separated by a second linker. In some embodiments the M protein portion and the N protein portion are separated by a first linker, and / or the N protein portion and the NSP3 protein portion are separated by a second linker. In some embodiments, each of the first and second linkers is a glycine or glycine-serine linker. In some embodiments, each of the first and second linkers comprises the amino acid sequence AAY. In some embodiments, the SARS-CoV-2 chimeric protein further comprises a signal peptide. In some embodiments, the signal peptide comprises an influenza A virus hemagglutinin (HA) signal peptide. Some aspects relate to a composition comprising a lipid nanoparticle and an mRNA comprising an open reading frame encoding a SARS-COV-2 chimeric protein comprising: a SARS-CoV-2 S protein portion; and a SARS-CoV-2 N protein portion; and a transmembrane portion comprising a transmembrane domain. In some embodiments, the SARS-CoV-2 protein portion comprises a truncated or modified N-terminal domain of a SARS-CoV-2 N protein and a C-terminal domain of the SARS- CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104-143 of a full-length SARS-CoV- 2 N protein. In some embodiments, the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to amino acids 43-87 of the full- length SARS-CoV-2 N protein. In some embodiments, the first and second N-terminal domain amino acid sequences are connected by a linker. In some embodiments, the linker is a glycine or glycine-serine linker. In some embodiments, the SARS-CoV-2 protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213-366 of the full-length SARS-CoV-2 N protein. In some embodiments, the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO: 84. In some embodiments, the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO: 92. In some embodiments, the transmembrane portion comprises an influenza HA transmembrane domain. In some embodiments, the transmembrane portion comprises a SARS-CoV-2 M protein portion comprising one or more transmembrane domains of a full-length SARS-CoV-2 M protein. In some embodiments, the SARS-CoV-2 M protein portion does not comprise an N- terminal glycosylation site, relative to a full-length SARS-CoV-2 M protein. In some embodiments, the SARS-CoV-2 protein portion comprises, in N-to-C terminal order, one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and a β- sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 96. In some embodiments, the SARS-CoV-2 M protein portion comprises, in N-to-C terminal order, a β-sheet domain of a full-length SARS-CoV-2 M protein, and one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the β-sheet domain is connected to one or more transmembrane domains by a linker. In some embodiments, the linker is a glycine or a glycine-serine linker. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 97. In some embodiments, the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO: 86. In some embodiments, the SARS-CoV-2 N protein portion is C-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the SARS-CoV-2 N protein portion is N-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is extracellular when the SARS-CoV-2 chimeric protein is expressed. In some embodiments, the SARS-CoV-2 N protein portion and the transmembrane portion are connected by a linker. In some embodiments, the linker is a glycine linker or a glycine-serine linker. In some embodiments, the SARS-CoV-2 S protein portion comprises an N-terminal domain (NTD) and a receptor-binding domain (RBD) of a full-length SARS-CoV-2 S protein. In some embodiments, the NTD corresponds to amino acids 1-290 of the full-length SARS-CoV-2 S protein, and / or the RBD corresponds to amino acids 316-517 of the full-length SARS-CoV-2 S protein. In some embodiments, the full-length SARS-CoV-2 S protein is a BA.4 or BA.5 lineage S protein. In some embodiments, the full-length SARS-CoV-2 S protein is a Wuhan-Hu-1 lineage S protein. In some embodiments, the full-length SARS-CoV-2 S protein comprises the amino acid sequence of SEQ ID NO: 87. In some embodiments, the S protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 98. In some embodiments, two or more of the S protein portion, the N protein portion, and the transmembrane portion are separated by a linker. In some embodiments, the S protein portion and the N protein portion are separated by a first linker and / or the N protein portion and the transmembrane portion are separated by a second linker. In some embodiments, the S protein portion and the transmembrane portion are separated by a first linker, and / or the transmembrane portion and the N protein portion are separated by a second linker. In some embodiments, each of the first and second linkers is a glycine or a glycine-serine linker. In some embodiments, each of the first and second linkers comprises the amino acid sequence AAY. Some aspects relate to a composition comprising a lipid nanoparticle and a messenger ribonucleic acid comprising an open reading frame (ORF) encoding a protein comprising an amino acid sequence with at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 101–124 or 170–183. In some embodiments, the mRNA comprises a 5′ untranslated region (UTR), wherein the 5′ UTR comprises a nucleotide sequence with at least 90% sequence identity to a nucleotide sequence selected from SEQ ID NOs: 1, 2, 5–35, 66, 70–72, 75, 76, and 81. In some embodiments, the 5′ UTR comprises a nucleotide sequence selected from SEQ ID NOs: 1, 2, 5– 35, 66, 70–72, 75, 76, and 81. In some embodiments, the mRNA comprises a 3′ untranslated region (UTR), wherein the 5′ UTR comprises a nucleotide sequence with at least 90% sequence identity to a nucleotide sequence selected from SEQ ID NOs: 3–4, 36–44, 68, 69, 73, 74, 77–79, and 82. In some embodiments, the 3′ UTR comprises a nucleotide sequence selected from SEQ ID NOs: 3–4, 36– 44, 68, 69, 73, 74, 77–79, and 82. In some embodiments, the mRNA comprises one or more stop codons immediately downstream from the open reading frame. In some embodiments, the one or more stop codons comprise the nucleotide sequence UGAUGA. In some embodiments, the one or more stop codons comprise the nucleotide sequence UGAUAAUAG. In some embodiments, the mRNA comprises a polyadenosine (polyA) sequence comprising 20 or more consecutive adenosine nucleotides. In some embodiments, the polyA sequence comprises 100 consecutive adenosine nucleotides. In some embodiments, the polyA sequence comprises, in 5′-to-3′ order, a first nucleotide sequence comprising 30 consecutive adenosine nucleotides, an intervening sequence comprising no more than three adenosine nucleotides, and a second nucleotide sequence comprising 70 consecutive adenosine nucleotides. In some embodiments, the polyA sequence comprises the nucleotide sequence of SEQ ID NO: 80. In some embodiments, the mRNA further comprises a polycytidine (polyC) sequence comprising 20 or more consecutive cytidine nucleotides. In some embodiments, the polyC sequence comprises 30 consecutive cytidine nucleotides. In some embodiments, the polyC sequence is downstream from the polyA sequence, wherein the polyA sequence comprises 64 consecutive adenosine nucleotides. In some embodiments, the polyA sequence comprises 109 consecutive adenosine nucleotides. In some embodiments, the mRNA comprises a 5’ cap analog. In some embodiments, the 5’ cap analog comprises a 7mG(5’)ppp(5’)NlmpNp cap. In some embodiments, the lipid nanoparticle comprises 40-55 mol% ionizable amino lipid, 30-45 mol% sterol, 5-15 mol% neutral lipid, and 1-5 mol% PEG-modified lipid. In some embodiments, the ionizable amino lipid comprises a compound of Formula (I): R1is R”M’R’ or C5-20alkenyl; R2 and R3 are each independently selected from C1-14 alkyl and C2-14 alkenyl; R4is (CH2)nQ, wherein Q is OH and n is selected from 3, 4, and 5; M and M’ are each independently -OC(O)- or -C(O)O; R5, R6, and R7 are each H; R’ is a linear C1-12 alkyl, or C1-12 alkyl substituted with C6-9 alkyl; R” is C3-14alkyl; m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13. In some embodiments, the ionizable amino lipid comprises Compound 1: (Compound 1). In some embodiments, the ionizable amino lipid comprises a compound of the structure A7: (A7). In some embodiments, the neutral lipid is 1,2 distearoyl-sn-glycero-3-phosphocholine (DSPC). In some embodiments, the sterol is cholesterol. In some embodiments, the PEG-modified lipid is PEG2000-DMG. In some embodiments, the open reading frame comprises one or more chemically modified nucleotides. In some embodiments, the open reading frame comprises N1-methylpseudouridine. In some embodiments, at least 80% of uracil nucleotides in the open reading frame comprise N1- methylpseudouridine. In some embodiments, 100% of uracil nucleotides in the open reading frame comprise N1-methylpseudouridine. In some embodiments, the open reading frame comprises 5-methylcytidine. In some embodiments, at least 80% of cytosine nucleotides in the open reading frame comprise 5- methylcytidine. In some embodiments, 100% of cytosine nucleotides in the open reading frame comprise 5-methylcytidine. In some embodiments, the open reading frame comprises 5-methyluridine. In some embodiments, at least 80% of uracil nucleotides in the open reading frame comprise 5- methyluridine. In some embodiments, 100% of uracil nucleotides in the open reading frame comprise 5-methyluridine. Some aspects relate to a pharmaceutical composition comprising an mRNA and a pharmaceutically acceptable excipient. Some aspects relate to a method comprising administering to a subject a composition. In some embodiments, the composition is administered intramuscularly. In some embodiments, the composition is effective to induce, in the subject, CD4+ and / or CD8+ T cells specific to one or more epitopes of the protein. In some embodiments, the method comprises administering a first dose and a second dose of the composition. Some aspects relate to a SARS-CoV-2 chimeric protein comprising a SARS-CoV-2 N protein portion; a SARS-CoV-2 NSP3 protein portion; and a SARS-CoV-2 M protein portion comprising one or more transmembrane domains. In some embodiments, the SARS-CoV-2 protein portion comprises a truncated or modified N-terminal domain of a full-length SARS-CoV-2 N protein and a C-terminal domain of the full-length SARS-CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104-143 of the full-length SARS- CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to the amino acids 43-87 of the full-length SARS-CoV-2 N protein. In some embodiments, the first and second N-terminal domain amino acid sequences are connected by a linker. In some embodiments, the linker is a glycine linker or a glycine-serine linker. In some embodiments, the SARS-CoV-2 N protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213-366 of the SARS-CoV-2 N protein. In some embodiments, the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO: 84. In some embodiments, the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO: 92. In some embodiments, the SARS-CoV-2 NSP3 protein portion comprises two or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein. In some embodiments, the SARS-CoV-2 NSP3 protein portion comprises 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein. In some embodiments, the CD8+ T cell epitopes occur in a different order in the SARS- CoV-2 NSP3 protein portion, relative to the order of the epitopes in a full-length wild-type SARS-CoV-2 NSPR3 protein. In some embodiments, one or more junctional epitopes present in a concatenated amino acid sequence consisting of two or more CD8+ T cell epitopes are not present in the SARS-CoV-2 NSP3 protein portion. In some embodiments, the full-length SARS-CoV-2 NSP3 protein comprises the amino acid sequence of SEQ ID NO: 85. In some embodiments, the SARS-CoV-2 NSP3 protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 93. In some embodiments, the SARS-CoV-2 protein portion does not comprise an N-terminal glycosylation site, relative to a full-length wild-type SARS-CoV-2 M protein. In some embodiments, the SARS-CoV-2 M protein portion comprises, in N-to-C terminal order, one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and a β- sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 96. In some embodiments, the SARS-CoV-2 M protein portion comprises, in N-to-C terminal order, a β-sheet domain of a full-length SARS-CoV-2 M protein, and one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the β-sheet domain is connected to one or more transmembrane domains by a linker. In some embodiments, the linker is a glycine or glycine-serine linker. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 97. In some embodiments, the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO: 86. In some embodiments, two or more of the N protein portion, the NSP3 protein portion, and the M protein portion are separated by a linker. In some embodiments, the N protein portion and the NSP3 protein portion are separated by a first linker, and / or the NSP3 protein portion and the M protein portion are separated by a second linker. In some embodiments, the N protein portion and the M protein portion are separated by a first linker, and / or the M protein portion and the NSP3 protein portion are separated by a second linker. In some embodiments the M protein portion and the N protein portion are separated by a first linker, and / or the N protein portion and the NSP3 protein portion are separated by a second linker. In some embodiments, each of the first and second linkers is a glycine or glycine-serine linker. In some embodiments, each of the first and second linkers comprises the amino acid sequence AAY. In some embodiments, the SARS-CoV-2 chimeric protein further comprises a signal peptide. In some embodiments, the signal peptide comprises an influenza A virus hemagglutinin (HA) signal peptide. Some aspects relate to a SARS-COV-2 chimeric protein comprising: a SARS-CoV-2 S protein portion; and a SARS-CoV-2 N protein portion; and a transmembrane portion comprising a transmembrane domain. In some embodiments, the SARS-CoV-2 protein portion comprises a truncated or modified N-terminal domain of a SARS-CoV-2 N protein and a C-terminal domain of the SARS- CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104-143 of a full-length SARS-CoV- 2 N protein. In some embodiments, the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to amino acids 43-87 of the full- length SARS-CoV-2 N protein. In some embodiments, the first and second N-terminal domain amino acid sequences are connected by a linker. In some embodiments, the linker is a glycine or glycine-serine linker. In some embodiments, the SARS-CoV-2 protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213-366 of the full-length wild-type SARS- CoV-2 N protein. In some embodiments, the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO: 84. In some embodiments, the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO: 92. In some embodiments, the transmembrane portion comprises an influenza HA transmembrane domain. In some embodiments, the transmembrane portion comprises a SARS-CoV-2 M protein portion comprising one or more transmembrane domains of a full-length SARS-CoV-2 M protein. In some embodiments, the SARS-CoV-2 M protein portion does not comprise an N- terminal glycosylation site, relative to a full-length wild-type SARS-CoV-2 M protein. In some embodiments, the SARS-CoV-2 protein portion comprises, in N-to-C terminal order, one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and a β- sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 96. In some embodiments, the SARS-CoV-2 M protein portion comprises, in N-to-C terminal order, a β-sheet domain of a full-length SARS-CoV-2 M protein, and one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the β-sheet domain is connected to one or more transmembrane domains by a linker. In some embodiments, the linker is a glycine or a glycine-serine linker. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 97. In some embodiments, the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO: 86. In some embodiments, the SARS-CoV-2 N protein portion is C-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the SARS-CoV-2 N protein portion is N-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is extracellular when the SARS-CoV-2 chimeric protein is expressed. In some embodiments, the SARS-CoV-2 N protein portion and the transmembrane portion are connected by a linker. In some embodiments, the linker is a glycine linker or a glycine-serine linker. In some embodiments, the SARS-CoV-2 S protein portion comprises an N-terminal domain (NTD) and a receptor-binding domain (RBD) of a full-length SARS-CoV-2 S protein. In some embodiments, the NTD corresponds to amino acids 1-290 of the full-length SARS-CoV-2 S protein, and / or the RBD corresponds to amino acids 316-517 of the full-length SARS-CoV-2 S protein. In some embodiments, the full-length SARS-CoV-2 S protein is a BA.4 or BA.5 lineage S protein. In some embodiments, the full-length SARS-CoV-2 S protein is a Wuhan-Hu-1 lineage S protein. In some embodiments, the full-length SARS-CoV-2 S protein comprises the amino acid sequence of SEQ ID NO: 87. In some embodiments, the S protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 98. In some embodiments, two or more of the S protein portion, the N protein portion, and the transmembrane portion are separated by a linker. In some embodiments, the S protein portion and the N protein portion are separated by a first linker and / or the N protein portion and the transmembrane portion are separated by a second linker. In some embodiments, the S protein portion and the transmembrane portion are separated by a first linker, and / or the transmembrane portion and the N protein portion are separated by a second linker. In some embodiments, each of the first and second linkers is a glycine or a glycine-serine linker. In some embodiments, each of the first and second linkers comprises the amino acid sequence AAY. Some aspects relate to a SARS-CoV-2 chimeric protein comprising an amino acid sequence with at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 101–124 or 170–183. In some embodiments, an mRNA comprising an ORF encodes any one of the proteins. In some embodiments, an mRNA comprises an ORF encoding the SARS-CoV-2 chimeric protein. In some embodiments, the mRNA comprises a chemical modification. In some embodiments, 100% of the uracil nucleotides of the mRNA comprise a chemical modification. In some embodiments, 100% of the uracil nucleotides of the mRNA comprise N1- methylpseudouridine. Some aspects relate to a composition comprising a self-amplifying RNA encoding a SARS-CoV-2 chimeric protein comprising a SARS-CoV-2 N protein portion; a SARS-CoV-2 NSP3 protein portion; and a SARS-CoV-2 M protein portion comprising one or more transmembrane domains. In some embodiments, the SARS-CoV-2 protein portion comprises a truncated or modified N-terminal domain of a full-length SARS-CoV-2 N protein and a C-terminal domain of the full-length SARS-CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104-143 of the full-length SARS- CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to the amino acids 43-87 of the full-length SARS-CoV-2 N protein. In some embodiments, the first and second N-terminal domain amino acid sequences are connected by a linker. In some embodiments, the linker is a glycine linker or a glycine-serine linker. In some embodiments, the SARS-CoV-2 N protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213-366 of the SARS-CoV-2 N protein. In some embodiments, the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO: 84. In some embodiments, the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO: 92. In some embodiments, the SARS-CoV-2 NSP3 protein portion comprises two or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein. In some embodiments, the SARS-CoV-2 NSP3 protein portion comprises 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein. In some embodiments, the CD8+ T cell epitopes occur in a different order in the SARS- CoV-2 NSP3 protein portion, relative to the order of the epitopes in a full-length SARS-CoV-2 NSPR3 protein. In some embodiments, one or more junctional epitopes present in a concatenated amino acid sequence consisting of two or more CD8+ T cell epitopes are not present in the SARS-CoV-2 NSP3 protein portion. In some embodiments, the full-length SARS-CoV-2 NSP3 protein comprises the amino acid sequence of SEQ ID NO: 85. In some embodiments, the SARS-CoV-2 NSP3 protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 93. In some embodiments, the SARS-CoV-2 protein portion does not comprise an N-terminal glycosylation site, relative to a full-length SARS-CoV-2 M protein. In some embodiments, the SARS-CoV-2 M protein portion comprises, in N-to-C terminal order, one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and a β- sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 96. In some embodiments, the SARS-CoV-2 M protein portion comprises, in N-to-C terminal order, a β-sheet domain of a full-length SARS-CoV-2 M protein, and one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the β-sheet domain is connected to one or more transmembrane domains by a linker. In some embodiments, the linker is a glycine or glycine-serine linker. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 97. In some embodiments, the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO: 86. In some embodiments, two or more of the N protein portion, the NSP3 protein portion, and the M protein portion are separated by a linker. In some embodiments, the N protein portion and the NSP3 protein portion are separated by a first linker, and / or the NSP3 protein portion and the M protein portion are separated by a second linker. In some embodiments, the N protein portion and the M protein portion are separated by a first linker, and / or the M protein portion and the NSP3 protein portion are separated by a second linker. In some embodiments the M protein portion and the N protein portion are separated by a first linker, and / or the N protein portion and the NSP3 protein portion are separated by a second linker. In some embodiments, each of the first and second linkers is a glycine or glycine-serine linker. In some embodiments, each of the first and second linkers comprises the amino acid sequence AAY. In some embodiments, the SARS-CoV-2 chimeric protein further comprises a signal peptide. In some embodiments, the signal peptide comprises an influenza A virus hemagglutinin (HA) signal peptide. Some aspects relate to a composition comprising a self-amplifying RNA encoding a SARS-CoV-2 chimeric protein comprising: a SARS-CoV-2 S protein portion; and a SARS-CoV- 2 N protein portion; and a transmembrane portion comprising a transmembrane domain. In some embodiments, the SARS-CoV-2 protein portion comprises a truncated or modified N-terminal domain of a SARS-CoV-2 N protein and a C-terminal domain of the SARS- CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein. In some embodiments, the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104-143 of a full-length SARS-CoV- 2 N protein. In some embodiments, the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to amino acids 43-87 of the full- length SARS-CoV-2 N protein. In some embodiments, the first and second N-terminal domain amino acid sequences are connected by a linker. In some embodiments, the linker is a glycine or glycine-serine linker. In some embodiments, the SARS-CoV-2 protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213-366 of the full-length SARS-CoV-2 N protein. In some embodiments, the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO: 84. In some embodiments, the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO: 92. In some embodiments, the transmembrane portion comprises an influenza HA transmembrane domain. In some embodiments, the transmembrane portion comprises a SARS-CoV-2 M protein portion comprising one or more transmembrane domains of a full-length SARS-CoV-2 M protein. In some embodiments, the SARS-CoV-2 M protein portion does not comprise an N- terminal glycosylation site, relative to a full-length SARS-CoV-2 M protein. In some embodiments, the SARS-CoV-2 protein portion comprises, in N-to-C terminal order, one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and a β- sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 96. In some embodiments, the SARS-CoV-2 M protein portion comprises, in N-to-C terminal order, a β-sheet domain of a full-length SARS-CoV-2 M protein, and one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the β-sheet domain is connected to one or more transmembrane domains by a linker. In some embodiments, the linker is a glycine or a glycine-serine linker. In some embodiments, the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 97. In some embodiments, the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO: 86. In some embodiments, the SARS-CoV-2 N protein portion is C-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell. In some embodiments, the SARS-CoV-2 N protein portion is N-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is extracellular when the SARS-CoV-2 chimeric protein is expressed. In some embodiments, the SARS-CoV-2 N protein portion and the transmembrane portion are connected by a linker. In some embodiments, the linker is a glycine linker or a glycine-serine linker. In some embodiments, the SARS-CoV-2 S protein portion comprises an N-terminal domain (NTD) and a receptor-binding domain (RBD) of a full-length SARS-CoV-2 S protein. In some embodiments, the NTD corresponds to amino acids 1-290 of the full-length SARS-CoV-2 S protein, and / or the RBD corresponds to amino acids 316-517 of the full-length SARS-CoV-2 S protein. In some embodiments, the full-length SARS-CoV-2 S protein is a BA.4 or BA.5 lineage S protein. In some embodiments, the full-length SARS-CoV-2 S protein is a Wuhan-Hu-1 lineage S protein. In some embodiments, the full-length SARS-CoV-2 S protein comprises the amino acid sequence of SEQ ID NO: 87. In some embodiments, the S protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 98. In some embodiments, two or more of the S protein portion, the N protein portion, and the transmembrane portion are separated by a linker. In some embodiments, the S protein portion and the N protein portion are separated by a first linker and / or the N protein portion and the transmembrane portion are separated by a second linker. In some embodiments, the S protein portion and the transmembrane portion are separated by a first linker, and / or the transmembrane portion and the N protein portion are separated by a second linker. In some embodiments, each of the first and second linkers is a glycine or a glycine-serine linker. In some embodiments, each of the first and second linkers comprises the amino acid sequence AAY. BRIEF DESCRIPTION OF THE DRAWINGS FIG.1 is a schematic of T cell composite vaccine designs. N / M / Nsp3 composite vaccine designs are shown on top, either with or without a signal peptide (SP), with two possible compositions of nucleocapsid (N) protein sequences, six non-structural protein 3 (Nsp3) epitopes, and either a full-length or truncated membrane (M) protein sequence. Segments of this composite are either not linked or are linked with an AAY linker (cleavable) or a GGSGG (SEQ ID NO: 99) linker (non-cleavable). NTD-RBD / N / M composite vaccine designs are shown on the bottom, with a spike (S) protein N terminal domain (NTD) and receptor binding domain (RBD), two possible compositions of N protein sequences, and three possible compositions of M protein sequences (HA-TM, full-length M protein, or truncated M protein). Segments of this composite are linked with a GGSGG (SEQ ID NO: 99) linker. FIG.2 represents the prediction methods underlying the design of the N protein antigens used in the vaccine composites shown in FIG.1. Shown in the bottom line graph is the N protein sequence with areas of immunogenicity; the top line graph illustrates the conservation of the N protein sequence across sarbecoviruses. Graphs in between represent the coverage of CD4+ and CD8+ TCRs, indicating immunogenic epitopes within the N protein sequence. FIG.3A-3C relate to the sequence and structure of the N protein. FIG.3A is a schematic of the regions of the N protein, including the N-terminal arm (N-arm); the N-terminal domain (NTD), which contains the RNA-binding sequence; the linker region (LKR) containing serine and arginine-rich (SR) motifs; the C-terminal domain (CTD), which contains a sequence associated with RNA-binding and oligomerization; and the C-terminal tail (C-tail). FIG.3B shows the protein structures of the RNA-binding residues of the N protein. The circle in the structure on the right highlights the N protein basic loop, which contains at least 7 residues that are removed in the N protein compositions included in the vaccine designs. FIG.3C iterates the designs of the N protein sequences used in the vaccine compositions. The design on the top contains residues 104-143 and 213-366 of the N protein, while the design on the bottom also includes residues 43-87 and a linker, preserving most of the NTD domain. FIG.4 represents the prediction methods underlying the design of the M protein antigens used in the vaccine composites shown in FIG.1. Shown in the bottom line graph is the M protein sequence with areas of immunogenicity; the top line graph illustrates the conservation of the N protein sequence across sarbecoviruses. Graphs in between represent the coverage of CD4+ and CD8+ TCRs, indicating immunogenic epitopes within the N protein sequence. FIG.5 iterates designs of M protein sequences used in vaccine compositions. The design on the top is the full-length M protein, while the design on the bottom is a truncated M protein containing the β-sheet domain and residues 6-104. FIG.6A-6B illustrate the junctional epitopes that arise from the concatenation of Nsp3 epitopes in two different configurations. FIG.6A includes a schematic of the concatenation of Nsp3 epitopes in the order of epitopes 1-6 (amino acid sequences for each epitope are shown below the epitope names) and the resulting junctional epitopes upon various epitope pairings. The world population coverage of HLAs that are capable of presenting the antigens of the junctional epitopes are shown as a percent in the “World Pop. Cov.” columns. The bolded and underlined junctional epitope that results from the combination of Nsp3-E3 and Nsp3-E4 is similarly matched to human proteins. FIG.6B shows the minimization of junctional epitopes that result from a concatenation of Nsp3 epitopes in a different configuration: Nsp3-E6---Nsp3- E2---Nsp3-E1---Nsp3-E4---Nsp3-E5---Nsp3-E3. Junctional epitopes result from three of these pairings, the sequences for which are shown in “MHC-I Junctional Epitopes.” The world population coverage of HLAs that are capable of presenting the resultant antigens is shown in the “World Pop. Cov.” column. DETAILED DESCRIPTION SARS-CoV-2 The genome of SARS-CoV-2 is a single-stranded positive-sense RNA (+ssRNA) with the size of 29.8–30 kb encoding about 9860 amino acids (Chan et al.2000, supra; Kim et al.2020 Cell, May 14; 181(4):914-921.e10.). The SARS-CoV-2 genome is organized into specific genes encoding structural proteins and nonstructural proteins (Nsps). The order of the structural proteins in the genome is 5′-replicase (open reading frame (ORF)1 / ab)-structural proteins [Spike (S)-Envelope (E)-Membrane (M)-Nucleocapsid (N)]-3′. The genome of coronaviruses includes a variable number of open reading frames that encode accessory proteins, nonstructural proteins, and structural proteins (Song et al.2019 Viruses;11(1):p.59). Most of the antigenic peptides are located in the structural proteins (Cui et al.2019 Nat. Rev. Microbiol., 17(3):181–192). Spike surface glycoprotein (S), a small envelope protein (E), matrix protein (M), and nucleocapsid protein (N) are four main structural proteins. Since S-protein contributes to cell tropism and virus entry and also induces neutralizing antibodies (NAb) and protective immunity, it can be considered one of the most important targets in coronavirus vaccine development among all other structural proteins. Moreover, amino acid sequence analysis has shown that S-protein contains conserved regions among the coronaviruses, which may be the basis for universal vaccine development. SARS-CoV-2 Proteins Some aspects relate to compositions comprising nucleic acids (e.g., mRNAs) encoding proteins of interest, e.g., a protein derived from one or more betacoronavirus proteins such as a SARS-CoV-2 nucleocapsid (N), matrix (M), non-structural protein 3 (nsp3), and / or spike (S) protein. Such compositions do not comprise antigens per se, but rather comprise nucleic acids, in particular, mRNA(s) that encode antigens or antigenic sequences once delivered to a cell, tissue or subject. Delivery of nucleic acids, in particular mRNA(s), is achieved by inclusion of nucleic acids in appropriate carriers or delivery vehicles (e.g., lipid nanoparticles) such that upon administration to cells, tissues or subjects, nucleic acid is taken up by cells which, in turn, express protein(s) encoded by the nucleic acids, e.g., mRNAs. Antigens, as used herein, are proteins capable of inducing an immune response (e.g., causing an immune system to produce antibodies against the antigens). The vaccines provide a unique advantage over traditional protein-based vaccination approaches, in which protein antigens are purified or produced in vitro, e.g., recombinant protein production technologies. The vaccines feature RNA (e.g., mRNA) encoding the desired antigens, which when introduced into the body, i.e., administered to a mammalian subject (for example a human) in vivo, cause the cells of the body to express the desired antigens. To facilitate delivery of the mRNAs to the cells of the body, the mRNAs are encapsulated in lipid nanoparticles (LNPs). Upon delivery and uptake by cells of the body, the mRNAs are translated in the cytosol and protein antigens are generated by the host cell machinery. The protein antigens are presented and elicit an adaptive humoral and cellular immune response. Neutralizing antibodies are directed against the expressed protein antigens and hence the protein antigens are considered relevant target antigens for vaccine development. Herein, use of the term “antigen” encompasses immunogenic proteins and immunogenic fragments (an immunogenic fragment that induces (or is capable of inducing) an immune response to a (at least one) SARS-CoV-2 variant), unless otherwise stated. It should be understood that the term “protein” encompasses peptides and the term “antigen” encompasses antigenic fragments. Other molecules may be antigenic such as bacterial polysaccharides or combinations of protein and polysaccharide structures, but for the viral vaccines included herein, viral proteins, fragments of viral proteins and designed and or mutated proteins derived from SARS-CoV-2 are the antigens. Many proteins have a quaternary or three-dimensional structure, which consists of more than one polypeptide or several polypeptide chains that associate into an oligomeric molecule. As used herein the term “subunit” refers to a single protein molecule, for example, a polypeptide or polypeptide chain resulting from processing of a nascent protein molecule, which subunit assembles (or “coassembles”) with other protein molecules (e.g., subunits or chains) to form a protein complex. Proteins can have a relatively small number of subunits and therefore be described as “oligomeric” or can consist of a large number of subunits and therefore be described as “multimeric”. The subunits of an oligomeric or multimeric protein may be identical, homologous or totally dissimilar and dedicated to disparate tasks. Proteins or protein subunits can further comprise domains. As used herein, the term “domain” refers to a distinct functional and / or structural unit within a protein. Typically, a “domain” is responsible for a particular function or interaction, contributing to the overall role of a protein. Domains can exist in a variety of biological contexts. Similar domains (i.e., domains sharing structural, functional and / or sequence homology) can exist within a single protein or can exist within distinct proteins having similar or different functions. A protein domain is often a conserved part of a given protein tertiary structure or sequence that can function and exist independently of the rest of the protein or subunit thereof. In structural and molecular biology, identical, homologous or similar subunits or domains can help to classify newly identified or novel proteins, as was done immediately upon publication of the SARS-CoV-2 viral genomic sequence. As used herein, the term antigen is distinct from the term “epitope” which is a substructure of an antigen, e.g., a polypeptide, such as 7-10 amino acids, or carbohydrate structure, which may be recognized by an antigen binding site. The art describes protein antigens that are delivered to subjects or immune cells in isolated form, e.g., isolated protein, polypeptide or peptide antigens, however, the design, testing, validation, and production of protein antigens can be costly and time-consuming, especially when producing proteins at large scale. By contrast, mRNA technology is amenable to rapid design and testing of mRNA constructs encoding a variety of antigens. Moreover, rapid production of mRNA coupled with inclusion in appropriate delivery vehicles (e.g., lipid nanoparticles), can proceed quickly and can rapidly produce mRNA vaccines at large scale. Potential benefit also arises from the fact that antigens encoded by the mRNAs are expressed by the cells of the subject, e.g., are expressed by the human body, and thus the subject, e.g., the human body, serves as the “factory” to produce the antigens which, in turn, elicit the desired immune response. The compositions may include an RNA or multiple RNAs encoding two or more antigens of the same or different viral strains. Vaccines may be combination vaccines that include RNA encoding one or more coronavirus antigens and one or more antigen(s) of a different organism. Thus, the vaccines may be combination vaccines that target one or more antigens of the same strain / species, or one or more antigens of different strains / species, e.g., antigens which induce immunity to organisms which are found in the same geographic areas where the risk of coronavirus infection is high or organisms to which an individual is likely to be exposed to when exposed to a coronavirus (e.g., COVID-19). In some embodiments, the second or subsequent circulating SARS-CoV-2 antigen is an immunodominant antigen from an emerging strain. An immunodominant antigen of an emerging strain is assessed with respect to the strain from which the antigen is derived, relative to a different strain of the virus, such as the original strain or other variant thereof. An immunodominant antigen of the emerging strain induces a stronger immune response against the emerging strain than against the different strain. In some embodiments, an immunodominant antigen of the emerging strain is more infective than a different strain of the virus, such as the original strain or other variant thereof. Nucleocapsid (N) Proteins and Portions Some aspects relate to proteins comprising a nucleocapsid (N) portion and / or RNAs encoding the same. The nucleocapsid of the SARS-CoV-2 virus plays an essential role in its replication and assembly and is highly conserved among SARS-CoV-2 variants. It contains the N protein, which protein forms oligomers and assembles around the viral RNA in a helical arrangement, resulting in the formation of the viral ribonucleoprotein (vRNP) complex. This complex is essential for protecting the viral genome and facilitating its packaging into new viral particles during viral assembly. Structurally, the N protein includes two domains: the N-terminal domain (NTD) and the C-terminal domain (CTD), connected by a linking region. The NTD is involved in RNA binding and oligomerization, while the CTD is responsible for protein-protein interactions, including interactions with other viral proteins and host factors. The N protein is predominantly intracellular but can be released from cells during active viral replication following cell lysis or by active secretion mechanisms. The N protein is highly immunogenic, containing many epitopes, including CD8+ and CD4+ T cell epitopes, a large number of which are conserved between emerging variants and ancestral lineages. In some embodiments, an mRNA encodes a protein comprising a SARS-CoV-2 nucleocapsid (N) protein portion. In some embodiments, a protein comprises a SARS-CoV-2 nucleocapsid (N) protein portion. N protein portions may contain a truncation or deletion of one or more regions, relative to a full-length or naturally occurring N protein, that are sparse in CD4+ and / or CD8+ T cell epitopes, thereby increasing the epitope density of the N protein portion compared to a full-length N protein. In some embodiments, an N protein portion comprises a higher density or CD4+ T cell epitopes than a wild-type SARS-CoV-2 N protein. In some embodiments, an N protein portion comprises a higher density or CD8+ T cell epitopes than a wild-type SARS-CoV-2 N protein. N protein portions may also be modified to remove or disrupt a functional region of full- length N protein to improve safety or immunogenicity. For example, an N protein portion may lack one or more amino acids of an RNA-binding domain. In some embodiments, the N protein portion has a truncation in, or a deletion of, a basic loop of an RNA-binding domain. For example, a SARS-CoV-2 N protein having the amino acid sequence of SEQ ID NO: 84 comprises a basic loop at amino acids 88–103. Thus, in SEQ ID NO: 84, a basic loop corresponds to amino acids 88–103, and so a N portion lacking or having a truncated basic loop lacks one or more amino acids corresponding to amino acids 88–103 of SEQ ID NO: 84. Some portions of SARS-COV-2 N protein that are shortened or removed by truncation are located internally on a wild-type SARS-CoV-2 N protein, and so truncations in these portions are internal truncations. A SARS-CoV-2 N protein portion comprising an internal truncation lacks one or more amino acids that is present in a full-length N protein sequence, but comprises one or more amino acids that flank the deleted amino acid(s) in the full-length N protein sequence. In some embodiments, a modified N protein portion lacks an amino acid sequence comprising 1–200, 1–190, 1–180, 1–170, 1–160, 1–150, 1–140, 1–130, 1–120, 1–110, 1–100, 1– 90, 1–80, 1–70, 1–60, 1–50, 1–40, 1–30, 1–25, 1–20, 1–10, or 1–5, 10–200, 20–200, 30–200, 40–200, 50–200, 60–200, 70–200, 80–200, 90–200, 100–200, 110–200, 120–200, 130–200, 140– 200, 150–200, 160–200, 170–200, 180–200, 190–200, 10–30, 30–50, 50–75, 75–100, 100–125, 125–150, 150–175, or 175–200 amino acids that is present between the N-terminal amino acid and C-terminal amino acid of a full-length N amino acid sequence. In some embodiments, a modified N protein portion lacks 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 amino acids corresponding to amino acids 88–103 of SEQ ID NO: 84. A SARS-CoV-2 N protein portion may comprise a truncated N-terminus. In some embodiments, a modified N protein portion lacks an amino acid sequence comprising 1–200, 1– 190, 1–180, 1–170, 1–160, 1–150, 1–140, 1–130, 1–120, 1–110, 1–100, 1–90, 1–80, 1–70, 1–60, 1–50, 1–40, 1–30, 1–25, 1–20, 1–10, or 1–5, 10–200, 20–200, 30–200, 40–200, 50–200, 60–200, 70–200, 80–200, 90–200, 100–200, 110–200, 120–200, 130–200, 140–200, 150–200, 160–200, 170–200, 180–200, 190–200, 10–30, 30–50, 50–75, 75–100, 100–125, 125–150, 150–175, or 175–200 amino acids that is present that is present at the N-terminus of a full-length N protein amino acid sequence. In some embodiments, a modified N protein portion lacks an amino acid sequence comprising 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 101, 102, or 103 amino acids, which is present at the N-terminus of a full-length N protein. In some embodiments, a modified N protein portion lacks an amino acid sequence corresponding to amino acids 1–103 of a full- length N protein. In some embodiments, a modified N protein portion lacks an amino acid sequence corresponding to amino acids 1–103 of SEQ ID NO: 84. In some embodiments, a modified N protein portion lacks an amino acid sequence comprising 10, 20, 30, 40, 41, or 42 amino acids, which is present at the N-terminus of a full-length N protein. In some embodiments, a modified N protein portion lacks an amino acid sequence corresponding to amino acids 1–42 of a full-length N protein. In some embodiments, a modified N protein portion lacks an amino acid sequence corresponding to amino acids 1–42 of SEQ ID NO: 84. A SARS-CoV-2 N protein portion may comprise a truncated C-terminus. In some embodiments, a modified N protein portion lacks an amino acid sequence comprising 1–200, 1– 190, 1–180, 1–170, 1–160, 1–150, 1–140, 1–130, 1–120, 1–110, 1–100, 1–90, 1–80, 1–70, 1–60, 1–50, 1–40, 1–30, 1–25, 1–20, 1–10, or 1–5, 10–200, 20–200, 30–200, 40–200, 50–200, 60–200, 70–200, 80–200, 90–200, 100–200, 110–200, 120–200, 130–200, 140–200, 150–200, 160–200, 170–200, 180–200, 190–200, 10–30, 30–50, 50–75, 75–100, 100–125, 125–150, 150–175, or 175–200 amino acids that is present that is present at the C-terminus of a full-length N protein amino acid sequence. In some embodiments, a modified N protein portion lacks an amino acid sequence comprising 10, 20, 30, 40, 50, 51, 52, or 53 amino acids, which is present at the C- terminus of a full-length N protein. In some embodiments, a modified N protein portion lacks an amino acid sequence corresponding to amino acids 367–419 of a full-length N protein. In some embodiments, a modified N protein portion lacks an amino acid sequence corresponding to amino acids 367–419 of SEQ ID NO: 84. A SARS-CoV-2 N protein portion may comprise two or more amino acid sequences derived from a full-length N protein. The amino acid sequences of the full-length N protein may be derived from the same N protein, or different N proteins (e.g., N proteins of different SARS- CoV-2 lineages). Any pair of the two or more amino acid sequences may be contiguous in the N protein portion (e.g., without an intervening amino acid sequence), or the two amino acid sequences may be separated by a linker. Where multiple linkers separate multiple pairs of amino acid sequences, the multiple linkers may each comprise the same amino acid sequence (e.g., AAY). Multiple linkers may comprise different amino acid sequences (e.g., a first linker comprises the amino acid sequence GGS, and a second linker comprises the amino acid sequence GGS). In some embodiments, an N protein portion comprises an N-terminal domain of a SARS- CoV-2 N protein. In some embodiments, the N protein portion comprises a truncated N-terminal domain of a SARS-CoV-2 N protein. In some embodiments, the N protein portion lacks a basic loop corresponding to amino acids 88–103 of SEQ ID NO: 84. In some embodiments, the N protein portion comprises an amino acid sequence with at least 90% identity to amino acids 104– 143 of SEQ ID NO: 84. In some embodiments, the N protein portion comprises an amino acid sequence corresponding to amino acids 104–143 of SEQ ID NO: 84. In some embodiments, the N protein portion comprises an amino acid sequence with at least 90% identity to amino acids 43–87 of SEQ ID NO: 84. In some embodiments, the N protein portion comprises an amino acid sequence corresponding to amino acids 43–87 of SEQ ID NO: 84. In some embodiments, two or more amino acid sequences of an N protein portion are connected by GGSGG (SEQ ID NO: 99). In some embodiments, the N protein portion comprises a C-terminal domain of a SARS- CoV-2 N protein. In some embodiments, the C-terminal domain comprises an amino acid sequence 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, or 110 amino acids in length. In some embodiments, the C-terminal domain comprises an amino acid sequence corresponding to amino acids 255–364 of SEQ ID NO: 84. In some embodiments, the N protein portion comprises an amino acid sequence with at least 90% identity to amino acids 213–366 of SEQ ID NO: 84. In some embodiments, the N protein portion comprises an amino acid sequence corresponding amino acids 213–366 of SEQ ID NO: 84. Matrix (M) Proteins and Portions Some aspects relate to proteins comprising a matrix (M) portion and / or RNAs encoding the same. The SARS-CoV-2 M protein is an integral membrane protein that plays a crucial role involved in the assembly, budding, and maturation of viral particles. The M protein is critical for maintaining the contributes to maintenance of virion structural integrity via stabilization of the lipid bilayer. It also participates in intracellular trafficking and localization of viral components by interacting with cellular transport proteins to direct viral proteins to the sites of viral assembly. Structurally, the M protein is a transmembrane domain of 222-229 amino acids, depending on the variant. It has three main regions: the N-terminal domain (NTD), the transmembrane domains (TMD), and the C-terminal domain (CTD). The NTD is the region of the M protein exposed on the cytoplasmic side of the viral envelope, where it interacts with the nucleocapsid protein. The TMD spans the viral membrane, anchoring the M protein within the viral envelope. It is a hydrophobic region that enables the protein’s integration into the lipid bilayer. The CTD is located on the extracellular side of the viral envelope. It interacts with other structural proteins, such as the S protein and envelope (E) protein, to maintain the integrity of the viral envelope. Though generally considered less immunogenic than the S protein, dozens of Multiple CD8+ and CD4+ T cell epitopes have been predicted to occur in the M protein, the amino acid sequence of which is highly conserved among SARS-CoV-2 variants. In some embodiments, an mRNA encodes a protein comprising a SARS-CoV-2 matrix (M) protein portion. In some embodiments, a protein comprises a SARS-CoV-2 matrix (M) protein portion. M protein portions may contain a truncation or deletion of one or more regions, relative to a full-length or naturally occurring M protein, that are sparse in CD4+ and / or CD8+ T cell epitopes, thereby increasing the epitope density of the M protein portion compared to a full- length M protein. In some embodiments, an M protein portion comprises a higher density or CD4+ T cell epitopes than a wild-type SARS-CoV-2 M protein. In some embodiments, an M protein portion comprises a higher density or CD8+ T cell epitopes than a wild-type SARS-CoV- 2 M protein. M protein portions may also be modified to disrupt or remove functional regions of the M protein to improve safety or immunogenicity. For example, in some embodiments, an M protein lacks one or more glycosylation sites. Some portions of SARS-COV-2 M proteins that are shortened or removed by truncation are located internally on a wild-type SARS-CoV-2 M protein, and so truncations in these portions are internal truncations. A SARS-CoV-2 M protein portion comprising an internal truncation lacks one or more amino acids that is present in a full-length M protein sequence, but comprises one or more amino acids that flank the deleted amino acid(s) in the full-length M protein sequence. In some embodiments, a modified M protein portion lacks an amino acid sequence comprising 1–200, 1–190, 1–180, 1–170, 1–160, 1–150, 1–140, 1–130, 1–120, 1–110, 1–100, 1–90, 1–80, 1–70, 1–60, 1–50, 1–40, 1–30, 1–25, 1–20, 1–10, or 1–5, 10–200, 20–200, 30–200, 40–200, 50–200, 60–200, 70–200, 80–200, 90–200, 100–200, 110–200, 120–200, 130– 200, 140–200, 150–200, 160–200, 170–200, 180–200, 190–200, 10–30, 30–50, 50–75, 75–100, 100–125, 125–150, 150–175, or 175–200 amino acids that is present between the N-terminal amino acid and C-terminal amino acid of a full-length M amino acid sequence. A SARS-CoV-2 M protein portion may comprise a truncated N-terminus. In some embodiments, a modified M protein portion lacks an amino acid sequence comprising 1–200, 1– 190, 1–180, 1–170, 1–160, 1–150, 1–140, 1–130, 1–120, 1–110, 1–100, 1–90, 1–80, 1–70, 1–60, 1–50, 1–40, 1–30, 1–25, 1–20, 1–10, or 1–5, 10–200, 20–200, 30–200, 40–200, 50–200, 60–200, 70–200, 80–200, 90–200, 100–200, 110–200, 120–200, 130–200, 140–200, 150–200, 160–200, 170–200, 180–200, 190–200, 10–30, 30–50, 50–75, 75–100, 100–125, 125–150, 150–175, or 175–200 amino acids that is present that is present at the N-terminus of a full-length M protein amino acid sequence. In some embodiments, a modified M protein portion lacks an amino acid sequence comprising 1, 2, 3, 4, or 5 amino acids, which is present at the N-terminus of a full- length M protein. In some embodiments, a modified M protein portion lacks an amino acid sequence corresponding to amino acids 1–5 of a full-length M protein. The N-terminal amino acids 1–5 of a full-length M protein are involved in glycosylation of the full-length M protein, and so removal of one or more of these amino acids results in a less glycosylated M protein portion, relative to a full-length M protein. In some embodiments, a modified M protein portion lacks an amino acid sequence corresponding to amino acids 1–5 of SEQ ID NO: 86. A SARS-CoV-2 M protein portion may comprise a truncated C-terminus. In some embodiments, a modified M protein portion lacks an amino acid sequence comprising 1–200, 1– 190, 1–180, 1–170, 1–160, 1–150, 1–140, 1–130, 1–120, 1–110, 1–100, 1–90, 1–80, 1–70, 1–60, 1–50, 1–40, 1–30, 1–25, 1–20, 1–10, or 1–5, 10–200, 20–200, 30–200, 40–200, 50–200, 60–200, 70–200, 80–200, 90–200, 100–200, 110–200, 120–200, 130–200, 140–200, 150–200, 160–200, 170–200, 180–200, 190–200, 10–30, 30–50, 50–75, 75–100, 100–125, 125–150, 150–175, or 175–200 amino acids that is present that is present at the C-terminus of a full-length M protein amino acid sequence. In some embodiments, the modified M protein portion lacks one or more C-terminal amino acids of SEQ ID NO: 86. In some embodiments, an M protein portion comprises an amino acid sequence comprising 1–222, 1–220, 1–217, 1–215, 1–210, 1–200, 1–190, 1–180, 1–170, 1–160, 1–150, 1– 140, 1–130, 1–120, 1–110, 1–100, 1–90, 1–80, 1–70, 1–60, 1–50, 1–40, 1–30, 1–25, 1–20, 1–10, or 1–5, 10–222, 20–222, 30–222, 40–222, 50–222, 60–222, 70–222, 80–222, 90–222, 100–222, 110–222, 120–222, 130–222, 140–222, 150–222, 160–222, 170–222, 180–222, 190–222, 200– 222, 210–222, 217–222, 10–30, 30–50, 50–75, 75–100, 100–125, 125–150, 150–175, or 175– 217 amino acids, which is present in a full-length M protein amino acid sequence. In some embodiments, the full-length M protein amino acid sequence is SEQ ID NO: 86. In some embodiments, an M protein portion comprises one or more transmembrane domains of a full-length SARS-CoV-2 M protein. In some embodiments, an M protein portion comprises 1, 2, or 3 transmembrane domains of a full-length SARS-CoV-2 M protein portion. Exemplary transmembrane domains of a full-length SARS-CoV-2 M protein are located at amino acids 19–1000 of SEQ ID NO: 86, such that the N-terminal amino acids are present outside of a virus particle, and C-terminal amino acids are present inside a virus particle. In some embodiments, an M protein portion comprises an amino acid sequence that is at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acids 19–100 of SEQ ID NO: 86. In some embodiments, an M protein portion comprises an amino acid sequence that is at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acids 6–104 of SEQ ID NO: 86. In some embodiments, an M protein portion comprises a β-sheet domain. In a naturally occurring SARS-CoV-2 M protein, the β-sheet domain corresponding, e.g., to amino acids 118– 222 of SEQ ID NO: 86, is C-terminal to the transmembrane domains of the M protein, such that the β-sheet domain is present inside a virus particle (virion), or inside the cytoplasm of an infected cell. In some embodiments, an M protein portion of a protein comprises a β-sheet domain that is C-terminal to one or more transmembrane domains of the M protein portion. Location of the β-sheet domain downstream from the one or more transmembrane domains allows the β-sheet domain to be localized in the cytoplasm when a protein having the M protein portion is expressed in a cell (e.g., by translation of an mRNA encoding the protein). In some embodiments, an M protein portion comprises the β-sheet domain of a full-length M protein, and the β-sheet domain is N-terminal to one or more transmembrane domains (e.g. M protein transmembrane domains). In some embodiments, the β-sheet domain is N-terminal to 1, 2, or 3 transmembrane domains of the full-length SARS-CoV-2 M protein. Rearrangement of the M protein domains in this manner, where the β-sheet domain is N-terminal to one or more transmembrane domains, allows the β-sheet domain to be located extracellularly when a protein comprising the M protein portion is expressed in a cell and embedded in the cell membrane. Without wishing to be bound by theory, it is expected that this localization of the β-sheet domain outside the cell membrane reduces interaction of the β-sheet domain with intracellular components, and also exposes the β-sheet domain for the generation of antibodies specific to the β-sheet domain. In some embodiments, an M protein portion comprises an amino acid sequence that is at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acids 118–222 of SEQ ID NO: 86. In some embodiments, an M protein portion comprises an amino acid sequence that is at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acids 105–222 of SEQ ID NO: 86. A SARS-CoV-2 M protein portion may comprise two or more amino acid sequences derived from a full-length M protein. The amino acid sequences of the full-length M protein may be derived from the same M protein, or different M proteins (e.g., M proteins of different SARS- CoV-2 lineages). Any pair of the two or more amino acid sequences may be contiguous in the M protein portion (e.g., without an intervening amino acid sequence), or the two amino acid sequences may be separated by a linker. Where multiple linkers separate multiple pairs of amino acid sequences, the multiple linkers may each comprise the same amino acid sequence (e.g., AAY). Multiple linkers may comprise different amino acid sequences (e.g., a first linker comprises the amino acid sequence GGS, and a second linker comprises the amino acid sequence GGS). In some embodiments, two or more amino acid sequences of an M protein portion are connected by GGSGG (SEQ ID NO: 99). Non-structural protein 3 (Nsp3) Proteins and Portions Some aspects relate to proteins comprising non-structural protein 3 (Nsp3) portion and / or RNAs encoding the same. The SARS-CoV-2 Nsp3 protein is large and multifunctional. It is involved in several processes during the viral life cycle, including viral replication, host immune response modulation, and viral pathogenesis. Nsp3 plays a crucial role in the formation of the replication- transcription complex (RTC) and acts as a scaffold for various enzymatic activities. Structurally, the SARS-CoV-2 Nsp3 protein is a large, multidomain protein with a molecular weight of approximately 200 kDa. Some of the important domains within Nsp3 include the papain-like protease (PLpro) domain; the macrodomain (also known as ADP-ribose- 1''-phosphatase); and the ubiquitin-like domain (Ubl1), which are involved in various enzymatic activities and protein-protein interactions. Nsp3 protein sequences are highly conserved among coronaviruses, including SARS- CoV-2. In addition to the functions described above, it contributes to the virulence of SARS- CoV-2 via interaction with host factors, which an influence the severity of COVD-19 and its clinical manifestations. Like the N protein, Nsp3 is largely intracellular but may be exposed to the extracellular space upon cell lysis or through active secretion. Several T cell epitopes, both CD8+ and CD4+ T cell epitopes, are predicted to occur in Nsp3, which are conserved across multiple SARS-CoV-2 variants. In some embodiments, an mRNA encodes a protein comprising a SARS-CoV-2 non- structural protein 3 (Nsp3) protein portion. In some embodiments, a protein comprises a SARS- CoV-2 non-structural protein 3 (Nsp3) protein portion. A SARS-CoV-2 Nsp3 protein portion may comprise one or more T cell epitopes. Such T cell epitopes may be CD4+ T cell epitopes or CD8+ T cell epitopes. A CD4+ T cell epitope refers to an amino acid sequence that is presented on a class II major histocompatibility (MHC-II) protein. A CD8+ T cell epitope refers to an amino acid sequence that is presented on a class I major histocompatibility (MHC-I) protein. MHC-I proteins present peptides that are typically 8– 11 amino acids in length. A CD8+ T cell epitope may thus comprise an amino acid sequence 8– 11 amino acids in length. A protein may comprise a T cell epitope, such that when a peptide consisting of the amino acid sequence of the epitope is presented on a protein, a T cell recognizes the peptide:MHC complex. Peptides consisting of amino acid sequences present in a protein are generated by cleavage of proteins by a proteasome, which cleaves peptide bonds to release peptide fragments, and peptides are loaded into antigen-presenting grooves of MHC proteins. In some embodiments, an Nsp3 protein portion comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more T cell epitopes. In some embodiments, an Nsp3 protein portion comprises 2–6 T cell epitopes. In some embodiments, an Nsp3 protein portion comprises at least 6 T cell epitopes. In some embodiments, an Nsp3 protein portion comprises 6 T cell epitopes. In some embodiments, Nsp3 protein portion comprises 6 different epitope sequences. In some embodiments, Nsp3 protein portion comprises 6 different epitope sequences that do not overlap in the amino acid sequence of the protein. In some embodiments, the Nsp3 protein portion comprises an epitope with the amino acid sequence ALRKVPTDNYITTY (SEQ ID NO: 149). In some embodiments, the Nsp3 protein portion comprises an epitope with the amino acid sequence SNEKQEILGTVSWNL (SEQ ID NO: 150). In some embodiments, the Nsp3 protein portion comprises an epitope with the amino acid sequence HTTDPSFLGRYMSAL (SEQ ID NO: 151). In some embodiments, the Nsp3 protein portion comprises an epitope with the amino acid sequence LVAEWFLAYILFTRFFYV (SEQ ID NO: 152). In some embodiments, the Nsp3 protein portion comprises an epitope with the amino acid sequence YIFFASFYYVWKSYV (SEQ ID NO: 153). In some embodiments, the Nsp3 protein portion comprises an epitope with the amino acid sequence AEAELAKNVSLDNVL (SEQ ID NO: 154). In some embodiments, the Nsp3 protein portion comprises each of SEQ ID NOs: 149–154. In some embodiments, an Nsp3 protein portion comprises two or more T cell epitopes, and those T cell epitopes occur in a different order in the Nsp3 protein portion than in a full- length SARS-CoV-2 Nsp3 protein. For example, if a naturally occurring SARS-CoV-2 Nsp3 protein comprises three epitopes (E1, E2, and E3) in the order E1–X–E2–X–E3, where each X is either a peptide bond, or one or more intervening amino acids between epitopes in the naturally occurring Nsp3 protein, a Nsp3 protein may comprise the three epitopes in the order same order (E1–E2–E3), or a different order. In some embodiments, the Nsp3 protein portion comprises two or more epitopes in the same order as they occur in a naturally occurring or full-length Nsp3. In some embodiments, the Nsp3 protein portion comprises two or more epitopes in a different order than they occur in a naturally occurring or full-length Nsp3 protein. In some embodiments, the Nsp3 protein portion lacks one or more junctional epitopes formed by an amino acid sequence that overlaps with a first epitope sequence and a second epitope sequence. For example, where a first epitope has the amino acid sequence ALRKVPTDNYITTY (SEQ ID NO: 149) and a second epitope has the amino acid sequence SNEKQEILGTVSWNL (SEQ ID NO: 150), a concatenation of both epitopes, having the amino acid sequence ALRKVPTDNYITTYSNEKQEILGTVSWNL (SEQ ID NO: 155), includes the junctional epitopes YITTYSNEK (SEQ ID NO: 156) and ITTYSNEKQ (SEQ ID NO: 157) (underlined amino acids are present in the first epitope sequence, and bolded amino acids are present in the second epitope sequence). Such junctional epitopes may be absent from a SARS- CoV-2 Nsp3 protein, and so T cells specific to those junctional epitopes are expected to provide little protection, if any, against a SARS-CoV-2 infection. Additionally, junctional epitopes formed by concatenation of two or more amino acid sequences may include amino acid sequences present in endogenous human proteins, or resemble amino acid sequences present in endogenous human proteins. Presentation of such junctional epitopes may cause deleterious activation of T cells that then exhibit a response to endogenous proteins in a subject. Accordingly, rearrangement of two or more epitopes of a full-length Nsp3 protein, in an Nsp3 protein portion, allows for the avoidance of one or more junctional epitopes, while maintaining the presence of those epitopes that are useful in generating an anti-SARS-CoV-2 T cell response. While rearrangement may also introduce a different junctional epitope, such an introduced junctional epitope may present on an MHC-I allele that is less common in the human population. For example, if a first junctional epitope presented on an MHC allele that is present in 25% of humans, and rearrangement of two Nsp3 epitopes eliminates this junctional epitope while introducing a second junctional epitope that is presented on an MHC allele that is present in only 5% of humans, this rearrangement reduces the chance that an Nsp3 protein portion having the rearranged epitopes will elicit off-target T cells, because the introduced junctional epitope is less likely to be presented than the one that was eliminated. In some embodiments, the Nsp3 protein portion lacks one or more amino acid sequences selected from YITTYSNEK (SEQ ID NO: 156), ITTYSNEKQ (SEQ ID NO: 157), TVSWNLHTT (SEQ ID NO: 158), WNLHTTDPS (SEQ ID NO: 159), RYMSALLVA (SEQ ID NO: 160), MSALLVAEW (SEQ ID NO: 161), SALLVAEWF (SEQ ID NO: 162), RFFYVYIFF (SEQ ID NO: 163), TRFFYVYIF (SEQ ID NO: 164), KSYVAEAEL (SEQ ID NO: 165), VWKSYVAEA (SEQ ID NO: 166), WKSYVAEAE (SEQ ID NO: 168), and VAEAELA (SEQ ID NO: 169). In some embodiments, two Nsp3 epitope sequences are connected by a linker. The presence of a linker may eliminate a junctional epitope that would otherwise be present if two epitope sequences were concatenated without any intervening amino acids. In some embodiments, the presence of a linker reduces the chance a junctional epitope will be presented on an MHC-I protein. In some embodiments, two of a pair of Nsp3 epitopes are connected by an AAY linker. The amino acid sequence AAY is a cleavage site for mammalian proteasomes, and so inclusion of an AAY linker facilitates cleavage between the two epitopes, increasing the efficiency of Nsp3 peptide epitope production and presentation. A SARS-CoV-2 Nsp3 portion may comprise two or more amino acid sequences derived from a full-length Nsp3. The amino acid sequences of the full-length Nsp3 may be derived from the same Nsp3, or different Nsp3s (e.g., Nsp3s of different SARS-CoV-2 lineages). Any pair of the two or more amino acid sequences may be contiguous in the Nsp3 portion (e.g., without an intervening amino acid sequence), or the two amino acid sequences may be separated by a linker. Where multiple linkers separate multiple pairs of amino acid sequences, the multiple linkers may each comprise the same amino acid sequence (e.g., AAY). Multiple linkers may comprise different amino acid sequences (e.g., a first linker comprises the amino acid sequence GGS, and a second linker comprises the amino acid sequence GGS). In some embodiments, two or more amino acid sequences of an Nsp3 portion are connected by GGSGG (SEQ ID NO: 99). Spike (S) Proteins The envelope spike (S) proteins of known betacoronaviruses determine the virus host tropism and entry into host cells. Coronavirus spike (S) protein is a choice antigen for the vaccine design as it can induce neutralizing antibodies and protective immunity. S protein is critical for SARS-CoV-2 infection. The organization of the S protein is similar among betacoronaviruses, such as SARS-CoV-2, SARS-CoV, MERS-CoV, HKU1-CoV, MHV-CoV and NL63-CoV. As used herein, the term “Spike protein” refers to a glycoprotein that that forms homotrimers protruding from the envelope (viral surface) of viruses including betacoronaviruses. Trimerized Spike protein facilitates entry of the virion into a host cell by binding to a receptor on the surface of a host cell followed by fusion of the viral and host cell membranes. The S protein is a highly glycosylated and large type I transmembrane fusion protein that is made up of 1,160 to 1,400 amino acids, depending upon the type of virus. Betacoronavirus Spike proteins comprise between about 1100 to 1500 amino acids. SARS-CoV-2 spike (S) protein is a primary antigen choice for vaccine design, as it can induce neutralizing antibodies and protective immunity. mRNAs are designed to produce SARS- CoV-2 Spike proteins (i.e., encode Spike proteins such that Spike protein is expressed when the mRNA is delivered to a cell or tissue, for example a cell or tissue in a subject), as well as variants thereof. The skilled artisan will understand that, while an essentially full length or complete Spike protein may be necessary for a virus, e.g., a betacoronavirus, to perform its intended function of facilitating virus entry into a host cell, a certain amount of variation in Spike protein structure and / or sequence is tolerated when seeking primarily to elicit an immune response against Spike protein. For example, minor truncation, e.g., of one to a few, possibly up to 5 or up to 10 amino acids from the N- or C-terminus of the encoded Spike protein, e.g., encoded Spike protein antigen, may be tolerated without changing the antigenic properties of the protein. Likewise, variation (e.g., conservative substitution) of one to a few, possibly up to 5 or up to 10 amino acids (or more) of the encoded Spike protein, e.g., encoded Spike protein antigen, may be tolerated without changing the antigenic properties of the protein. In some embodiments, the Spike protein is a stabilized Spike protein, for example, the Spike protein is stabilized by two proline substitutions (a 2P mutation). In some embodiments, the Spike protein is not a stabilized Spike protein, for example, the Spike protein is not stabilized by two proline substitutions (a 2P mutation). In some embodiments, the Spike protein is from a different virus strain. A strain is a genetic variant of a microorganism (e.g., a virus). New viral strains can be created due to mutation, which may be selected due to enhanced replication, transmissibility, and / or evasion of pre-existing immune responses (e.g., antigenic drift), or recombination of genetic components when two or more viruses infect the same cell, with such recombinant viruses being selected due to enhanced replication, transmissibility, and / or evasion of pre-existing immune responses. Antigenic drift is a kind of genetic variation in viruses, arising by the accumulation of mutations in the virus genes that code for virus-surface proteins recognized by host immune responses (antibodies and T cells). This results in selection for new virus strains that are not effectively inhibited by the antibodies and / or T cell responses that prevented or mitigated infection by previous (wild-type or ancestral) strains. This makes it easier for the changed virus to spread throughout a partially immune population. Antigenic shift is the process by which two or more different strains of a virus, or strains of two or more different viruses, combine to form a new subtype having a mixture of the surface antigens of the two or more original strains, which may create virus with a novel combination of surface antigens that did not previously exist in nature. The term is often applied specifically to influenza viruses, where segmentation of the viral genome into distinct RNA segments, and reassortment of genome segments during virion production, allows the production of reassortant progeny with novel combinations of genome segments from co-infected cells. However, genetic recombination may occur between non-segmented viruses (e.g., SARS-CoV-2) where multiple viral strains replicate in the same cell, e.g., by switching between two template genomes during replication, resulting in progeny genomes with combinations of sequences from two or more viral strains. Antigenic shift is contrasted with antigenic drift (in which individual mutations accumulate over time, and may lead to a loss of immunity, or in vaccine mismatch). In contrast to accumulation of mutations on an ancestral genome (antigenic drift), genetic recombination (through reassortment or molecular recombination of genomes) is often associated with a major reorganization of viral surface antigens, resulting in novel combination of genes, which may cause a more immediate and drastic change in viral phenotype. A virus strain as used herein is a genetic variant or of a virus that is characterized by a differing isoform of one or more surface proteins of the virus. In the case of SARS-CoV-2, for example, a different amino acid sequence in the SARS-CoV-2 spike protein where the immune response in an individual to the new strain is less effective than to the strain used to immunize or first infect the individual. A new virus strain may arise from natural mutation or a combination of natural mutation and immune selection due to an ongoing immune response in an immunized or previously infected individual. A new virus strain can differ by one, two, three or more amino acid mutations in regions of the spike protein responsible for a viral function such as receptor binding or viral fusion with a target cell. A spike protein from a new strain may differ from the parental strain by as much as 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity at the amino acid level. A natural virus strain is a variant of a given virus that is recognizable because it possesses some “unique phenotypic characteristics” that remain stable (e.g., stable and heritable biological, serological, and / or molecular characters) under natural conditions. Such “unique phenotypic characteristics” are biological properties different from the compared reference virus, such as unique antigenic properties, host range (e.g., infecting a different kind of host), symptoms of disease caused by the strain, different type of disease caused by the strain (e.g., transmitted by different means), etc. A “unique phenotypic characteristic” can be detected clinically (e.g., clinical manifestations detected in a host infected with the strain) or within a comparative animal experiment in which a researcher skilled in the art of virology can distinguish between the reference control virus-infected animal and the animal infected with the alleged new strain, without knowing which animal received which virus and without having any information about the differences between the two viruses. Importantly, a virus variant with a simple difference in genome sequence is not a separate strain if there is no recognizable distinct viral phenotype. The extent of genomic sequence variation is irrelevant for the classification of a variant as a strain since a distinct phenotype sometimes arises from few mutations. As an example, in some embodiments, the mRNA encodes an antigen from at least one virus strain variant or comprises mutations from at least one virus strain that is not wild-type SARS-CoV-2. In some embodiments, the vaccine comprises an mRNA encoding a Spike protein associated with the XBB.1.5 lineage variant. The XBB.1.5 lineage variant encodes a Spike protein with multiple mutations relative to an ancestral Wuhan-Hu-1 Spike protein (SEQ ID NO: 87), including an N460K substitution, an F486P substitution, and an F490S substitution in the Spike protein. In some embodiments, an mRNA encodes a Spike protein with at least one substitution associated with the XBB.1.5 lineage variant. In some embodiments, an mRNA encodes a Spike protein with an N460K substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a Spike protein with an F486P substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a Spike protein with an F490S substitution relative to SEQ ID NO: 87. In some embodiments, the vaccine comprises an mRNA encoding a Spike protein associated with the XBB.1.16 lineage variant. The XBB.1.16 lineage variant encodes a Spike protein with multiple mutations relative to an ancestral Wuhan-Hu-1 Spike protein (SEQ ID NO: 87), including a Q183E substitution, an F456L substitution, an F486P substitution, and an F490S substitution in the Spike protein. In some embodiments, an mRNA encodes a Spike protein with at least one substitution associated with the XBB.1.16 lineage variant. In some embodiments, an mRNA encodes a Spike protein with an Q183E substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a Spike protein with an F456L substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a Spike protein with an F486P substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a Spike protein with an F490S substitution relative to SEQ ID NO: 87. Table 4, below, presents examples of Spike protein mutations in SARS-CoV-2 variants. In some embodiments, a Spike protein, e.g., an encoded Spike protein portion, has the amino acid sequence of SEQ ID NO: 87. In some embodiments, a Spike protein, e.g., an encoded Spike protein antigen, has no greater than 100, no greater than 90, no greater than 80, no greater than 70, no greater than 60, no greater than 50, no greater than 40, no greater than 30, no greater than 20, no greater than 10, or no greater than 5 amino acid substitutions and / or deletions as compared to (when aligned with) a Spike protein having the amino acid sequence as provided in SEQ ID NO: 87. Where minor variations are made in encoded Spike protein sequences, the variant preferably has the same activity as the reference Spike protein sequence and / or has the same immune specificity as the reference Spike protein, as determined for example, in immunoassays (e.g., enzyme-linked immunosorbent assays (ELISA assays). S proteins of coronaviruses can be divided into two important functional subunits, of which include the N-terminal S1 subunit, which forms of the globular head of the S protein, and the C-terminal S2 region that forms the stalk of the protein and is directly embedded into the viral envelope. Upon interaction with a potential host cell, the S1 subunit will recognize and bind to receptors on the host cell, specifically angiotensin-converting enzyme 2 (ACE2) receptors, whereas the S2 subunit, which is the most conserved component of the S protein, will be responsible for fusing the envelope of the virus with the host cell membrane. (See e.g., Shang et al., PLoS Pathog.2020 Mar; 16(3):e1008392.). Each monomer of trimeric S protein trimer contains the two subunits, S1 and S2, mediating attachment and membrane fusion, respectively. As part of the infection process in vivo, the two subunits are separated from each other by an enzymatic cleavage process. S protein is first cleaved by furin-mediated cleavage at the S1 / S2 site in infected cells. In vivo, a subsequent serine protease-mediated cleavage event occurs at the S2′ site within S1. In SARS-CoV2, the S1 / S2 cleavage site is at amino acids 676 – TQTNSPRRAR / SVA – 688 (SEQ ID NO: 45). The S2’ cleavage site is at amino acids 811 – KPSKR / SFI – 818 (SEQ ID NO: 46). As used herein, for example in the context of designing SARS-CoV-2 S protein antigens encoded by the nucleic acids, e.g., mRNAs, the term “S1 subunit” (e.g., S1 subunit antigen) refers to the N-terminal subunit of the Spike protein beginning at the S protein N-terminus and ending at the S1 / S2 cleavage site whereas the term “S2 subunit” (e.g., S2 subunit antigen) refers to the C-terminal subunit of the Spike protein beginning at the S1 / S2 cleavage site and ending at the C-terminus of the Spike protein. As described supra, the skilled artisan will understand that, while an essentially full length or complete Spike protein S1 or S2 subunit may be necessary for receptor binding or membrane fusion, respectively, a certain amount of variation in S1 or S2 structure and / or sequence is tolerated when seeking primarily to elicit an immune response against Spike protein subunits. For example, minor truncation, e.g., of one to a few, possibly up to 4, 5, 6, 7, 8, 9 or 10 amino acids from the N- or C-terminus of the encoded subunit, e.g., encoded S1 or S2 protein antigens, may be tolerated without changing the antigenic properties of the protein. Likewise, variation (e.g., conservative substitution) of one to a few, possibly up to 4, 5, 6, 7, 8, 9 or 10 amino acids (or more) of the encoded Spike protein subunits, e.g., encoded S1 or S2 protein antigen, may be tolerated without changing the antigenic properties of the protein(s). In some embodiments, a Spike protein, e.g., an encoded Spike protein antigen, has an amino acid sequence of SEQ ID NO: 87. The S1 and S2 subunits of the SARS-CoV-2 Spike protein further include domains readily discernable by structure and function, which in turn can be featured in designing antigens to be encoded by the nucleic acid vaccines, in particular, mRNA vaccines. Within the S1 subunit, domains include the N-terminal domain (NTD) and the receptor-binding domain (RBD), said RBD domain further including a receptor-binding motif (RBM) Within the S2 subunit, domains include fusion peptide (FP), heptad repeat 1 (HR1), heptad repeat 2 (HR2), transmembrane domain (TM), and cytoplasm domain, also known as cytoplasmic tail (CT) (Lu R. et al., supra; Wan et al., J. Virol. Mar 2020, 94 (7) e00127-20). The HR1 and HR2 domains can be referred to as the “fusion core region” of SARS-CoV-2 (Xia et al., 2020 Cell Mol Immunol. Jan; 17(1):1- 12.). The S1 subunit includes an N terminal domain (NTD), a linker region, a receptor binding domain (RBD), a first subdomain (SD1), and a second subdomain (SD2). The S2 subunit includes, inter alia, a first heptad repeat (HR1), a second heptad repeat (HR2), a transmembrane domain (TM), and a cytoplasmic tail. The NTD and RBD of S1 are good antigens for the vaccine design approach of some embodiments, as these domains have been shown to be the targets of neutralizing antibodies in betacoronavirus-infected individuals. As used herein, for example, in the context of an antigen design (said antigen encoded by an mRNA and to be expressed, for example, from an mRNA vaccine), the term “N-terminal domain” or “NTD” refers to a domain within the SARS-CoV-2 S1 subunit comprising approximately 290 amino acids in length, having identity to amino acids 1-290 of the S1 subunit of the Spike protein having the amino acid sequence set forth as SEQ ID NO: 87. As used herein, for example, in the context of an antigen design (said antigen encoded by an mRNA and to be expressed, for example, from an mRNA vaccine), the term “receptor binding domain” or “RBD” refers to a domain within the S1 subunit of SARS-CoV-2 comprising approximately 175-225 amino acids in length, having identity to amino acids 316-517 of the S1 subunit of the Spike protein having the amino acid sequence set forth as SEQ ID NO: 87. As used herein, the term “receptor binding motif” refers to the portion of the RBD that directly contacts the ACE2 receptor. Expressed RBDs are predicted to specifically bind to angiotensin-converting enzyme 2 (ACE2) as its receptor and / or specifically react with RBD-binding and / or neutralizing antibodies, e.g., CR3022. In some embodiments these antigens include a stabilizing 2P mutation. Compositions may include mRNA that encodes any one or more full-length or partial (truncated or other deletion of sequence) S protein subunit (e.g., S1 or S2 subunit), one or more domain or combination of domains of an S protein subunit (e.g., NTD, RBD, or NTD-RBD fusions, with or without an SD1 and / or SD2), or chimeras of full-length or partial and S2 protein subunits. Other S protein subunit and / or domain configurations are contemplated herein. Proteins comprising one or more Spike protein domains (e.g., NTD and RBD) may comprise one or more mutations associated with a virus strain variant, in the respective domain of the encoded protein. For example, an encoded NTD-RBD fusion protein may comprise a substitution corresponding to N460K in a full-length Spike protein, which the skilled artisan will understand refers to substitution of asparagine for lysine, where the substituted asparagine is one corresponding to N460 of a full-length Spike protein, when the NTD-RBD fusion protein sequence is aligned to a full-length Spike protein sequence (e.g., SEQ ID NO: 87). In some embodiments, the vaccine comprises an mRNA encoding an NTD-RBD fusion protein comprising one or more mutations associated with the XBB.1.5 lineage variant. The XBB.1.5 lineage variant encodes a Spike protein with multiple mutations relative to an ancestral Wuhan- Hu-1 Spike protein (SEQ ID NO: 87), including an N460K substitution, an F486P substitution, and an F490S substitution in the Spike protein. In some embodiments, an mRNA encodes an NTD-RBD fusion protein with at least one substitution associated with the XBB.1.5 lineage variant. In some embodiments, an mRNA encodes an NTD-RBD fusion protein with an N460K substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes an NTD-RBD fusion protein with an F486P substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes an NTD-RBD fusion protein with an F490S substitution relative to SEQ ID NO: 87. In some embodiments, the vaccine comprises an mRNA encoding an NTD-RBD fusion protein comprising one or more mutations associated with the XBB.1.16 lineage variant. The XBB.1.16 lineage variant encodes a Spike protein with multiple mutations relative to an ancestral Wuhan-Hu-1 Spike protein (SEQ ID NO: 87), including a Q183E substitution, an F456L substitution, an F486P substitution, and an F490S substitution in the Spike protein. In some embodiments, an mRNA encodes an NTD-RBD fusion protein with at least one substitution associated with the XBB.1.16 lineage variant. In some embodiments, an mRNA encodes an NTD-RBD fusion protein with an Q183E substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes an NTD-RBD fusion protein with an F456L substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes an NTD-RBD fusion protein with an F486P substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes an NTD-RBD fusion protein with an F490S substitution relative to SEQ ID NO: 87. Table 4, below, presents examples of Spike protein mutations in SARS-CoV-2 variants. Ta V 2 . 20A.EU2 S477N-D614G N439K-D614G N439K-D614G M B ( 2 B B ( P - B B V B V B A V B , B , X a X a , Q , An exemplary sequence of a protein comprising one or more domains of a coronavirus Spike protein (e.g., NTD-RBD fusion proteins) encoded by mRNAs is provided as SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having at least one of the following mutations relative to SEQ ID NO: 87: T19I, A27S, V83A, G142D, H146Q, E180V, Q183E, V213E, G252V, G339H, R346T, L368I, S371F, S373P, S375F, T376A, D405N, R408S, K417N, N440K, V445P, G446S, N460K, S477N, T478K, T478R, E484A, F486P, F490S, Q498R, N501Y, Y505H, D614G, H655Y, N679K, P681H, N764K, D796Y, Q954H, and N969K. In some embodiments, the mRNA encodes a protein having 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, or 39 substitutions selected from T19I, A27S, V83A, G142D, H146Q, E180V, Q183E, V213E, G252V, G339H, R346T, L368I, S371F, S373P, S375F, T376A, D405N, R408S, K417N, N440K, V445P, G446S, N460K, S477N, T478K, T478R, E484A, F486P, F490S, Q498R, N501Y, Y505H, D614G, H655Y, N679K, P681H, N764K, D796Y, Q954H, and N969K. In some embodiments, an mRNA encodes a protein having a T19I substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a A27S substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a V83A substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a G142D substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a H146Q substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a E180V substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a Q183E substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a V213E substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a G252V substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a G339H substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a R346T substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a L368I substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a S371F substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a S373P substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a S375F substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a T376A substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a D405N substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a R408S substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a K417N substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a N440K substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a V445P substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a G446S substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a N460K substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a S477N substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a T478K substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a T478R substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a E484A substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a F486P substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a F490S substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a Q498R substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a N501Y substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a Y505H substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a D614G substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a H655Y substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a N679K substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a P681H substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a N764K substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a D796Y substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a Q954H substitution relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a N969K substitution relative to SEQ ID NO: 87. In some embodiments, the mRNA encodes a protein having one or more deletions relative to the SARS-CoV-2 S protein of SEQ ID NO: 87. Exemplary deletions include, but are not limited to, deletions of L24, P25, P26, and Y144. In some embodiments, the mRNA encodes a protein lacking 1, 2, 3, or 4 amino acids corresponding to L24, P25, P26, or Y144 of SEQ ID NO: 87. In some embodiments, the mRNA encodes a protein having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, or 39 substitutions selected from T19I, A27S, V83A, G142D, H146Q, E180V, Q183E, V213E, G252V, G339H, R346T, L368I, S371F, S373P, S375F, T376A, D405N, R408S, K417N, N440K, V445P, G446S, N460K, S477N, T478K, T478R, E484A, F486P, F490S, Q498R, N501Y, Y505H, D614G, H655Y, N679K, P681H, N764K, D796Y, Q954H, and N969K relative to SEQ ID NO: 87, and lacking 1, 2, 3, or 4 amino acids corresponding to L24, P25, P26, or Y144 of SEQ ID NO: 87, any combination thereof. In some embodiments, an mRNA encodes a protein having a deletion of L24 relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a deletion of P25 relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a deletion of P26 relative to SEQ ID NO: 87. In some embodiments, an mRNA encodes a protein having a deletion of Y144 relative to SEQ ID NO: 87. In some embodiments, the mRNA vaccine comprises 1, 2, 3, 4, 5, or 6 mRNAs encoding different proteins, wherein each protein comprises at least one mutation and / or at least one deletion. In some embodiments, the mRNA vaccine further comprises an mRNA encoding a wild-type SARS-CoV-2 S protein or the antigenic fragment thereof. The mRNA vaccine, in some embodiments, is in a lipid nanoparticle (that is, the lipid nanoparticle comprises 1, 2, 3, 4, 5, or 6 mRNAs encoding different protein). In some embodiments, a composition comprises a first mRNA encoding a protein or variant thereof of a first SARS-CoV-2 virus and a second mRNA encoding a second protein or variant thereof of a second SARS-CoV-2 virus. In some embodiments, the first SARS-CoV-2 virus is a first circulating SARS-CoV-2 virus. In some embodiments, the second SARS-CoV-2 virus is a second circulating SARS-CoV-2 virus. “Circulating viruses” as used herein refer to viruses that have been in circulation for 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, a portion of a year, 1 year, 1.5 years, 2 years, 3 years, or longer. In some embodiments, the first and second mRNAs are present in the composition in a 1:1, 1:2, 1:3, or 1:4 ratio. In some embodiments, the first and second mRNAs are present in the composition in a 2:1, 3:1, or 4:1 ratio. In some embodiments, the first and second mRNAs are present in the composition in a 1:1 ratio. In some embodiments, a S protein portion comprises a receptor binding domain (RBD) from a SARS-CoV-2 Spike protein. In some embodiments, a S protein portion comprises an N-terminal domain (NTD) from a SARS-CoV-2 Spike protein. Fusion Proteins Some aspects relate to SARS-CoV-2 chimeric proteins comprising one or more portions of a SARS-CoV-2 N protein, a SARS-CoV-2 M protein, a SARS-CoV-2 Nsp3 protein, and / or a SARS-CoV-2 S protein, and / or RNAs encoding the same. Thus, the encoded protein or proteins may include two or more proteins (e.g., protein and / or protein portions) joined together with or without a linker. Alternatively, the protein to which a protein is fused does not promote a strong immune response to itself, but rather to the coronavirus antigen. Antigenic fusion proteins, in some embodiments, retain the functional property from each original protein. In some embodiments, a chimeric protein comprises an N protein portion, an Nsp3 protein portion, and an M protein portion. The N protein portion, Nsp3 protein portion, and M protein portion may occur in any order in the chimeric protein. In some embodiments, the portions occur, from N-to-C-terminal order, N-Nsp3-M. In some embodiments, the portions occur, from N-to-C-terminal order, N-M-Nsp3. In some embodiments, the portions occur, from N-to-C-terminal order, M-N-Nsp3. In some embodiments, the portions occur, from N-to-C- terminal order, M-Nsp3-N. In some embodiments, the portions occur, from N-to-C-terminal order, N-Nsp3-M. In some embodiments, the portions occur, from N-to-C-terminal order, N-M- Nsp3. Those skilled in the art will understand that in a chimeric protein comprising an M protein portion including one or more transmembrane domains, the amino acids N-terminal to the transmembrane domain(s) will be present extracellularly when the protein is embedded in a cell membrane, and the amino acids C-terminal to the transmembrane domain(s) will be present inside the cytoplasm when the protein is embedded in the cell membrane. In some embodiments, a chimeric protein comprises an S protein portion, an N protein portion, and a transmembrane portion comprising one or more transmembrane domains. The transmembrane portion may comprise an M protein portion. In some embodiments, the transmembrane protein portion comprises a transmembrane domain from a protein other than a SARS-CoV-2 M protein. In some embodiments, the transmembrane domain is an influenza virus hemagglutinin (HA) transmembrane domain. The S portion, N portion, and transmembrane portions may occur in any order. In some embodiments, the S portion is N-terminal to the transmembrane portion. In some embodiments, the N portion is N-terminal to the transmembrane portion. In some embodiments, the N portion is C-terminal to the transmembrane portion. Those skilled in the art will understand that in a chimeric protein comprising a transmembrane portion including one or more transmembrane domains, the amino acids N-terminal to the transmembrane domain(s) will be present extracellularly when the protein is embedded in a cell membrane, and the amino acids C-terminal to the transmembrane domain(s) will be present inside the cytoplasm when the protein is embedded in the cell membrane. The presence of a S portion extracellularly, in particular, allows exposure to the extracellular environment, facilitating more efficient generation of anti-Spike antibodies in a subject. In some embodiments, a fusion protein comprises a transmembrane domain. The transmembrane domain may, in some embodiments, be from a virus that is not SARS-CoV-2. For example, the transmembrane domain may be from an influenza hemagglutinin transmembrane domain, which has been demonstrated to effectively anchor proteins at the cell surface. Any pair of protein portions (e.g., N portion, M portion, Nsp3 portion, S portion) may be contiguous in the chimeric protein (e.g., without an intervening amino acid sequence), or the two portions may be separated by a linker. Where multiple linkers separate multiple pairs of portions, the multiple linkers may each comprise the same amino acid sequence (e.g., AAY). Multiple linkers may comprise different amino acid sequences (e.g., a first linker comprises the amino acid sequence GGS, and a second linker comprises the amino acid sequence GGS). In some embodiments, two or more portions of a chimeric protein portion are connected by a glycine linker or a glycine-serine linker. In some embodiments, each pair of protein portions of a chimeric protein are connected by a glycine linker or a glycine-serine linker. In some embodiments, each pair of protein portions are connected by the amino acid sequence GGSGG (SEQ ID NO: 99). In some embodiments, two or more portions of a chimeric protein are connected by a linker comprising the amino acid sequence AAY. In some embodiments, each pair of protein portions are connected by the amino acid sequence AAY. In some embodiments, two or more portions of a chimeric protein are connected by a linker comprising the amino acid sequence RKSY (SEQ ID NO: 136). In some embodiments, each pair of protein portions are connected by the amino acid sequence RKSY (SEQ ID NO: 136). The amino acid sequence RKSY (SEQ ID NO: 136) is a cleavable linker. Thus, inclusion of an RKSY (SEQ ID NO: 136) linker facilitates cleavage between the two connected protein portions, increasing the efficiency of peptide epitope production and presentation. In some embodiments, no linkers are present between protein portions in the chimeric protein. In some embodiments, no linkers are present between protein portions in the chimeric protein. Some aspects relate to a SARS-CoV-2 chimeric protein comprising an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of any one of SEQ ID NOs: 101–124 or 170–183. Exemplary sequences of SARS-CoV-2 chimeric proteins are provided in Appendix I and Table 5. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 101. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 102. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 103. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 104. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 105. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 106. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 107. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 108. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 109. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 110. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 111. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 112. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 113. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 114. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 115. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 116. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 117. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 118. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 119. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 120. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 121. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 122. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 123. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 124. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 170. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 171. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 172. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 173. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 174. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 175. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 176. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 177. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 178. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 179. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 180. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 181. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 182. In some embodiments, a SARS-CoV-2 chimeric protein comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 183. Variants In some embodiments, compositions include RNA that encodes a SARS-CoV-2 antigen variant. Antigen variants or other polypeptide variants refers to molecules that differ in their amino acid sequence from a wild-type, native, or reference sequence. The antigen / polypeptide variants may possess substitutions, deletions, and / or insertions at certain positions within the amino acid sequence, as compared to a native or reference sequence. Ordinarily, variants possess at least 50% identity to a wild-type, native or reference sequence. In some embodiments, variants share at least 80%, or at least 90% identity with a wild-type, native, or reference sequence. In some embodiments, the nucleic acid vaccines encode SARS-CoV-2 variant proteins comprising 1, 2, 3, 4, or more mutations relative to a reference sequence. In some embodiments, the nucleic acid vaccines encode SARS-CoV-2 variant proteins comprising less than 20, 18, 15, 12, or 10 mutations relative to a reference sequence. In some embodiments, the nucleic acid vaccines encode SARS-CoV-2 variant proteins having 1-501-40, 1-30, 1-25, 1-20, 1-15, 1-10, 5-50, 5-40, 5-30, 5-25, 5-20, 5-15, 5-10, 10-50, 10-40, 10-30, 10-25, 10-20, 10-15, 20-50, 20-40, 20-30, 20- 25, 25-50, 25-40, 25-30, 30-50, 30-40, 40-50 mutations (e.g., substitutions). As used herein, “mutation” refers to an amino acid substitution, insertion, or deletion. A reference sequence refers to a naturally-occurring strain, for example, a naturally-occurring circulating strain of SARS-CoV-2. Variant antigens / polypeptides encoded by nucleic acids may contain amino acid changes that confer any of a number of desirable properties, e.g., that enhance their immunogenicity, enhance their expression, and / or improve their stability or PK / PD properties in a subject. Variant antigens / polypeptides can be made using routine mutagenesis techniques and assayed as appropriate to determine whether they possess the desired property. Assays to determine expression levels and immunogenicity are well known in the art and exemplary such assays are set forth in the Examples section. Similarly, PK / PD properties of a protein variant can be measured using art recognized techniques, e.g., by determining expression of antigens in a vaccinated subject over time and / or by looking at the durability of the induced immune response. The stability of protein(s) encoded by a variant nucleic acid may be measured by assaying thermal stability or stability upon urea denaturation or may be measured using in silico prediction. Methods for such experiments and in silico determinations are known in the art. In some embodiments, a composition comprises an RNA or an RNA ORF that comprises a nucleotide sequence of any one of the sequences in Table 5, or comprises a nucleotide sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a nucleotide sequence of any one of the sequences in Table 5. The term “identity” refers to a relationship between the sequences of two or more polypeptides (e.g. antigens) or polynucleotides (nucleic acids), as determined by comparing the sequences. Identity also refers to the degree of sequence relatedness between or among sequences as determined by the number of matches between strings of two or more amino acid residues or nucleic acid residues. Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (e.g., “algorithms”). Identity of related antigens or nucleic acids can be readily calculated by known methods. “Percent (%) identity” as it applies to polypeptide or polynucleotide sequences is defined as the percentage of residues (amino acid residues or nucleic acid residues) in the candidate amino acid or nucleic acid sequence that are identical with the residues in the amino acid sequence or nucleic acid sequence of a second sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent identity. Methods and computer programs for the alignment are well known in the art. It is understood that identity depends on a calculation of percent identity but may differ in value due to gaps and penalties introduced in the calculation. Generally, variants of a particular polynucleotide or polypeptide (e.g., antigen) have at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% but less than 100% sequence identity to that particular reference polynucleotide or polypeptide as determined by sequence alignment programs and parameters known to those skilled in the art. Such tools for alignment include those of the BLAST suite (Stephen F. Altschul, et al (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res.25:3389-3402). Another popular local alignment technique is based on the Smith-Waterman algorithm (Smith, T.F. & Waterman, M.S. (1981) “Identification of common molecular subsequences.” J. Mol. Biol.147:195-197). A general global alignment technique based on dynamic programming is the Needleman–Wunsch algorithm (Needleman, S.B. & Wunsch, C.D. (1970) “A general method applicable to the search for similarities in the amino acid sequences of two proteins.” J. Mol. Biol.48:443-453). More recently a Fast Optimal Global Sequence Alignment Algorithm (FOGSAA) has been developed that purportedly produces global alignment of nucleotide and protein sequences faster than other optimal global alignment methods, including the Needleman–Wunsch algorithm. As such, polynucleotides encoding peptides or polypeptides containing substitutions, insertions and / or additions, deletions and covalent modifications with respect to reference sequences are contemplated. For example, sequence tags or amino acids, such as one or more lysines, can be added to peptide sequences (e.g., at the N-terminal or C-terminal ends). Sequence tags can be used for peptide detection, purification or localization. Lysines can be used to increase peptide solubility or to allow for biotinylation. Alternatively, amino acid residues located at the carboxy and amino terminal regions of the amino acid sequence of a peptide or protein may optionally be deleted providing for truncated sequences. Certain amino acids (e.g., C-terminal or N-terminal residues) may alternatively be deleted depending on the use of the sequence, as for example, expression of the sequence as part of a larger sequence which is soluble or linked to a solid support. In some embodiments, sequences for (or encoding) signal sequences, termination sequences, transmembrane domains, linkers, multimerization domains (such as, e.g., foldon regions) and the like may be substituted with alternative sequences that achieve the same or a similar function. In some embodiments, cavities in the core of proteins can be filled to improve stability, e.g., by introducing larger amino acids. In some embodiments, buried hydrogen bond networks may be replaced with hydrophobic resides to improve stability. In yet some embodiments, glycosylation sites may be removed and replaced with appropriate residues. Such sequences are readily identifiable to one of skill in the art. It should also be understood that some of the sequences contain sequence tags or terminal peptide sequences (e.g., at the N-terminal or C-terminal ends) that may be deleted, for example, prior to use in the preparation of an mRNA vaccine. As recognized by those skilled in the art, protein fragments, functional protein domains, and homologous proteins are also considered to be within the scope of coronavirus antigens of interest. For example, any protein fragment (meaning a polypeptide sequence at least one amino acid residue shorter than a reference antigen sequence but otherwise identical) of a reference protein, provided that the fragment is immunogenic and confers a protective immune response to the coronavirus, may be suitable. In addition to variants that are identical to the reference protein but are truncated, in some embodiments, an antigen includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations, as shown in any of the sequences provided or referenced herein. Antigens / antigenic polypeptides can range in length from about 4, 6, or 8 amino acids to full length proteins. Linkers and Cleavable Peptides In some embodiments, an RNA (e.g., mRNA) that encodes a protein encodes a linker located between at least one or each domain (portion) of the protein. The linker may be, for example, a cleavable linker or protease-sensitive linker. In some embodiments, the linker is selected from the group consisting of F2A linker, P2A linker, T2A linker, E2A linker, and combinations thereof (see, e.g., WO 2017 / 127750). This family of self-cleaving peptide linkers, referred to as 2A peptides, has been described in the art (see, e.g., Kim, J.H. et al. PLoS ONE 2011;6:e18556). In some embodiments, the linker is an F2A linker. In some embodiments, the linker is a GS linker. GS linkers are polypeptide linkers that include glycine and serine amino acids repeats. They comprise flexible and hydrophilic residues and can be used to perform fusion of protein subunits without interfering in the folding and function of the protein domains, and without formation of secondary structures. In some embodiments, an RNA (e.g., mRNA) encodes a protein that comprises a GS linker that is 3 to 20 amino acids long. For example, the GS linker may have a length of (or have a length of at least) 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids. In some embodiments, a GS linker is (or is at least) 15 amino acids long (e.g., GGSGGSGGSGGSGGG (SEQ ID NO: 47)). In some embodiments, a GS linker is (or is at least) 8 amino acids long (e.g., GGGSGGGS (SEQ ID NO: 48)). In some embodiments, a GS linker is (or is at least) 7 amino acids long (e.g., GGGSGGG (SEQ ID NO: 49)). In some embodiments, a GS linker comprises the amino acid sequence GGGSGG (SEQ ID NO: 50). In some embodiments, a GS linker is (or is at least) 4 amino acid long (e.g., GGGS (SEQ ID NO: 51)). In some embodiments, the GS linker comprises (GGGS)n (SEQ ID NO: 127), where n is any integer from 1-5. In some embodiments, a GS linker is (or is at least) 4 amino acid long (e.g., GSGG (SEQ ID NO: 52)). In some embodiments, the GS linker comprises (GSGG)n (SEQ ID NO: 130), where n is any integer from 1-5. In some embodiments, a linker is a glycine linker, for example having a length of (or a length of at least) 3 amino acids (e.g., GGG). In some embodiments, a protein encoded by an RNA (e.g., mRNA) includes two or more linkers, which may be the same or different from each other. The skilled artisan will appreciate that other art-recognized linkers may be suitable for use in the constructs (e.g., encoded by nucleic acids). The skilled artisan will likewise appreciate that other polycistronic constructs (RNA (e.g., mRNA) encoding more than one protein separately within the same molecule) may be suitable. Signal Peptides In some embodiments, an RNA (e.g., mRNA) has an ORF that encodes a signal peptide fused to a protein. Signal peptides, comprising the N-terminal 15-60 amino acids of proteins, are typically involved for the translocation across the membrane on the secretory pathway and, thus, control the entry of proteins both in eukaryotes and prokaryotes to the secretory pathway. In eukaryotes, the signal peptide of a nascent precursor protein (pre-protein) directs the ribosome to the rough endoplasmic reticulum (ER) membrane and initiates the transport of the growing peptide chain across it for processing. ER processing produces mature proteins, wherein the signal peptide is cleaved from precursor proteins, typically by an ER-resident signal peptidase of the host cell, or they remain uncleaved and function as a membrane anchor. A signal peptide may also facilitate the targeting of the protein to the cell membrane. A signal peptide may have a length of 15-60 amino acids. For example, a signal peptide may have a length of 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60 amino acids. In some embodiments, a signal peptide has a length of 20-60, 25-60, 30-60, 35- 60, 40-60, 45- 60, 50-60, 55-60, 15-55, 20-55, 25-55, 30-55, 35-55, 40-55, 45-55, 50-55, 15-50, 20-50, 25-50, 30-50, 35-50, 40-50, 45-50, 15-45, 20-45, 25-45, 30-45, 35-45, 40-45, 15-40, 20- 40, 25-40, 30-40, 35-40, 15-35, 20-35, 25-35, 30-35, 15-30, 20-30, 25-30, 15-25, 20-25, or 15-20 amino acids. Signal peptides from heterologous genes (which regulate expression of genes other than SARS-CoV-2 proteins in nature) are known in the art and can be tested for desired properties and then incorporated into a nucleic acid. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame that encodes a protein fused to a signal peptide comprising an amino acid sequence that has at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to the amino acid sequence of any one of the sequences, such as those reproduced below in Table 5. In some embodiments, an mRNA comprises an open reading frame that encodes a protein including an endogenous signal peptide of the wild-type protein (e.g., an mRNA encoding a (wild-type or modified) SARS-CoV-2 protein or variant thereof encodes a SARS-CoV-2 signal peptide). In some embodiments, an mRNA comprises an open reading frame that encodes a SARS-CoV-2 protein having an influenza virus hemagglutinin (HA) signal peptide. In some embodiments, the SARS-CoV-2 protein comprises the amino acid sequence of SEQ ID NO: 100. Nucleic Acids Encoding SARS-CoV-2 Proteins Nucleic acids comprise a polymer of nucleotides (nucleotide monomers). Thus, nucleic acids are also referred to as polynucleotides. Nucleic acids may be or may include, for example, deoxyribonucleic acid (DNA), ribonucleic acid (RNA), threose nucleic acid (TNA), glycol nucleic acid (GNA), peptide nucleic acid (PNA), locked nucleic acid (LNA, including LNA having a β-D-ribo configuration, α-LNA having an α-L-ribo configuration (a diastereomer of LNA), 2′-amino-LNA having a 2′-amino functionalization, and 2′-amino- α-LNA having a 2′- amino functionalization), ethylene nucleic acid (ENA), cyclohexenyl nucleic acid (CeNA) and / or chimeras and / or combinations thereof. RNA (e.g., mRNA) comprises an open reading frame (ORF) encoding a SARS-CoV-2 protein or variant thereof. In some embodiments, the RNA (e.g., mRNA) further comprises a 5 ^ untranslated region (UTR), 3 ^ UTR, a poly(A) tail and / or a 5 ^ cap analog. Messenger RNA (mRNA) Messenger RNA (mRNA) is RNA that encodes a (at least one) protein (a naturally- occurring, non-naturally-occurring, or modified polymer of amino acids) and can be translated to produce the encoded protein in vitro, in vivo, in situ, or ex vivo. It is understood that mRNA is not self-amplifying RNA (saRNA) (see, e.g., Bloom K et al. Gene Therapy 2021; 28: 117–129 for a comparison of mRNA and saRNA). saRNAs include alphavirus replicase sequences that encode an RNA-dependent RNA polymerase. mRNA does not include alphavirus replicase sequences. The skilled artisan will appreciate that, except where otherwise noted, nucleic acid sequences set forth in the instant application may recite “T”s in a representative DNA sequence but where the sequence represents mRNA, the “T”s would be substituted for “U”s. Thus, any of the DNAs disclosed and identified by a particular sequence identification number herein also disclose the corresponding mRNA sequence complementary to the DNA, where each “T” of the DNA sequence is substituted with “U.” Naturally-occurring eukaryotic mRNA molecules can contain stabilizing elements, including, but not limited to, UTRs at their 5′-end (5′ UTR) and / or at their 3′-end (3′ UTR), in addition to other structural features, such as a 5′-cap structure or a 3′-poly(A) tail. Both the 5′ UTR and the 3′ UTR are typically transcribed from the genomic DNA and are elements of the premature mRNA. Characteristic structural features of mature mRNA, such as the 5′-cap and the 3′-poly(A) tail are usually added to the transcribed (premature) mRNA during mRNA processing. Untranslated Regions (UTRs) mRNAs may comprise one or more regions or parts which act or function as an untranslated region. A “5′ untranslated region” (UTR) refers to a region of an mRNA that is directly upstream (i.e., 5′) from the start codon (i.e., the first codon of an mRNA transcript translated by a ribosome) that does not encode a polypeptide. A “3′ untranslated region” (UTR) refers to a region of an mRNA that is directly downstream (i.e., 3′) from the open reading frame (e.g., downstream from the last amino acid-encoding codon of an open reading frame, where the stop codon is considered part of the 3′ UTR, or downstream from the first stop codon signaling translation termination, where that stop codon is considered part of the open reading frame), and which does not encode a polypeptide. When RNA transcripts are being generated, the 5’ UTR may comprise a promoter sequence. Such promoter sequences are known in the art. It should be understood that such promoter sequences will not be present in an mRNA vaccine. Where mRNAs encode a (at least one) protein, the mRNA may comprise a 5’ UTR and / or 3’ UTR. UTRs of an mRNA are transcribed but not translated. In mRNA, the 5′ UTR starts at the transcription start site and continues to the start codon but does not include the start codon; the 3′ UTR starts immediately following the open reading frame and continues until the transcriptional termination signal. Where an open reading frame ends with a codon encoding an amino acid, the 3′ UTR begins with a stop codon, such that no amino acids are added to a polypeptide beyond the last amino acid encoded by the open reading frame. A 3′ UTR may further comprise one or more stop codons. There is a growing body of evidence about the regulatory roles played by the UTRs in terms of stability of the nucleic acid molecule and translation. The regulatory features of a UTR can be incorporated into the polynucleotides to, among other things, enhance the stability of the molecule. The specific features can also be incorporated to ensure controlled down-regulation of the transcript in case they are misdirected to undesired organs sites. A variety of 5’ UTR and 3’ UTR sequences are known. In some embodiments, the 5′ UTR comprises a sequence provided in Table 1 or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity to a 5′ UTR sequence provided in Table 1, or a variant or a fragment thereof. In some embodiments, the 3′ UTR comprises a sequence provided in Table 2 or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity to a 3′ UTR sequence provided in Table 2, or a variant or a fragment thereof. It should also be understood that the mRNA may include any 5’ UTR and / or any 3’ UTR. Exemplary UTR sequences include SEQ ID NOs: 1-44, 66-79 and 81-82; however, other UTR sequences may be used. In some embodiments, a 5' UTR comprises a sequence selected from: GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACC (SEQ ID NO: 1), GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGACCCCGGCGCCGCCACC (SEQ ID NO: 2), GAGGAAAUCGCAAAAUUUGCUCUUCGCGUUAGAUUUCUUUUAGUUUUCUCGCAACUAGC AAGCUUUUUGUUCUCGCC (SEQ ID NO: 66), and GGAAAUCGCAAAAUUUGCUCUUCGCGUUAGAUUUCUUUUAGUUUUCUCGCAACUAGCAA GCUUUUUGUUCUCGCC (SEQ ID NO: 5). In some embodiments, a 3′ UTR comprises, in 5′-to-3′order: (a) the nucleic acid sequenceUAAAGCUCCCCGGGGGCCUCGGUGGCCUAGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCAG (SEQ ID NO: 68), (b) an identification and ratio determination (IDR) sequence, and (c) the nucleic acid sequence UGGUCUUUGAAUAAAGUCUGAGUGGGCGGC (SEQ ID NO: 69). In some embodiments, each mRNA encoding a distinct protein (i.e., having a different amino acid sequence from proteins encoded by other mRNAs in a composition) comprises a 3′ UTR comprising, in 5′-to-3′ order: (a) the nucleotide sequence of SEQ ID NO: 68; (b) a distinct IDR sequence; and (c) the nucleotide sequence of SEQ ID NO: 69. Non-limiting examples of IDR sequences are described in the section entitled “Identification and Ratio Determination (IDR) Sequences.” In some embodiments, a 5′ UTR comprises a sequence derived from a 5′ UTR of a gene selected from HSD17B4, RPL32, ASAH1, ATP5A1, MP68, NDUFA4, NOSIP, RPL31, SLC7A3, TUBB4B and UBQLN2. In some embodiments, the 5′ UTR comprises a sequence derived from the 5′ UTR of human hydroxysteroid 17-beta dehydrogenase 4 (HSD17B4). In some embodiments, a 5′ UTR comprises the sequence GGGAGAGUCCCGCAGUCGGCGUCCAGCGGCUCUGCUUGUUCGUGUGUGUGUCGUUGCAGG CCUUAUUCAAGCUUACC (SEQ ID NO: 70). In some embodiments, a 5′ UTR comprises the sequence GUCCCGCAGUCGGCGUCCAGCGGCUCUGCUUGUUCGUGUGUGUGUCGUUGCAGGCCUUAU UC (SEQ ID NO: 71). In some embodiments, a 5′ UTR comprises the sequence GGGAGAAAGCUUACC (SEQ ID NO: 72). In some embodiments, a 3′ UTR comprises a sequence derived from a 3′ UTR of a gene selected from PSMB3, ALB7, alpha-globin, CASP1, COX6B1, GNAS, NDUFA1 and RPS9. In some embodiments, a 3′ UTR comprises a sequence derived from a 3′ UTR of PSMB3 (proteasome 20S subunit beta 3). In some embodiments, a 3′ UTR comprises a sequence derived from a 3′ UTR of alpha-globin (MUAG). In some embodiments, a 3′ UTR comprises the sequence AGGACUAGUCCCUGUUCCCAGAGCCCACUUUUUUUUCUUUUUUUGAAAUAAAAUAGCCU GUCUUUCAGAUCU (SEQ ID NO: 73). In some embodiments, a 3′ UTR comprises the sequence GGACUAGUUAUAAGACUGACUAGCCCGAUGGGCCUCCCAACGGGCCCUCCUCCCCUCCUU GCACCGAGAUUAAU (SEQ ID NO: 74). In some embodiments, the mRNA comprises a 5′ UTR comprising the nucleotide sequence of any one of SEQ ID NOs: 70–72, an open reading frame, one or more stop codons, and a 3′ UTR comprising the nucleotide sequence of SEQ ID NO: 73 or SEQ ID NO: 74. In some embodiments, the mRNA further comprises a polyA sequence comprising at least 64 consecutive adenosine nucleotides. In some embodiments, the mRNA further comprises a polyC sequence comprising at least 30 consecutive cytidine nucleotides. In some embodiments, a 5′ UTR comprises the sequence AACUAGUAUUCUUCUGGUCCCCACAGACUCAGAGAGAACCCGCCACC (SEQ ID NO: 75). In some embodiments, a 5′ UTR comprises the sequence GAGAAUAAACUAGUAUUCUUCUGGUCCCCACAGACUCAGAGAGAACCCGCCACC (SEQ ID NO: 76). In some embodiments, a 3′ UTR comprises the sequence CUGGUACUGCAUGCACGCAAUGCUAGCUGCCCCUUUCCCGUCCUGGGUACCCCGAGUCUC CCCCGACCUCGGGUCCCAGGUAUGCUCCCACCUCCACCUGCCCCACUCACCACCUCUGCUA GUUCCAGACACCUCCCAAGCACGCAGCAAUGCAGCUCAAAACGCUUAGCCUAGCCACACC CCCACGGGAAACAGCAGUGAUUAACCUUUAGCAAUAAACGAAAGUUUAACUAAGCUAUA CUAACCCCAGGGUUGGUCAAUUUCGUGCCAGCCACACC (SEQ ID NO: 77). In some embodiments, a 3′ UTR comprises the sequence CUCGAGCUGGUACUGCAUGCACGCAAUGCUAGCUGCCCCUUUCCCGUCCUGGGUACCCCG AGUCUCCCCCGACCUCGGGUCCCAGGUAUGCUCCCACCUCCACCUGCCCCACUCACCACCU CUGCUAGUUCCAGACACCUCCCAAGCACGCAGCAAUGCAGCUCAAAACGCUUAGCCUAGC CACACCCCCACGGGAAACAGCAGUGAUUAACCUUUAGCAAUAAACGAAAGUUUAACUAAG CUAUACUAACCCCAGGGUUGGUCAAUUUCGUGCCAGCCACACCCUGGAGCUAGC (SEQ ID NO: 78). In some embodiments, a 3′ UTR comprises the sequence CUGGUACUGCAUGCACGCAAUGCUAGCUGCCCCUUUCCCGUCCUGGGUACCCCGAGUCUC CCCCGACCUCGGGUCCCAGGUAUGCUCCCACCUCCACCUGCCCCACUCACCACCUCUGCUA GUUCCAGACACCUCCCAAGCACGCAGCAAUGCAGCUCAAAACGCUUAGCCUAGCCACACC CCCACGGGAAACAGCAGUGAUUAACCUUUAGCAAUAAACGAAAGUUUAACUAAGCUAUA CUAACCCCAGGGUUGGUCAAUUUCGUGCCAGCCACACCCUGGAGCUAGC (SEQ ID NO: 79). In some embodiments, an mRNA comprises a 5′ UTR comprising the nucleotide sequence of SEQ ID NO: 75 or SEQ ID NO: 76, an open reading frame, one or more stop codons, and a 3′ UTR comprising the nucleotide sequence of any one of SEQ ID NOs: 77–79. In some embodiments, an mRNA comprises a 5′ UTR comprising the nucleotide sequence of SEQ ID NO: 76, an open reading frame, one or more stop codons, and a 3′ UTR comprising the nucleotide sequence of SEQ ID NO: 78. In some embodiments, an mRNA comprises a 5′ UTR comprising the nucleotide sequence of SEQ ID NO: 76, an open reading frame, the nucleotide sequence UGAUGA, and a 3′ UTR comprising the nucleotide sequence of SEQ ID NO: 78. In some embodiments, the mRNA further comprises two poly(A) sequences separated by an intervening nucleotide sequence. In some embodiments, the mRNA further comprises the nucleotide sequence of SEQ ID NO: 80. In some embodiments, a 5′ UTR comprises the sequence GAGGAGACCCAAGCUACAUUUGCUUCUGACACAACUGUGUUCACUAGCAACCUCAAACAG ACACCGCCACC (SEQ ID NO: 81). In some embodiments, a 3′ UTR comprises the sequence GCUCGCUUUCUUGCUGUCCAAUUUCUAUUAAAGGUUCCUUUGUUCCCUAAGUCCAACUAC UAAACUGGGGGAUAUUAUGAAGGGCCUUGAGCAUCUGGAUUCUGCCUAAUAAAAAACAU UUAUUUUCAUUGC (SEQ ID NO: 82). In some embodiments, an mRNA comprises a 5′ UTR comprising the nucleotide sequence of SEQ ID NO: 81, an open reading frame, one or more stop codons, and a 3′ UTR comprising the nucleotide sequence of SEQ ID NO: 82. In some embodiments, the mRNA further comprises a polyA tail comprising 109 consecutive adenosine nucleotides. UTRs may also be omitted from the mRNA. A 5 ^ UTR does not encode a protein (is non-coding). Natural 5′ UTRs have features that play roles in translation initiation. They harbor signatures like Kozak sequences which are commonly known to be involved in the process by which the ribosome initiates translation of many genes. Kozak sequences have the consensus CCR(A / G)CCAUGG (SEQ ID NO: 53), where R is a purine (adenine or guanine) three bases upstream of the start codon (AUG), which is followed by another 'G'.5′UTR also have been known to form secondary structures which are involved in elongation factor binding. In some embodiments, a 5’ UTR is a heterologous UTR, i.e., is a UTR found in nature associated with a different ORF. In some embodiments, a 5’ UTR is a synthetic UTR, i.e., does not occur in nature. Synthetic UTRs include UTRs that have been mutated to improve their properties, e.g., which increase gene expression as well as those which are completely synthetic. Exemplary 5’ UTRs include Xenopus or human derived a-globin or b-globin (8278063; 9012219), human cytochrome b-245 a polypeptide, and hydroxysteroid (17b) dehydrogenase, and Tobacco etch virus (US8278063, US9012219). CMV immediate-early 1 (IE1) gene (US2014 / 0206753, WO2013 / 185069), the sequence GGGAUCCUACC (SEQ ID NO: 54) (WO 2014 / 144196) may also be used. In some embodiments, a 5' UTR is a 5' UTR of a TOP gene lacking the 5' TOP motif (the oligopyrimidine tract) (e.g., WO2015 / 101414, WO2015 / 101415, WO2015 / 062738, WO2015 / 024667, WO2015 / 024667); 5' UTR element derived from ribosomal protein Large 32 (L32) gene (WO / 2015101414, WO2015101415, WO / 2015 / 062738), 5' UTR element derived from the 5' UTR of an hydroxysteroid (17-β) dehydrogenase 4 gene (HSD17B4) (WO201 / 5024667), or a 5' UTR element derived from the 5' UTR of ATP5A1 (WO2015 / 024667) can be used. In some embodiments, an internal ribosome entry site (IRES) is used instead of a 5' UTR. A 3 ^ UTR does not encode a protein (is non-coding). Natural or wild type 3′ UTRs are known to have stretches of adenosines and uridines embedded in them. These AU rich signatures are particularly prevalent in genes with high rates of turnover. Based on their sequence features and functional properties, the AU rich elements (AREs) can be separated into three classes (Chen et al, 1995): Class I AREs contain several dispersed copies of an AUUUA motif within U-rich regions. C-Myc and MyoD contain class I AREs. Class II AREs possess two or more overlapping UUAUUUA(U / A)(U / A) nonamers. Molecules containing this type of AREs include GM-CSF and TNF-a. Class III ARES are less well defined. These U rich regions do not contain an AUUUA motif. c-Jun and Myogenin are two well-studied examples of this class. Most proteins binding to the AREs are known to destabilize the messenger, whereas members of the ELAV family, most notably HuR, have been documented to increase the stability of mRNA. HuR binds to AREs of all the three classes. Engineering the HuR specific binding sites into the 3′ UTR of nucleic acid molecules will lead to HuR binding and thus, stabilization of the message in vivo. Introduction, removal or modification of 3′ UTR AU rich elements (AREs) can be used to modulate the stability of mRNA. When engineering specific nucleic acids, one or more copies of an ARE can be introduced to make nucleic acids less stable and thereby curtail translation and decrease production of the resultant protein. Likewise, AREs can be identified and removed or mutated to increase the intracellular stability and thus increase translation and production of the resultant protein. Transfection experiments can be conducted in relevant cell lines, using nucleic acids and protein production can be assayed at various time points post-transfection. For example, cells can be transfected with different ARE-engineering molecules and by using an ELISA kit to the relevant protein and assaying protein produced at 6 hours, 12 hours, 1 day, 2 days, and 7 days post-transfection. Those of ordinary skill in the art will understand that 5’ UTRs that are heterologous or synthetic may be used with any desired 3’ UTR sequence. For example, a heterologous or synthetic 5’ UTR may be used with a synthetic 3’ UTR or with a heterologous 3’ UTR. Non-UTR sequences may also be used as regions or subregions within a nucleic acid. For example, introns or portions of introns sequences may be incorporated into regions of nucleic acid. Incorporation of intronic sequences may increase protein production as well as nucleic acid levels. Combinations of features may be included in flanking regions and may be contained within other features. For example, the ORF may be flanked by a 5′ UTR which may contain a strong Kozak translational initiation signal and / or a 3' UTR which may include an oligo(dT) sequence for templated addition of a poly-A tail. A 5′ UTR may comprise a first polynucleotide fragment and a second polynucleotide fragment from the same and / or different genes such as the 5′ UTRs described in US2010 / 0293625 and WO2015 / 085318A2, each of which is herein incorporated by reference. It should be understood that any UTR from any gene may be incorporated into the regions of a nucleic acid. Furthermore, multiple wild-type UTRs of any known gene may be utilized. Artificial UTRs which are not variants of wild type regions may be used. These UTRs or portions thereof may be placed in the same orientation as in the transcript from which they were selected or may be altered in orientation or location. Hence a 5′ or 3′ UTR may be inverted, shortened, lengthened, made with one or more other 5′ UTRs or 3′ UTRs. As used herein, the term “altered” as it relates to a UTR sequence, means that the UTR has been changed in some way in relation to a reference sequence. For example, a 3′ UTR or 5′ UTR may be altered relative to a wild-type / native UTR by the change in orientation or location as taught above or may be altered by the inclusion of additional nucleotides, deletion of nucleotides, swapping or transposition of nucleotides. Any of these changes producing an “altered” UTR (whether 3′ or 5′) comprise a variant UTR. In some embodiments, a double, triple or quadruple UTR such as a 5′ UTR or 3′ UTR may be used. As used herein, a “double” UTR is one in which two copies of the same UTR are encoded either in series or substantially in series. For example, a double beta-globin 3′ UTR may be used as described in US2010 / 0129877, which is incorporated herein by reference. Patterned UTRs may be used in RNAs. As used herein “patterned UTRs” are those UTRs which reflect a repeating or alternating pattern, such as ABABAB or AABBAABBAABB or ABCABCABC or variants thereof repeated once, twice, or more than 3 times. In these patterns, each letter, A, B, or C represent a different UTR at the nucleotide level. In some embodiments, flanking regions are selected from a family of transcripts whose proteins share a common function, structure, feature, or property. For example, polypeptides of interest may belong to a family of proteins which are expressed in a particular cell, tissue or at some time during development. The UTRs from any of these genes may be swapped for any other UTR of the same or different family of proteins to create a new polynucleotide. As used herein, a “family of proteins” is used in the broadest sense to refer to a group of two or more polypeptides of interest which share at least one function, structure, feature, localization, origin, or expression pattern. The untranslated region may also include translation enhancer elements (TEE). As a non- limiting example, the TEE may include those described in US 2009 / 0226470, herein incorporated by reference, and those known in the art. Open Reading Frames An open reading frame (ORF) is a continuous stretch of DNA or RNA that (1) begins with a start codon (e.g., ATG or AUG, encoding methionine), and (2) ends with a stop codon (e.g., TAA, TAG or TGA, or UAA, UAG or UGA) or is immediately followed by a stop codon. A stop codon does not encode an amino acid, such that translation of an ORF terminates when a ribosome reaches the stop codon immediately following the last amino acid-encoding codon in the ORF. A stop codon that results in translation termination may be considered part of the ORF, in which case the ORF ends with the stop codon. Alternatively, the first stop codon immediately following the last amino acid-encoding codon of an ORF may considered part of the 3′ untranslated region (3′ UTR) of a DNA or RNA, rather than part of the ORF. Those skilled in the art will understand that an ORF sequence that ends in a codon encoding amino acid will be followed by one or more stop codons in a DNA or RNA. An ORF may be followed by multiple stop codons. Inclusion of multiple consecutive stop codons reduces the extent of continued translation that may occur if a stop codon is mutated to a codon encoding an amino acid (readthrough), as a second stop codon may terminate translation even if a first stop codon is mutated and encodes an amino acid, such that only one amino acid is added to the C-terminus of the translated protein. Where multiple stop codons are present at the end, or immediately following, an ORF, the multiple stop codons may comprise the same stop codon (e.g., UGAUGA). Multiple stop codons may comprise different stop codons in series (e.g., UGAUAAUAG). In addition to reducing the extent of readthrough if a first stop codon is mutated, the presence of multiple different stop codons reduces the extent of readthrough if the first stop codon fails to allow translation termination (e.g., if a suppressor tRNA with an anticodon complementary to the first stop codon is present in the cell). An ORF typically encodes a protein. It will be understood that the sequences disclosed herein may further comprise additional elements, e.g., 5’ and / or 3’ UTRs, but that those elements, unlike the ORF, need not necessarily be present in an RNA (e.g., mRNA). Some aspects relate to an RNA (e.g., mRNA or self-amplifying RNA) encoding a SARS- CoV-2 chimeric protein and comprising an open reading frame with a sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of any one of SEQ ID NOs: 125, 126, 128, 129, 131, 132, 133, 134, 135, 137, 138, 140, 141, 143, 144, 146, or 147. Exemplary sequences of open reading frames encoding a SARS-CoV-2 chimeric protein are provided in Table 5. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 125. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 126. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 128. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 129. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 131. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 132. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 134. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 135. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 137. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 138. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 140. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 141. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 143. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 144. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 146. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 147. In some embodiments, an RNA (e.g., mRNA) comprises an open reading frame having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the nucleotide sequence of SEQ ID NO: 133. 5′ Caps In some embodiments, an RNA (e.g., mRNA) comprises a 5′ terminal cap.5′-capping of polynucleotides may be completed concomitantly during an in vitro transcription reaction using, for example, the following chemical RNA cap analogs to generate the 5′-guanosine cap structure according to manufacturer protocols: 3´-O-Me-m7G(5')ppp(5') G [the ARCA cap];G(5')ppp(5')A; G(5')ppp(5')G; m7G(5')ppp(5')A; m7G(5')ppp(5')G (New England BioLabs, Ipswich, MA).5′- capping of modified RNA (e.g., mRNA) may be completed post-transcriptionally using, for example, a Vaccinia Virus Capping Enzyme to generate the “Cap 0” structure: m7G(5')ppp(5')G (New England BioLabs, Ipswich, MA). Cap 1 structure may be generated using both Vaccinia Virus Capping Enzyme and a 2′-O methyl-transferase to generate: m7G(5')ppp(5')G-2′-O- methyl. Cap 2 structure may be generated from the Cap 1 structure followed by the 2′-O- methylation of the 5′-antepenultimate nucleotide using a 2′-O methyl-transferase. Cap 3 structure may be generated from the Cap 2 structure followed by the 2′-O-methylation of the 5′- preantepenultimate nucleotide using a 2′-O methyl-transferase. Enzymes may be derived from a recombinant source. Other cap analogs may be used. A cap analog may be, for example, a dinucleotide cap, a trinucleotide cap, or a tetranucleotide cap. In some embodiments, a cap analog is a dinucleotide cap. In some embodiments, a cap analog is a trinucleotide cap. In some embodiments, a cap analog is a tetranucleotide cap. A nucleotide cap (e.g., a trinucleotide cap or tetranucleotide cap), in some embodiments, comprises a compound of formula (I) a stereoisomer, tautomer or salt ; ring B1 is a modified or unmodified Guanine; ring B2and ring B3each independently is a nucleobase or a modified nucleobase; X2is O, S(O)p, NR24or CR25R26in which p is 0, 1, or 2; Y0 is O or CR6R7; Y1 is O, S(O)n, CR6R7, or NR8, in which n is 0, 1, or 2; each --- is a single bond or absent, wherein when each --- is a single bond, Yi is O, S(O)n, CR6R7, or NR8; and when each --- is absent, Y1 is void; Y2 is (OP(O)R4)m in which m is 0, 1, or 2, or -O-(CR40R41)u-Q0-(CR42R43)v-, in which Q0 is a bond, O, S(O)r, NR44, or CR45R46, r is 0, 1 , or 2, and each of u and v independently is 1, 2, 3 or 4; each R2 and R2' independently is halo, LNA, or OR3; each R3independently is H, C1-C6alkyl, C2-C6alkenyl, or C2-C6alkynyl and R3, when being C1-C6alkyl, C2-C6alkenyl, or C2-C6alkynyl, is optionally substituted with one or more of halo, OH and C1-C6 alkoxyl that is optionally substituted with one or more OH or OC(O)-C1-C6 alkyl; each R4and R4' independently is H, halo, C1-C6alkyl, OH, SH, SeH, or BH3-; each of R6, R7, and R8, independently, is -Q1-T1, in which Q1 is a bond or C1-C3 alkyl linker optionally substituted with one or more of halo, cyano, OH and C1-C6 alkoxy, and T1 is H, halo, OH, COOH, cyano, or Rs1, in which Rs1is C1-C3alkyl, C2-C6alkenyl, C2-C6alkynyl, C1- C6 alkoxyl, C(O)O-C1-C6 alkyl, C3-C8 cycloalkyl, C6-C10 aryl, NR31R32, (NR31R32R33)+, 4 to 12- membered heterocycloalkyl, or 5- or 6-membered heteroaryl, and Rs1 is optionally substituted with one or more substituents selected from the group consisting of halo, OH, oxo, C1-C6alkyl, COOH, C(O)O-C1-C6alkyl, cyano, C1-C6alkoxyl, NR31R32, (NR31R32R33)+, C3-C8cycloalkyl, C6-C10 aryl, 4 to 12-membered heterocycloalkyl, and 5- or 6-membered heteroaryl; each of R10, R11, R12, R13 R14, and R15, independently, is -Q2-T2, in which Q2 is a bond or C1-C3alkyl linker optionally substituted with one or more of halo, cyano, OH and C1-C6alkoxy, and T2 is H, halo, OH, NH2, cyano, NO2, N3, Rs2, or ORs2, in which Rs2 is C1-C6 alkyl, C2-C6 alkenyl, C2-C6 alkynyl, C3-C8 cycloalkyl, C6-C10 aryl, NHC(O)-C1-C6 alkyl, NR31R32, (NR31R32R33)+, 4 to 12-membered heterocycloalkyl, or 5- or 6-membered heteroaryl, and Rs2is optionally substituted with one or more substituents selected from the group consisting of halo, OH, oxo, C1-C6 alkyl, COOH, C(O)O-C1-C6 alkyl, cyano, C1 - C6 alkoxyl, NR31R32, (NR31R32R33)+, C3-C8cycloalkyl, C6-C10aryl, 4 to 12-membered heterocycloalkyl, and 5- or 6- membered heteroaryl; or alternatively R12together with R14is oxo, or R13together with R15is oxo, each of R20, R21, R22, and R23 independently is -Q3-T3, in which Q3 is a bond or C1-C3 alkyl linker optionally substituted with one or more of halo, cyano, OH and C1-C6alkoxy, and T3 is H, halo, OH, NH2, cyano, NO2, N3, RS3, or ORS3, in which RS3 is C1-C6 alkyl, C2- C6 alkenyl, C2-C6 alkynyl, C3-C8 cycloalkyl, C6-C10 aryl, NHC(O)-C1-C6 alkyl, mono-C1- C6alkylamino, di-C1-C6alkylamino, 4 to 12-membered heterocycloalkyl, or 5- or 6-membered heteroaryl, and Rs3is optionally substituted with one or more substituents selected from the group consisting of halo, OH, oxo, C1-C6 alkyl, COOH, C(O)O-C1-C6 alkyl, cyano, C1-C6 alkoxyl, amino, mono-C1-C6alkylamino, di-C1-C6alkylamino, C3-C8cycloalkyl, C6-C10aryl, 4 to 12-membered heterocycloalkyl, and 5- or 6-membered heteroaryl; each of R24, R25, and R26 independently is H or C1-C6 alkyl; each of R27 and R28 independently is H or OR29; or R27 and R28 together form O-R30-O; each R29independently is H, C1-C6alkyl, C2-C6alkenyl, or C2-C6alkynyl and R29, when being C1-C6 alkyl, C2-C6 alkenyl, or C2-C6 alkynyl, is optionally substituted with one or more of halo, OH and C1-C6 alkoxyl that is optionally substituted with one or more OH or OC(O)-C1-C6 alkyl; R30is C1-C6alkylene optionally substituted with one or more of halo, OH and C1-C6alkoxyl; each of R31, R32, and R33, independently is H, C1-C6 alkyl, C3-C8 cycloalkyl, C6-C10 aryl, 4 to 12-membered heterocycloalkyl, or 5- or 6-membered heteroaryl; each of R40, R41, R42, and R43independently is H, halo, OH, cyano, N3, OP(O)R47R48, or C1-C6 alkyl optionally substituted with one or more OP(O)R47R48, or one R41 and one R43, together with the carbon atoms to which they are attached and Q0, form C4-C10 cycloalkyl, 4- to 14-membered heterocycloalkyl, C6-C10aryl, or 5- to 14-membered heteroaryl, and each of the cycloalkyl, heterocycloalkyl, phenyl, or 5- to 6-membered heteroaryl is optionally substituted with one or more of OH, halo, cyano, N3, oxo, OP(O)R47R48, C1-C6alkyl, C1-C6haloalkyl, COOH, C(O)O-C1-C6 alkyl, C1-C6 alkoxyl, C1-C6 haloalkoxyl, amino, mono-C1-C6 alkylamino, and di-C1-C6 alkylamino; R44is H, C1-C6alkyl, or an amine protecting group; each of R45 and R46 independently is H, OP(O)R47R48, or C1-C6 alkyl optionally substituted with one or more OP(O)R47R48, and each of R47and R48, independently is H, halo, C1-C6alkyl, OH, SH, SeH, or BH3. It should be understood that a cap analog may include any of the cap analogs described in international publication WO 2017 / 066797, published on 20 April 2017, incorporated by reference herein in its entirety. In some embodiments, the B2middle position can be a non-ribose molecule, such as arabinose. In some embodiments R2 is ethyl-based. Thus, in some embodiments, a tetranucleotide cap comprises the following structure: . In some embodiments, a tetranucleotide cap comprises the following structure:

[0002] . (IX). In some embodiments, R is an alkyl (e.g., C1-C6alkyl). In some embodiments, R is a methyl group (e.g., C1alkyl). In some embodiments, R is an ethyl group (e.g., C2alkyl). In some embodiments, R is a hydrogen. In some embodiments, a tetranucleotide cap comprises GGAG. In some embodiments, a tetranucleotide cap comprises any one of the following structures: ; or . Polyadenylation A “poly(A) tail” is a region of mRNA that is downstream, e.g., directly downstream (i.e., 3′), from the 3′ UTR that contains multiple, consecutive adenosine monophosphates. A poly(A) tail may contain 10 to 300 adenosine monophosphates. It can, in some instances, comprise up to about 400 adenine nucleotides. For example, a poly(A) tail may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290 or 300 adenosine monophosphates. In some embodiments, a poly(A) tail contains 50 to 250 adenosine monophosphates. In a relevant biological setting (e.g., in cells, in vivo) the poly(A) tail functions to protect mRNA from enzymatic degradation, e.g., in the cytoplasm, and aids in transcription termination, and / or export of the mRNA from the nucleus and translation. In some embodiments, the length of the 3′-poly(A) tail may be an essential element with respect to the stability of the individual mRNA. In some embodiments, a poly(A) tail has a length of about 50, about 100, about 150, about 200, about 250, about 300, about 350, or about 400 nucleotides. In some embodiments, a poly(A) tail has a length of 100 nucleotides. In some embodiments, an mRNA comprises a poly(A) sequence that has a length of 50– 75 nucleotides. In some embodiments, an mRNA comprises a poly(A) sequence that comprises 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, or 70 consecutive adenosine nucleotides. In some embodiments, an mRNA comprises a poly(A) sequence comprising 64 consecutive adenosine nucleotides. In some embodiments, the consecutive adenosine nucleotides of a poly(A) sequence are flanked at the 5′ and 3′ end by nucleotides that are not adenosine nucleotides. In some embodiments, an mRNA comprises a poly(C) sequence, which may comprise 10 to 300 cytidine nucleotides. In some embodiments, the poly(C) sequence comprises 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 consecutive cytidine nucleotides. In some embodiments, the poly(C) sequence comprises 30 cytidine nucleotides. In some embodiments, the consecutive cytidine nucleotides of a poly(C) sequence are flanked at the 5′ and 3′ end by nucleotides that are not cytidine nucleotides. In some embodiments, an mRNA comprises two poly(A) sequences separated by an intervening nucleotide sequence. In some embodiments, the intervening nucleotide sequence comprises no more than 3, no more than two, no more than 1, or no adenosine nucleotides. In some embodiments, the intervening sequence comprises 3 adenosine nucleotides. In some embodiments, the intervening sequence does not comprise an adenosine nucleotide. In some embodiments, the intervening sequence is no more than 30, no more than 25, no more than 20, no more than 15, or no more than 10 nucleotides long. In some embodiments, the intervening sequence consists of 10 nucleotides. In some embodiments, the intervening sequence comprises the sequence of GCAUAUGACU (SEQ ID NO: 55). In some embodiments, the intervening sequence does not begin with an adenosine nucleotide, and does not end with an adenosine nucleotide. In some embodiments, the first poly(A) sequences comprises at least 15, at least 20, at least 25, or at least 30 consecutive adenosine nucleotides. In some embodiments, the second poly(A) sequences comprises at least 55, at least 60, at least 65, or at least 70 consecutive adenosine nucleotides. In some embodiments, the first poly(A) sequence comprises 30 consecutive adenosine nucleotides. In some embodiments, the second poly(A) sequence comprises 70 adenosine nucleotides. In some embodiments, an mRNA comprises the nucleotide sequence AAAAAAAAAAAAAAAAAAAAAAAAAAAAAGCAUAUGACUAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA (SEQ ID NO: 80). In some embodiments, an mRNA comprises a poly(A) sequence that has a length of 90– 120 nucleotides. In some embodiments, an mRNA comprises a poly(A) sequence that comprises 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 190, or 120 consecutive adenosine nucleotides. In some embodiments, an mRNA comprises a poly(A) sequence that comprises at least 109 consecutive adenosine nucleotides. In some embodiments, an mRNA comprises a poly(A) sequence that comprises 109 consecutive adenosine nucleotides. In some embodiments, an mRNA comprises a poly(A) sequence that consists of 109 consecutive adenosine nucleotides. Self-amplifying RNA Some aspects relate to self-amplifying RNA (e.g., an RNA replicon) encoding a SARS- CoV-2 chimeric protein. An self-amplifying RNA refers to an RNA encoding one or more molecules (e.g., proteins), individually or in conjunction, are capable of replicating the self- amplifying RNA. In some embodiments, the proteins encoded by the self-amplifying RNA are non-structural proteins nsP1, nsP2, nsP3, and nsP4, which form an RNA-dependent RNA polymerase (RdRp), or replicase, that is capable of replicating the self-amplifying RNA. By encoding proteins that are capable of replicating the RNA, a self-amplifying RNA is capable of self-amplification in a cell, provided that the cell can translate the RNA and produce the encoded protein(s). A self-amplifying RNA may be referred to as an RNA replicon. When an RNA replicon or self-amplifying RNA is translated, the one or more encoded viral non-structural proteins are translated. A “viral non-structural protein” is a protein encoded by a virus but that is not part of the virus particle. The viral non-structural proteins, in the context of self-amplifying RNA, replicate the nucleotide sequences encoding the vaccine antigen or therapeutic protein (e.g., SARS-CoV-2 chimeric protein) from the self-amplifying RNA via the sub-genomic viral promoters. Such replication driven by the viral sub-genomic promoter using the viral non- structural proteins enhances the expression level of the encoded protein. In some embodiments, the viral non-structural proteins are from a single-strand positive-sense RNA viruses. In some embodiments, the viral non-structural proteins are from an Alphavirus, belonging to the Togaviridae family. In some embodiments, the alphavirus is Sindbis or Venezuelan equine encephalitis virus. In some embodiments, the viral non-structural protein is an RNA-dependent RNA polymerase (RdRp) polyprotein P1234 (also termed NSP1-4). Upon translation, P1234 is rapidly cleaved into P123 and nsP4 by autoproteolytic activity originating from the nsP2 (proteinase) portion of the polyprotein. Alphaviral RNA synthesis occurs at the plasma membrane of a cell, where the nsPs, together with alphaviral RNA, form membrane invaginations (or “spherules”). These spherules contain dsRNA created by replication of “+” strand viral genomic RNA into “–“ strand anti-genomic RNA. The “–“ strand serves as a template from which additional “+” strand genomic RNA (synthesized from the 5’UTR) or a shorter subsequence of the genomic RNA (termed subgenomic RNA) is synthesized from the subgenomic viral promoter region located near the end of the nonstructural protein ORF. The “+” strand genomic RNA and the subgenomic RNA are exported out of the spherules into the cytoplasm where they are translated by endogenous ribosomes. The exported “+” strand genomic RNA can associate with nsPs and form additional spherules, thus resulting in exponential increase of replicon RNA. The viral non-structural proteins facilitate the replication of the nucleotide sequences encoding the SARS-CoV-2 protein via the subgenomic viral promoters (also referred to as “subgenomic promoters” herein). A “subgenomic viral promoter” refers to a promoter the drives the transcription of subgenomic mRNAs. Typically, an mRNA is transcribed from genomic DNAs and episomal DNAs (e.g., plasmids). Some viruses may transcribe subgenomic mRNAs from a RNA replicon that is produced from its genomic RNA. Many positive-sense RNA viruses produce subgenomic mRNAs as one of the common infection techniques used by these viruses and generally transcribe late viral genes. Subgenomic viral promoters range from 20 nucleotide (Sindbis virus) to over 100 nucleotides (Beet necrotic yellow vein virus) and are usually found upstream of the transcription start. In some embodiments, the subgenomic viral promoter is 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 nucleotides long, or longer. Subgenomic viral promoters have been described in the art, e.g., in PCT Application Publication No. WO 2016 / 040359, and Wagner et al., Nature Chemical Biology, DOI: 10.1038 / s41589-018-0146-9 (2018). Additional Stabilizing Elements RNA (e.g., mRNA), in some embodiments, includes an additional stabilizing element. Stabilizing elements may include, for example, a histone stem-loop. A stem-loop binding protein (SLBP), a 32 kDa protein has been identified. It is associated with the histone stem-loop at the 3'-end of the histone messages in both the nucleus and the cytoplasm. Its expression level is regulated by the cell cycle; it peaks during the S-phase, when histone mRNA levels are also elevated. The protein has been shown to be essential for efficient 3'-end processing of histone pre-mRNA by the U7 snRNP. SLBP continues to be associated with the stem-loop after processing, and then stimulates the translation of mature histone mRNAs into histone proteins in the cytoplasm. The RNA binding domain of SLBP is conserved through metazoa and protozoa; its binding to the histone stem-loop depends on the structure of the loop. The minimum binding site includes at least three nucleotides 5’ and two nucleotides 3 ^ relative to the stem-loop. In some embodiments, an RNA (e.g., mRNA) includes an open reading frame (coding region), a histone stem-loop, and optionally, a poly(A) sequence or polyadenylation signal. The poly(A) sequence or polyadenylation signal generally should enhance the expression level of the encoded protein. The encoded protein, in some embodiments, is not a histone protein, a reporter protein (e.g., Luciferase, GFP, EGFP, β-Galactosidase, EGFP), or a marker or selection protein (e.g., alpha-Globin, Galactokinase and Xanthine:guanine phosphoribosyl transferase (GPT)). In some embodiments, an RNA (e.g., mRNA) includes the combination of a poly(A) sequence or polyadenylation signal and at least one histone stem-loop, even though both represent alternative mechanisms in nature, they act synergistically to increase the protein expression beyond the level observed with either of the individual elements. The synergistic effect of the combination of poly(A) and a histone stem-loop does not depend on the order of the elements or the length of the poly(A) sequence. In some embodiments, an RNA (e.g., mRNA) does not include a histone downstream element (HDE). “Histone downstream element” (HDE) includes a purine-rich polynucleotide stretch of approximately 15 to 20 nucleotides 3′ of naturally-occurring stem-loops, representing the binding site for the U7 snRNA, which is involved in processing of histone pre-mRNA into mature histone mRNA. In some embodiments, the nucleic acid does not include an intron. An RNA (e.g., mRNA) may or may not contain an enhancer and / or promoter sequence, which may be modified or unmodified or which may be activated or inactivated. In some embodiments, the histone stem-loop is generally derived from histone genes and includes an intramolecular base pairing of two neighbored partially or entirely reverse complementary sequences separated by a spacer, consisting of a short sequence, which forms the loop of the structure. The unpaired loop region is typically unable to base pair with either of the stem loop elements. It occurs more often in RNA, as is a key component of many RNA secondary structures but may be present in single-stranded DNA as well. Stability of the stem-loop structure generally depends on the length, number of mismatches or bulges, and base composition of the paired region. In some embodiments, wobble base pairing (non-Watson-Crick base pairing) may result. In some embodiments, the at least one histone stem-loop sequence comprises a length of 15 to 45 nucleotides. In some embodiments, an RNA (e.g., mRNA) has one or more AU-rich sequences removed. These sequences, sometimes referred to as AURES are destabilizing sequences found in the 3 ’UTR. The AURES may be removed from the mRNA. Alternatively, the AURES may remain in the mRNA. Sequence Modification In some embodiments, an open reading frame encoding a protein is codon optimized. Codon optimization methods are known in the art. An open reading frame of any one or more of the sequences may be codon optimized. Codon optimization, in some embodiments, may be used to match codon frequencies in target and host organisms to ensure proper folding; bias GC content to increase RNA (e.g., mRNA) stability or reduce secondary structures; minimize tandem repeat codons or base runs that may impair gene construction or expression; customize transcriptional and translational control regions; insert or remove protein trafficking sequences; remove / add post translation modification sites in encoded protein (e.g., glycosylation sites); add, remove or shuffle protein domains; insert or delete restriction sites; modify ribosome binding sites and RNA (e.g., mRNA) degradation sites; adjust translational rates to allow the various domains of the protein to fold properly; or reduce or eliminate problem secondary structures within the polynucleotide. Codon optimization tools, algorithms and services are known in the art – non-limiting examples include services from GeneArt (Life Technologies), DNA2.0 (Menlo Park CA) and / or proprietary methods. In some embodiments, the open reading frame sequence is optimized using optimization algorithms. In some embodiments, a codon optimized sequence shares less than 95% sequence identity to a naturally-occurring or wild-type sequence open reading frame (e.g., a naturally- occurring or wild-type RNA (e.g., mRNA) sequence encoding a SARS-CoV-2 protein antigen). In some embodiments, a codon optimized sequence shares less than 90% sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type RNA (e.g., mRNA) sequence encoding a SARS-CoV-2 protein). In some embodiments, a codon optimized sequence shares less than 85% sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type RNA (e.g., mRNA) sequence encoding a SARS-CoV-2 protein). In some embodiments, a codon optimized sequence shares less than 80% sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type RNA (e.g., mRNA) sequence encoding a SARS-CoV-2 protein). In some embodiments, a codon optimized sequence shares less than 75% sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type RNA (e.g., mRNA) sequence encoding a SARS-CoV-2 protein). In some embodiments, a codon optimized sequence shares between 65% and 85% (e.g., between about 67% and about 85% or between about 67% and about 80%) sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type RNA (e.g., mRNA) sequence encoding a SARS-CoV-2 protein). In some embodiments, a codon optimized sequence shares between 65% and 75% or about 80% sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type RNA (e.g., mRNA) sequence encoding a SARS-CoV-2 protein). In some embodiments, a codon-optimized sequence encodes an antigen that is as immunogenic as, or more immunogenic than (e.g., at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 100%, or at least 200% more), than a SARS-CoV-2 protein encoded by a non-codon-optimized sequence. When transfected into mammalian host cells, the modified mRNAs have a stability of between 12-18 hours, or greater than 18 hours, e.g., 24, 36, 48, 60, 72, or greater than 72 hours and are capable of being expressed by the mammalian host cells. In some embodiments, a codon optimized RNA (e.g., mRNA) may be one in which the levels of G / C are enhanced. The G / C-content of nucleic acid molecules (e.g., mRNA) may influence the stability of the RNA. RNA (e.g., mRNA) having an increased amount of guanine (G) and / or cytosine (C) residues may be functionally more stable than RNA containing a large amount of adenine (A) and thymine (T) or uracil (U) nucleotides. As an example, WO02 / 098443 discloses a pharmaceutical composition containing an RNA (e.g., mRNA) stabilized by sequence modifications in the translated region. Due to the degeneracy of the genetic code, the modifications work by substituting existing codons for those that promote greater RNA stability without changing the resulting amino acid. The approach is limited to coding regions of the RNA (e.g., mRNA). Some embodiments of mRNAs comprise a sequence with a %G / C content of 30%–80%, 40%–70%, 50%–60%, 35%–50%, 50%–65%, 65%–70%, 40%–45%, 45%–50%, 50%–55%, 55%–70%, 70%–75%, or 75%–80%. In some embodiments, the nucleic acid sequence of the full-length mRNA comprises a %G / C content of 30%–80%, 40%–70%, 50%–60%, 35%–50%, 50%–65%, 65%–70%, 40%–45%, 45%–50%, 50%–55%, 55%–70%, 70%–75%, or 75%–80%. In some embodiments, the mRNA comprises an ORF with a %G / C content from about 30% to about 80%, about 35% to about 70%, about 40% to about 60%, about 45% to about 55%, about 40% to about 70%, about 50% to about 60%, about 35% to about 50%, about 50% to about 50% to about 65%, about 65% to about 70%, about 40% to about 45%, about 45% to about 50%, about 50% to about 55%, about 55% to about 70%, about 70% to about 75%, or about 75% to about 80%. In some embodiments, the mRNA comprises 5′ UTR with a %G / C content from about 30% to about 80%, about 35% to about 70%, about 40% to about 60%, about 45% to about 55%, about 40% to about 70%, about 50% to about 60%, about 35% to about 50%, about 50% to about 50% to about 65%, about 65% to about 70%, about 40% to about 45%, about 45% to about 50%, about 50% to about 55%, about 55% to about 70%, about 70% to about 75%, or about 75% to about 80%. In some embodiments, the mRNA comprises 3′ UTR with a %G / C content from about 30% to about 80%, about 35% to about 70%, about 40% to about 60%, about 45% to about 55%, about 40% to about 70%, about 50% to about 60%, about 35% to about 50%, about 50% to about 50% to about 65%, about 65% to about 70%, about 40% to about 45%, about 45% to about 50%, about 50% to about 55%, about 55% to about 70%, about 70% to about 75%, or about 75% to about 80%. In some embodiments, a modified mRNA comprises a higher %G / C content than a wild-type mRNA sequence. In some embodiments, the %G / C content of the modified mRNA sequence is 2% or more, 3% or more, 4% or more, 5% or more, 6% or more, 7% or more, 8% or more, 9% or more, 10% or more, 12% or more, 15% or more, or 20% or more than the %G / C content of the wild-type RNA sequence. In some embodiments, the %G / C content of the modified ORF sequence is 2% or more, 3% or more, 4% or more, 5% or more, 6% or more, 7% or more, 8% or more, 9% or more, 10% or more, 12% or more, 15% or more, or 20% or more than the %G / C content of the wild-type ORF sequence. In some embodiments, the %G / C content of the modified 5′ UTR sequence is 2% or more, 3% or more, 4% or more, 5% or more, 6% or more, 7% or more, 8% or more, 9% or more, 10% or more, 12% or more, 15% or more, or 20% or more than the %G / C content of the wild-type 3′ UTR sequence. Chemically Modified Nucleotides The compositions comprise, in some embodiments, an RNA having an open reading frame encoding a protein, wherein the nucleic acid comprises nucleotides and / or nucleosides that can be standard (unmodified) or modified as is known in the art. In some embodiments, nucleotides and nucleosides comprise modified nucleotides or nucleosides. Such modified nucleotides and nucleosides can be naturally-occurring modified nucleotides and nucleosides or non-naturally-occurring modified nucleotides and nucleosides. Such modifications can include those at the sugar, backbone, or nucleobase portion of the nucleotide and / or nucleoside as are recognized in the art. In some embodiments, a naturally-occurring modified nucleotide or nucleotide is one as is generally known or recognized in the art. Non-limiting examples of such naturally-occurring modified nucleotides and nucleotides can be found, inter alia, in the widely recognized MODOMICS database. In some embodiments, a non-naturally-occurring modified nucleotide or nucleoside is one as is generally known or recognized in the art. Non-limiting examples of such non-naturally- occurring modified nucleotides and nucleosides can be found, inter alia, in international publication numbers WO2013052523A1; WO2014093924A1; WO2015051173A2; WO2015051169A2; WO2015089511A2; or WO2017153936A1, each of which is herein incorporated by reference. Hence, nucleic acids (e.g., DNA and RNA, such as mRNA) can comprise standard nucleotides and nucleosides, naturally-occurring nucleotides and nucleosides, non-naturally- occurring nucleotides and nucleosides, or any combination thereof. Nucleic acids (e.g., DNA and RNA, such as mRNA), in some embodiments, comprise various (more than one) different types of standard and / or modified nucleotides and nucleosides. In some embodiments, a particular region of a nucleic acid contains one, two or more (optionally different) types of standard and / or modified nucleotides and nucleosides. In some embodiments, a modified RNA (e.g., mRNA) introduced to a cell or organism, exhibits reduced degradation in the cell or organism, respectively, relative to an unmodified nucleic acid comprising standard nucleotides and nucleosides. In some embodiments, a modified RNA (e.g., mRNA) introduced into a cell or organism, may exhibit reduced immunogenicity in the cell or organism, respectively (e.g., a reduced innate response) relative to an unmodified nucleic acid comprising standard nucleotides and nucleosides. Nucleic acids (e.g., RNA, such as mRNA), in some embodiments, comprise non-natural modified nucleotides that are introduced during synthesis or post-synthesis of the nucleic acids to achieve desired functions or properties. The modifications may be present on internucleotide linkages, purine or pyrimidine bases, or sugars. The modification may be introduced with chemical synthesis or with a polymerase enzyme at the terminal of a chain or anywhere else in the chain. Any of the regions of a nucleic acid may be chemically modified. Modified nucleosides and nucleotides may be present in a nucleic acid (e.g., RNA nucleic acids, such as mRNA nucleic acids). A “nucleoside” refers to a compound containing a sugar molecule (e.g., a pentose or ribose) or a derivative thereof in combination with an organic base (e.g., a purine or pyrimidine) or a derivative thereof (also referred to herein as “nucleobase”). A “nucleotide” refers to a nucleoside, including a phosphate group. Modified nucleotides may by synthesized by any useful method, such as, for example, chemically, enzymatically, or recombinantly, to include one or more modified or non-natural nucleosides. Nucleic acids can comprise a region or regions of linked nucleosides. Such regions may have variable backbone linkages. The linkages can be standard phosphodiester linkages, in which case the nucleic acids would comprise regions of nucleotides. Modified nucleotide base pairing encompasses not only the standard adenosine-thymine, adenosine-uracil, or guanosine-cytosine base pairs, but also base pairs formed between nucleotides and / or modified nucleotides comprising non-standard or modified bases, wherein the arrangement of hydrogen bond donors and hydrogen bond acceptors permits hydrogen bonding between a non-standard base and a standard base or between two complementary non-standard base structures, such as, for example, in those nucleic acids having at least one chemical modification. One example of such non-standard base pairing is the base pairing between the modified nucleotide inosine and adenine, cytosine or uracil. Any combination of base / sugar or linker may be incorporated into nucleic acids. In some embodiments, modified nucleobases in nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids) comprise 1-methyl-pseudouridine (m1ψ), 1-ethyl-pseudouridine (e1ψ), 5-methoxy-uridine (mo5U), 5-methyl-cytidine (m5C), 5-methyl-uridine (m5U), and / or pseudouridine (ψ). In some embodiments, modified nucleobases in nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids) comprise 5-methyluridine, 5-methoxymethyl uridine, 5-methylthio uridine, 1-methoxymethyl pseudouridine, 5-methyl cytidine, and / or 5- methoxy cytidine. In some embodiments, the polyribonucleotide includes a combination of at least two (e.g., 2, 3, 4 or more) of any of the aforementioned modified nucleobases, including but not limited to chemical modifications. In some embodiments, a mRNA comprises 1-methyl-pseudouridine (m1ψ) substitutions at one or more or all uridine positions of the nucleic acid. In some embodiments, a mRNA comprises 5-methyl-uridine (5mU) substitutions at one or more or all uridine positions of the nucleic acid. In some embodiments, a mRNA comprises 5-methyl-uridine (5mU) substitutions at one or more or all uridine positions of the nucleic acid and 5-methyl cytidine substitutions at one or more or all cytidine positions of the nucleic acid. In some embodiments, a mRNA comprises 1-methyl-pseudouridine (m1ψ) substitutions at one or more or all uridine positions of the nucleic acid and 5-methyl cytidine substitutions at one or more or all cytidine positions of the nucleic acid. In some embodiments, a mRNA comprises 5-methyl-uridine (5mU) substitutions at one or more or all uridine positions of the nucleic acid and 5-methyl cytidine substitutions at one or more or all cytidine positions of the nucleic acid. In some embodiments, a mRNA comprises pseudouridine (ψ) substitutions at one or more or all uridine positions of the nucleic acid. In some embodiments, a mRNA comprises pseudouridine (ψ) substitutions at one or more or all uridine positions of the nucleic acid and 5-methyl cytidine substitutions at one or more or all cytidine positions of the nucleic acid. In some embodiments, a mRNA comprises unmodified uridine at one or more or all uridine positions of the nucleic acid. In some embodiments, mRNAs are uniformly modified (e.g., fully modified, modified throughout the entire sequence) for a particular modification. For example, a nucleic acid can be uniformly modified with 1-methyl-pseudouridine, meaning that all uridine residues in the mRNA sequence are replaced with 1-methyl-pseudouridine. Similarly, a nucleic acid can be uniformly modified for any type of nucleoside residue present in the sequence by replacement with a modified residue such as those set forth above. The nucleic acids may be partially or fully modified along the entire length of the molecule. For example, one or more or all or a given type of nucleotide (e.g., purine or pyrimidine, or any one or more or all of A, G, U, C) may be uniformly modified in a nucleic acid, or in a predetermined sequence region thereof (e.g., in the mRNA including or excluding the poly(A) tail). In some embodiments, all nucleotides X in a nucleic acid (or in a sequence region thereof) are modified nucleotides, wherein X may be any one of nucleotides A, G, U, C, or any one of the combinations A+G, A+U, A+C, G+U, G+C, U+C, A+G+U, A+G+C, G+U+C or A+G+C. The nucleic acid may contain from about 1% to about 100% modified nucleotides (either in relation to overall nucleotide content, or in relation to one or more types of nucleotide, i.e., any one or more of A, G, U or C) or any intervening percentage (e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to 95%, from 70% to 100%, from 80% to 90%, from 80% to 95%, from 80% to 100%, from 90% to 95%, from 90% to 100%, and from 95% to 100%). It will be understood that any remaining percentage is accounted for by the presence of unmodified A, G, U, or C. The mRNAs may contain at a minimum 1% and at maximum 100% modified nucleotides, or any intervening percentage, such as at least 5% modified nucleotides, at least 10% modified nucleotides, at least 25% modified nucleotides, at least 50% modified nucleotides, at least 80% modified nucleotides, or at least 90% modified nucleotides. For example, the nucleic acids may contain a modified pyrimidine such as a modified uracil or cytosine. In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the uracil in the nucleic acid is replaced with a modified uracil (e.g., a 5-substituted uracil). The modified uracil can be replaced by a compound having a single unique structure or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures). In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the cytosine in the nucleic acid is replaced with a modified cytosine (e.g., a 5-substituted cytosine). The modified cytosine can be replaced by a compound having a single unique structure or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures). Modified nucleotides may include modified nucleobases. For example, an RNA transcript (e.g., mRNA transcript) may include a modified uracil nucleobase selected from pseudouracil (ψ), N1-methylpseudouracil (m1ψ), 1-ethylpseudouracil, 2-thiouracil, 4′-thiouracil, 2-thio-1- methyl-1-deaza-pseudouracil, 2-thio-1-methyl-pseudouracil, 2-thio-5-aza-uracil, 2-thio- dihydropseudouracil, 2-thio-dihydrouracil, 2-thio-pseudouracil, 4-methoxy-2-thio-pseudouracil, 4-methoxy-pseudouracil, 4-thio-1-methyl-pseudouracil, 4-thio-pseudouracil, 5-aza-uracil, dihydropseudouracil, 5-methyluracil, 5-methoxyuracil (mo5U) and 2′-O-methyluracil. In some embodiments, an RNA transcript (e.g., mRNA transcript) includes a modified guanine nucleobase selected from digoxigeninated guanine, 6-thioguanine, 7-deazaguanine, 7-deaza-7- propargylaminoguanine, 8-oxoguanine, araguanine, biotin-16-7-deaza-7-propargylaminoguanine, isoguanine, N2-methylguanine, O6-methylguanine, thienoguanine, and 2,6-daminoguanine. In some embodiments, an RNA transcript may include a modified cytosine nucleobase selected from digoxigeninated cytosine, 2-thiocytosine, 5-aminoallylcytosine, 5-bromocytosine, 5- carboxycytosine, 5-formylcytosine, 5-hydroxycytosine, 5-hydroxymethylcytosine, 5- methoxycytosine, 5-methylcytosine, 5-propargylaminocytosine, 5-propynylcytosine, 6- azacytosine, aracytosine, cyanine 3-5-propargylaminocytosine, cyanine 3-aminoallylcytosine, cyanine 5-6-propargylaminocytosine, cyanine 5-aminoallylcytosine, desthiobiotin-6- aminoallylcytosine, N4-biotin-OBEA-cytosine, N4-methylcytosine, pseudoisocytosine, and thienocytosine. In some embodiments, an RNA transcript (e.g., mRNA transcript) includes a modified adenine nucleobase selected from digoxigeninated adenine, N6-methyladenine, 7- deazaadenine, 7-deaza-7-propargylaminoadenine, 8-azaadenine, 8-azidoadenine, 8- chloroadenine, 8-oxoadenine, araadenine, N1-methyladenine, N6-methyladenine, 3- deazaadenine, 2,6-diaminoadenine, 2-methyl-thio-N6-isopentenyladenine (ms2i6A), 2- methylthio-N6-methyladenine (ms2m6A), N6-(cis-hydroxyisopentenyl)adenine (io6A), 2- methylthio-N6-(cis-hydroxyisopentenyl)adenine (ms2io6A), N6-glycinylcarbamoyladenine (g6A), N6-threonylcarbamoyladenine (t6A), 2-methylthio-N6-threonyl carbamoyladenine (ms2t6A), N6-methyl-N6-threonylcarbamoyladenine (m6t6A), N6- hydroxynorvalylcarbamoyladenine (hn6A), 2-methylthio-N6-hydroxynorvalyl carbamoyladenine (ms2hn6A), N6,N6-dimethyladenine (m62A), and N6-acetyladenine (ac6A). In some embodiments, an RNA transcript (e.g., mRNA transcript) includes a combination of at least two (e.g., 2, 3, 4 or more) of the foregoing modified nucleobases. Modified nucleotides may include modified sugars. For example, an RNA transcript (e.g., mRNA transcript) may include a modified sugar selected from 2′-thioribose, 2′,3′-dideoxyribose, 2′-amino-2′-deoxyribose, 2′ deoxyribose, 2′-azido-2′-deoxyribose, 2′-fluoro-2′-deoxyribose, 2′- O-methylribose, 2′-O-methyldeoxyribose, 3′-amino-2′,3′-dideoxyribose, 3′-azido-2′,3′- dideoxyribose, 3′-deoxyribose, 3′-O-(2-nitrobenzyl)-2′-deoxyribose, 3′-O-methylribose, 5′- aminoribose, 5′-thioribose, 5-nitro-1-indolyl-2′-deoxyribose, 5′-biotin-ribose, 2′-O,4′-C- methylene-linked, 2′-O,4′-C-amino-linked ribose, and 2′-O,4′-C-thio-linked ribose. In some embodiments, an RNA transcript (e.g., mRNA transcript) includes a combination of at least two (e.g., 2, 3, 4 or more) of the foregoing modified sugars. Modified nucleotides may include modified phosphates. A modified phosphate group is a phosphate group that differs from the canonical structure of phosphate. An example of a canonical is shown below: , where R5and R3are atoms or molecules to which the canonical phosphate is bonded. For example, for a phosphate in a nucleic acid sequence, R5may refer to the upstream nucleotide of the nucleic acid, and R3 may refer to the downstream nucleotide of the nucleic acid. The canonical structure of phosphate also refers to structures in which one or more hydroxyl groups of the phosphate are deprotonated, or in which an oxygen atom of the phosphate is bonded to an adjacent nucleotide in a nucleic acid sequence. In some embodiments, an RNA transcript (e.g., mRNA transcript) may include a modified phosphate selected from phosphorothioate (PS), thiophosphate, 5′-O-methylphosphonate, 3′-O-methylphosphonate, 5′-hydroxyphosphonate, hydroxyphosphanate, phosphoroselenoate, selenophosphate, phosphoramidate, carbophosphonate, methylphosphonate, phenylphosphonate, ethylphosphonate, H-phosphonate, guanidinium ring, triazole ring, boranophosphate (BP), methylphosphonate, and guanidinopropyl phosphoramidate. In some embodiments, an RNA transcript (e.g., mRNA transcript) includes a combination of at least two (e.g., 2, 3, 4 or more) of the foregoing modified phosphates. In some embodiments, an mRNA includes N1-methylpseudouridine. In some embodiments, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% of uracil nucleotides in an mRNA comprise N1-methylpseudouridine. In some embodiments, each uracil nucleotide of an mRNA transcript comprises N1- methylpseudouridine. In some embodiments, an mRNA includes 5-methylcytidine. In some embodiments, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% of cytosine nucleotides in an mRNA comprise 5-methylcytidine. In some embodiments, each cytosine nucleotide of an mRNA transcript comprises 5- methylcytidine. In some embodiments, an mRNA includes 5-methyluridine. In some embodiments, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% of uracil nucleotides in an mRNA comprise 5-methyluridine. In some embodiments, each uracil nucleotide of an mRNA transcript comprises 5-methyluridine. In some embodiments, an mRNA includes 5-methylcytidine and 5-methyluridine. In some embodiments, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% of uracil nucleotides in an mRNA comprise 5-methyluridine and at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% of cytosine nucleotides in an mRNA comprise 5-methylcytidine. In some embodiments, each cytosine nucleotide of an mRNA transcript comprises 5-methylcytidine and each uracil nucleotide of an mRNA transcript comprises 5-methyluridine. Unmodified Nucleotides In some embodiments, an RNA (e.g., mRNA) is not chemically modified and comprises the standard ribonucleotides consisting of adenosine, guanosine, cytosine and uridine. In some embodiments, nucleotides and nucleosides comprise standard nucleoside residues such as those present in transcribed RNA (e.g., A, G, C, or U). In some embodiments, nucleotides and nucleosides comprise standard deoxyribonucleosides such as those present in DNA (e.g., dA, dG, dC, or dT). In Vitro Transcription (IVT) cDNA encoding the polynucleotides may be transcribed using an in vitro transcription (IVT) system. In vitro transcription of RNA is known in the art and is described in International Publication WO 2014 / 152027, which is incorporated by reference herein in its entirety. In some embodiments, the RNA is prepared in accordance with any one or more of the methods described in WO 2018 / 053209 and WO 2019 / 036682, each of which is incorporated by reference herein. In some embodiments, the RNA transcript is generated using a non-amplified, linearized DNA template in an in vitro transcription reaction to generate the RNA transcript. In some embodiments, the template DNA is isolated DNA. In some embodiments, the template DNA is cDNA. In some embodiments, the cDNA is formed by reverse transcription of a RNA polynucleotide, for example, but not limited to influenza virus mRNA. In some embodiments, cells, e.g., bacterial cells, e.g., E. coli, e.g., DH-1 cells are transfected with the plasmid DNA template. In some embodiments, the transfected cells are cultured to replicate the plasmid DNA which is then isolated and purified. In some embodiments, the DNA template includes a RNA polymerase promoter, e.g., a T7 promoter located 5 ' to and operably linked to the gene of interest. In some embodiments, an in vitro transcription template encodes a 5′ untranslated (UTR) region, contains an open reading frame, and encodes a 3′ UTR and a poly(A) tail. The particular nucleic acid sequence composition and length of an in vitro transcription template will depend on the mRNA encoded by the template. An in vitro transcription system typically comprises a transcription buffer, nucleotide triphosphates (NTPs), an RNase inhibitor and a polymerase. The NTPs may be manufactured in house, may be selected from a supplier, or may be synthesized. The NTPs may be selected from, but are not limited to, those including natural and unnatural (modified) NTPs. Any number of RNA polymerases or variants may be used in the method. The polymerase may be selected from, but is not limited to, a phage RNA polymerase, e.g., a T7 RNA polymerase, a T3 RNA polymerase, a SP6 RNA polymerase, and / or mutant polymerases such as, but not limited to, polymerases able to incorporate modified nucleic acids and / or modified nucleotides, including chemically modified nucleic acids and / or nucleotides. Some embodiments exclude the use of DNase. In some embodiments, the RNA transcript is capped via enzymatic capping. In some embodiments, the RNA comprises 5' terminal cap, for example, 7mG(5’)ppp(5’)NlmpNp. In some embodiments, the RNA polymerase is an RNA polymerase variant, such as those described in WO 2020 / 172239, incorporated herein by reference in its entirety. RNA polymerase variants include at least one amino acid substitution, relative to the wild type (WT) RNA polymerase. A WT T7 RNA polymerase is represented by SEQ ID NO: 83: MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARFRKMFERQLKAGEVA DNAAAKPLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNT TVQAVASAIGRAIEDEARFGRIRDLEAKHFKKNVEEQLNKRVGHVYKKAFMQVVEADMLSKGL LGGEAWSSWHKEDSIHVGVRCIEMLIESTGMVSLHRQNAGVVGQDSETIELAPEYAEAIATRAGA LAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAINIAQ NTAWKINKKVLAVANVITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKD KARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKP IGKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCF EYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSETVQDIYGIVAKKVNEI LQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSVTKRSVMTLAYGSKEF GFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLA AEVKDKKTGEILRKRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDA HKQESGIAPNFVHSQDGSHLRKTVVWAHEKYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLNLRDILESDFAFA (SEQ ID NO: 83).For example, with reference to WT T7 RNA polymerase having an amino acid sequence of SEQ ID NO: 83, the glycine at position 47 is considered a “wild-type amino acid,” whereas a substitution of the glycine for alanine at position 47 is considered an “amino acid substitution” that has a high-helix propensity. In some embodiments, the RNA polymerase variant is a T7 RNA polymerase variant comprising at least one (one or more) amino acid substitution relative to WT RNA polymerase (e.g., WT T7 RNA polymerase having an amino acid sequence of SEQ ID NO: 83). In some embodiments, a RNA polymerase variant comprises a RNA polymerase that includes an (at least one) amino acid modification causes a loop structure of the RNA polymerase variant to undergo a conformational change to a helix structure as the RNA polymerase variant transitions from an initiation complex to an elongation complex. In some embodiments, the amino acid modification is an amino acid substitution at one or more of positions 42, 43, 44, 45, 46, and 47, relative to the wild-type RNA polymerase, wherein the wild- type RNA polymerase comprises the amino acid sequence of SEQ ID NO: 83. The amino acid substitution, in some embodiments, is a high propensity amino acid substitution. Examples of high-helix propensity amino acids include alanine, isoleucine, leucine, arginine, methionine, lysine, glutamine, and / or glutamate. In some embodiments, the amino acid substitution at position 47 is G47A. In some embodiments, a RNA polymerase variant comprise a RNA polymerase that includes an additional C-terminal amino acid, relative to the wild-type RNA polymerase. The additional C-terminal amino acid, in some embodiments, is selected from glycine, alanine, threonine, proline, glutamine, and serine. In some embodiments, the additional C-terminal amino acid (e.g., at position 884 relative to wild-type RNA polymerase comprising the amino acid sequence of SEQ ID NO: 83) is glycine. Co-transcriptional capping methods may also be used for ribonucleic acid (RNA) synthesis, using an RNA polymerase variant. That is, RNA is produced in a “one-pot” reaction, without the need for a separate capping reaction. Thus, the methods, in some embodiments, comprise reacting a polynucleotide template with a RNA polymerase variant, nucleoside triphosphates, and a cap analog under in vitro transcription reaction conditions to produce RNA transcript. Multivalent Vaccines The compositions may include RNA (e.g., mRNA) or multiple RNAs (e.g., mRNAs) encoding two or more antigens of the same or different species. In some embodiments, composition includes an RNA (e.g., mRNA) or multiple RNAs (e.g., mRNAs) encoding two or more proteins. In some embodiments, the RNA (e.g., mRNA) may encode 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, or more proteins. In some embodiments, two or more different RNA (e.g., mRNA) encoding antigens may be formulated in the same lipid nanoparticle. In some embodiments, two or more different RNA (e.g., mRNA) encoding antigens may be formulated in separate lipid nanoparticles (each RNA (e.g., mRNA) formulated in a single lipid nanoparticle). Lipid nanoparticles may then be combined and administered as a single vaccine composition (e.g., comprising multiple RNAs (e.g., mRNAs) encoding multiple antigens) or may be administered separately. Identification and Ratio Determination (IDR) Sequences In some embodiments, one or more nucleic acids comprises an Identification and Ratio Determination sequence. An Identification and Ratio Determination (IDR) sequence is a sequence of a biological molecule (e.g., nucleic acid or protein) that, when combined with the sequence of a target biological molecule, serves to identify the target biological molecule. Typically, an IDR sequence is a heterologous sequence that is incorporated within or appended to a sequence of a target biological molecule and can be used as a reference to identify the target molecule. Thus, in some embodiments, a nucleic acid (e.g., mRNA) comprises (i) a target sequence of interest (e.g., a coding sequence encoding a therapeutic and / or antigenic peptide or protein); and (ii) a unique IDR sequence. An RNA species (e.g., RNA having a given coding sequence) may comprise an IDR sequence that differs from the IDR sequence of other RNA species (e.g., RNA(s) having different coding sequence(s)). Each IDR sequence thus identifies a particular RNA species, and so the abundance of IDR sequences may be measured to determine the abundance of each RNA species in a composition. Use of distinct IDR sequences to identify RNA species allows for analysis of multivalent RNA compositions (e.g., containing multiple RNA species) containing RNA species with similar coding sequences and / or lengths, which could otherwise be difficult to distinguish using PCR- or chromatography-based analysis of full-length RNAs. Each RNA species in a multivalent RNA composition may comprise an IDR sequence that is not a sequence isomer of an IDR sequence of another RNA species in a multivalent RNA composition (e.g., the IDR sequence does not have the same number of adenosine nucleotides, the same number of cytosine nucleotides, the same number of guanine nucleotides, and the same number of uracil nucleotides, as another IDR sequence in the composition, even if those sequences have different sequences). Having identical nucleotide compositions causes sequence isomers to have the same mass, presenting a challenge to distinguishing sequence isomers using mass-based identification methods (e.g., mass spectrometry). Each RNA species in a multivalent RNA composition may comprise an IDR sequence having a mass that differs from the mass of IDR sequences of each other RNA species in a multivalent RNA composition. For example, the mass of each IDR sequence may differ from the mass of other IDR sequences by at least 9 Da, at least 25 Da, at least 25 Da, or at least 50 Da. Use of IDR sequences with distinct masses allows RNA fragments comprising different IDR sequences to be distinguished using mass-based analysis methods (e.g., mass spectrometry), which do not require reverse transcription, amplification, or sequencing of RNAs. Each RNA species in an RNA composition may comprises an IDR sequence with a different length. For example, each IDR sequence may have a length independently selected from 0 to 25 nucleotides. The length of a nucleic acid influences the rate at which the nucleic acid traverses a chromatography column, and so the use of IDR sequences of different lengths on different RNA species allows RNA fragments having different IDR sequences to be distinguished using chromatography-based methods (e.g., LC-UV). IDR sequences may be chosen such that no IDR sequence comprises a start codon, ‘AUG’. Lack of a start codon in an IDR sequence prevents undesired translation of nucleotide sequences within and / or downstream from the IDR sequence. IDR sequences may be chosen such that no IDR sequence comprises a recognition site for a restriction enzyme. In one example, no IDR sequence comprises a recognition site for XbaI, ‘UCUAG’. Lack of a recognition site for a restriction enzyme (e.g., XbaI recognition site ‘UCUAG’) allows the restriction enzyme to be used in generating and modifying a DNA template for in vitro transcription, without affecting the IDR sequence or sequence of the transcribed RNA. Non-limiting examples of distinct IDR sequences include: GAGAUUGAGUGUAGUGACUAG (SEQ ID NO: 56), GAGAUUGAGUGUAGUGAC (SEQ ID NO: 57), GAGAUUGAGUGUAGUG (SEQ ID NO: 58), GAUUGAGACUACGGG (SEQ ID NO: 59), and CAUAGACACUACG (SEQ ID NO: 60). In some embodiments of the compositions, each mRNA encoding a distinct protein comprises a 3′ UTR comprising a distinct IDR sequence selected from SEQ ID NOs: 56–60. Nucleic Acid Production Chemical Synthesis Nucleic acids may be manufactured in whole or in part using solid phase techniques. Solid-phase chemical synthesis of nucleic acids is an automated method wherein molecules are immobilized on a solid support and synthesized step by step in a reactant solution. Solid-phase synthesis is useful in site-specific introduction of chemical modifications in the nucleic acid sequences. The synthesis of nucleic acids by the sequential addition of monomer building blocks may be carried out in a liquid phase. The synthetic methods discussed above each has its own advantages and limitations. Attempts have been conducted to combine these methods to overcome the limitations. Such combinations of methods are also suitable. The use of solid-phase or liquid-phase chemical synthesis in combination with enzymatic ligation provides an efficient way to generate long chain nucleic acids that cannot be obtained by chemical synthesis alone. Ligation Assembling nucleic acids by a ligase may also be used. DNA or RNA ligases promote intermolecular ligation of the 5’ and 3’ ends of polynucleotide chains through the formation of a phosphodiester bond. Nucleic acids such as chimeric polynucleotides and / or circular nucleic acids may be prepared by ligation of one or more regions or subregions. DNA fragments can be joined by a ligase catalyzed reaction to create recombinant DNA with different functions. Two oligodeoxynucleotides, one with a 5’ phosphoryl group and another with a free 3’ hydroxyl group, serve as substrates for a DNA ligase. Purification Purification of the nucleic acids may include, but is not limited to, nucleic acid clean-up, quality assurance and quality control. Clean-up may be performed by methods known in the arts such as, but not limited to, AGENCOURT® beads (Beckman Coulter Genomics, Danvers, MA), poly-T beads, LNATM oligo-T capture probes (EXIQON® Inc, Vedbaek, Denmark) or HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC- HPLC). The term “purified” when used in relation to a nucleic acid such as a “purified nucleic acid” refers to one that is separated from at least one contaminant. A “contaminant” is any substance that makes another unfit, impure or inferior. Thus, a purified nucleic acid (e.g., DNA and RNA) is present in a form or setting different from that in which it is found in nature, or a form or setting different from that which existed prior to subjecting it to a treatment or purification method. A quality assurance and / or quality control check may be conducted using methods such as, but not limited to, gel electrophoresis, UV absorbance, or analytical HPLC. In some embodiments, the nucleic acids may be sequenced by methods including, but not limited to reverse-transcriptase-PCR. Quantification In some embodiments, the nucleic acids may be quantified in exosomes or when derived from one or more bodily fluid. Bodily fluids include peripheral blood, serum, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid, cerumen, breast milk, broncheoalveolar lavage fluid, semen, prostatic fluid, cowper's fluid or pre-ejaculatory fluid, sweat, fecal matter, hair, tears, cyst fluid, pleural and peritoneal fluid, pericardial fluid, lymph, chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit, vaginal secretions, mucosal secretion, stool water, pancreatic juice, lavage fluids from sinus cavities, bronchopulmonary aspirates, blastocyl cavity fluid, and umbilical cord blood. Alternatively, exosomes may be retrieved from an organ selected from the group consisting of lung, heart, pancreas, stomach, intestine, bladder, kidney, ovary, testis, skin, colon, breast, prostate, brain, esophagus, liver, and placenta. Assays may be performed using construct specific probes, cytometry, qRT-PCR, real-time PCR, PCR, flow cytometry, electrophoresis, mass spectrometry, or combinations thereof while the exosomes may be isolated using immunohistochemical methods such as enzyme linked immunosorbent assay (ELISA) methods. Exosomes may also be isolated by size exclusion chromatography, density gradient centrifugation, differential centrifugation, nanomembrane ultrafiltration, immunoabsorbent capture, affinity purification, microfluidic separation, or combinations thereof. These methods afford the investigator the ability to monitor, in real time, the level of nucleic acids remaining or delivered. This is possible because the nucleic acids, in some embodiments, differ from the endogenous forms due to the structural or chemical modifications. In some embodiments, the nucleic acid may be quantified using methods such as, but not limited to, ultraviolet visible spectroscopy (UV / Vis). A non-limiting example of a UV / Vis spectrometer is a NANODROP® spectrometer (ThermoFisher, Waltham, MA). The quantified nucleic acid may be analyzed in order to determine if the nucleic acid may be of proper size, check that no degradation of the nucleic acid has occurred. Degradation of the nucleic acid may be checked by methods such as, but not limited to, agarose gel electrophoresis, HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC- HPLC), liquid chromatography-mass spectrometry (LCMS), capillary electrophoresis (CE) and capillary gel electrophoresis (CGE). Lipid Compositions In some embodiments, the nucleic acids are formulated as a lipid composition, such as a composition comprising a lipid nanoparticle, a liposome, and / or a lipoplex. In some embodiments, nucleic acids are formulated as lipid nanoparticle (LNP) compositions. Lipid nanoparticles typically comprise amino lipid, non-cationic lipid, structural lipid, and PEG lipid components along with the nucleic acid cargo of interest. The lipid nanoparticles can be generated using components, compositions, and methods as are generally known in the art, see for example PCT / US2016 / 052352; PCT / US2016 / 068300; PCT / US2017 / 037551; PCT / US2015 / 027400; PCT / US2016 / 047406; PCT / US2016 / 000129; PCT / US2016 / 014280; PCT / US2017 / 038426; PCT / US2014 / 027077; PCT / US2014 / 055394; PCT / US2016 / 052117; PCT / US2012 / 069610; PCT / US2017 / 027492; PCT / US2016 / 059575; PCT / US2016 / 069491; PCT / US2016 / 069493; and PCT / US2014 / 66242, all of which are incorporated by reference herein in their entirety. In some embodiments, the lipid nanoparticle comprises at least one ionizable amino lipid, at least one non-cationic lipid, at least one sterol, and / or at least one polyethylene glycol (PEG)- modified lipid. In some embodiments, the lipid nanoparticle comprises a molar ratio of 20-60% ionizable amino lipid, 5-25% non-cationic lipid, 25-55% structural lipid, and 0.5-15% PEG-modified lipid. In some embodiments, the lipid nanoparticle comprises a molar ratio of 20-60% ionizable amino lipid, 5-30% non-cationic lipid, 10-55% structural lipid, and 0.5-15% PEG-modified lipid. In some embodiments, the lipid nanoparticle comprises 40-50 mol% ionizable lipid, optionally 45-50 mol%, for example, 45-46 mol%, 46-47 mol%, 47-48 mol%, 48-49 mol%, or 49-50 mol% for example about 45 mol%, 45.5 mol%, 46 mol%, 46.5 mol%, 47 mol%, 47.5 mol%, 48 mol%, 48.5 mol%, 49 mol%, or 49.5 mol%. In some embodiments, the lipid nanoparticle comprises 20-60 mol% ionizable amino lipid. For example, the lipid nanoparticle may comprise 20-50 mol%, 20-40 mol%, 20-30 mol%, 30-60 mol%, 30-50 mol%, 30-40 mol%, 40-60 mol%, 40-50 mol%, or 50-60 mol% ionizable amino lipid. In some embodiments, the lipid nanoparticle comprises 20 mol%, 30 mol%, 40 mol%, 50 mol%, or 60 mol% ionizable amino lipid. In some embodiments, the lipid nanoparticle comprises 35 mol%, 36 mol%, 37 mol%, 38 mol%, 39 mol%, 40 mol%, 41 mol%, 42 mol%, 43 mol%, 44 mol%, 45 mol%, 46 mol%, 47 mol%, 48 mol%, 49 mol%, 50 mol%, 51 mol%, 52 mol%, 53 mol%, 54 mol%, or 55 mol% ionizable amino lipid. In some embodiments, the lipid nanoparticle comprises 45–55 mole percent (mol%) ionizable amino lipid. For example, lipid nanoparticle may comprise 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, or 55 mol% ionizable amino lipid. Ionizable amino lipids Formula (AI) In some embodiments, the ionizable amino lipid of a lipid nanoparticle is a compound of Formula (AI): ; a wherein Raα, Raβ, Raγ, and Raδare each independently selected from the group consisting of H, C2-12 alkyl, and C2-12 alkenyl; R2and R3are each independently selected from the group consisting of C1-14 alkyl and C2-14alkenyl; R4is selected from the group consisting of -(CH2)nOH, wherein n is selected from the group consisting of 1, 2, 3, 4, and 5, and , wherein denotes a point of attachment; wherein R10is N(R)2; each R is independently selected from the group consisting of C1-6alkyl, C2-3 alkenyl, and H; and n2 is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; each R5is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R6is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; M and M’ are each independently selected from the group consisting of -C(O)O- and -OC(O)-; R’ is a C1-12 alkyl or C2-12 alkenyl; l is selected from the group consisting of 1, 2, 3, 4, and 5; and m is selected from the group consisting of 5, 6, 7, 8, 9, 10, 11, 12, and 13. In some embodiments of the compounds of Formula (AI), R’ais R’branched; is a point of attachment; Raα, Raβ, Raγ, and Raδare each H; R2and R3are each C1-14 alkyl; R4is -(CH2)nOH; n is 2; each R5is H; each R6is H; M and M’ are each - C(O)O-; R’ is a C1-12 alkyl; l is 5; and m is 7. In some embodiments of the compounds of Formula (AI), R’ais R’branched; R’branchedis ; a point of attachment; Raα, Raβ, Raγ, and Raδare each H; R2and R3are each C1-14 alkyl; R4is -(CH2)nOH; n is 2; each R5is H; each R6is H; M and M’ are each - C(O)O-; R’ is a C1-12alkyl; l is 3; and m is 7. of the compounds of Formula (AI), R’ais R’branched; R’branchedis ; denotes a point of attachment; Raαis C2-12alkyl; Raβ, Raγ, and Raδare each H; R2and R3are each C1-14alkyl;6alkyl); n2 is 2; R5is H; each R6is H; M and M’ are each - m is 7. In some embodiments of the compounds of Formula (AI), R’ais R’branched; R’branchedis a point of attachment; Raα, Raβ, and Raδare each H; Raγis C2-12 are C1-14 alkyl; R4is -(CH2)nOH; n is 2; each R5is H; each R6is H; M and M’ are each -C(O)O-; R’ is a C1-12 alkyl; l is 5; and m is 7. In some embodiments, the compound of Formula (AI) is selected from: . In some embodiments, the ionizable amino lipid of Formula (AI) is a compound of (AIa), or its N-oxide, or a salt or isomer thereof, wherein R’ais R’branched; wherein denotes a point of attachment; selected from the group consisting of H, C2-12 alkyl, and C2-12 alkenyl; R2and R3are each independently selected from the group consisting of C1-14 alkyl and C2-14alkenyl; R4is selected from the group consisting of -(CH2)nOH wherein n is selected from the group consisting , wherein denotes a point of attachment; wherein R10is N(R)2; each R is independently selected from the group consisting of C1-6 alkyl, C2-3alkenyl, and H; and n2 is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; each R5is independently selected from the group consisting of C1-3alkyl, C2-3 alkenyl, and H; each R6is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; M and M’ are each independently selected from the group consisting of -C(O)O- and -OC(O)-; R’ is a C1-12alkyl or C2-12alkenyl; l is selected from the group consisting of 1, 2, 3, 4, and 5; and m is selected from the group consisting of 5, 6, 7, 8, 9, 10, 11, 12, and 13. In some embodiments, the ionizable amino lipid of Formula (AI) is a compound of (AIb), or its N-oxide, or a salt or isomer thereof, wherein R’branchedis: ; wherein denotes a point of attachment; wherein Raα, Raβ, Raγ, and Raδare each independently selected from the group consisting of H, C2-12alkyl, and C2-12alkenyl; R2and R3are each independently selected from the group consisting of C1-14 alkyl and C2-14 alkenyl; R4is -(CH2)nOH, wherein n is selected from the group consisting of 1, 2, 3, 4, and 5; each R5is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; each R6is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; M and M’ are each independently selected from the group consisting of -C(O)O- and -OC(O)-; R’ is a C1-12alkyl or C2-12alkenyl; l is selected from the group consisting of 1, 2, 3, 4, and 5; and m is selected from the group consisting of 5, 6, 7, 8, 9, 10, 11, 12, and 13. In some embodiments of Formula (AI) or (AIb), R’ais R’branched; is attachment; Raβ, Raγ, and Raδare each H; R2and R3are each C1-14alkyl; R4is -(CH2)nOH; n is 2; each R5is H; each R6is H; M and M’ are each - C(O)O-; R’ is a C1-12alkyl; l is 5; and m is 7. In some embodiments of Formula (AI) or (AIb), R’ais R’branched; is a point of attachment; Raβ, Raγ, and Raδare each H; R2and R3are each C1-14alkyl; R4is -(CH2)nOH; n is 2; each R5is H; each R6is H; M and M’ are each - C(O)O-; R’ is a C1-12 alkyl; l is 3; and m is 7. In some embodiments of Formula (AI) or (AIb), R’ais R’branched; is ; denotes a point of attachment; Raβand Raδare each H; Raγis C2-12 alkyl; R2and R3are each C1-14alkyl; R4is -(CH2)nOH; n is 2; each R5is H; each R6is H; M and M’ are each -C(O)O-; R’ is a C1-12 alkyl; l is 5; and m is 7. In some embodiments, the ionizable amino lipid of Formula (AI) is a compound of Formula (AIc): its N-oxide, or a salt or isomer thereof, R’brancheddenotes a point of attachment; wherein are selected from the group consisting of H, C2-12alkyl, and C2-12alkenyl; R2and R3are each independently selected from the group consisting of C1-14 alkyl and C2-14 alkenyl; R4is wherein denotes a point of attachment; wherein R10is N(R)2; each R is independently selected from the group consisting of C1-6 alkyl, C2-3 alkenyl, and H; n2 is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; each R5is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R6is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; M and M’ are each independently selected from the group consisting of -C(O)O- and -OC(O)-; R’ is a C1-12alkyl or C2-12alkenyl; l is selected from the group consisting of 1, 2, 3, 4, and 5; and m is selected from the In some embodiments, R’ais R’branched; R’branchedis ; denotes a point of each H; Raαis C2-12alkyl; R2and R3are each C1-14 alkyl; R4is ; denotes a point of attachment; R10is NH(C1-6 alkyl); n2 is 2; each R5is H; each R6is H; M and M’ are each -C(O)O-; R’ is a C1-12alkyl; l is 5; and m is 7. In some embodiments, the compound of Formula (AIc) is: . Formula In some embodiments, the ionizable amino lipid is a compound of Formula (AII): R’bis: ; wherein denotes a point of attachment; Raγand Raδare each independently selected from the group consisting of H, C1-12 alkyl, and C2-12 alkenyl, wherein at least one of Raγand Raδis selected from the group consisting of C1-12alkyl and C2-12alkenyl; Rbγand Rbδare each independently selected from the group consisting of H, C1-12 alkyl, and C2-12 alkenyl, wherein at least one of Rbγand Rbδis selected from the group consisting of C1-12alkyl and C2-12alkenyl; R2and R3are each independently selected from the group consisting of C1-14alkyl and C2-14 alkenyl; R4is wherein n is selected from the group consisting of 1, 2, 3, 4, and 5, and , wherein denotes a point of attachment; wherein R10is N(R)2; each R is independently selected from the group consisting of C1-6alkyl, C2-3alkenyl, and H; and n2 is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; each R’ independently is a C1-12 alkyl or C2-12 alkenyl; Yais a C3-6 carbocycle; R*”ais selected from the group consisting of C1-15alkyl and C2-15alkenyl; and s is 2 or 3; m is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9; l is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9. In some embodiments, the ionizable amino lipid of Formula (AII) is a compound of wherein R’ais R’branchedor R’cyclic; wherein denotes a point of attachment; Raγand Raδare each independently selected from the group consisting of H, C1-12 alkyl, and C2-12alkenyl, wherein at least one of Raγand Raδis selected from the group consisting of C1-12alkyl and C2-12alkenyl; Rbγand Rbδare each independently selected from the group consisting of H, C1-12 alkyl, and C2-12alkenyl, wherein at least one of Rbγand Rbδis selected from the group consisting of C1-12alkyl and C2-12alkenyl; R2and R3are each independently selected from the group consisting of C1-14 alkyl and C2-14 alkenyl; R4is wherein n is selected from the group consisting of 1, 2, 3, 4, and 5, and , wherein denotes a point of attachment; wherein R10is N(R)2; each R is independently selected from the group consisting of C1-6alkyl, C2-3alkenyl, and H; and n2 is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; each R’ independently is a C1-12 alkyl or C2-12 alkenyl; m is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9; l is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9. In some embodiments, the ionizable amino lipid of Formula (AII) is a compound of Formula (AII-b): its N-oxide, or a salt or isomer thereof, wherein R’ais R’branchedor R’cyclic; wherein a point of attachment; Raγand Rbγare each independently selected from the group consisting of C1-12alkyl and C2-12 alkenyl; R2and R3are each independently selected from the group consisting of C1-14alkyl and C2-14alkenyl; R4is selected from the group consisting of -(CH2)nOH wherein n is selected from the group consisting , wherein denotes a point of attachment; wherein R10is N(R)2; each R is independently selected from the group consisting of C1-6 alkyl, C2-3 alkenyl, and H; and n2 is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; each R’ independently is a C1-12alkyl or C2-12alkenyl; m is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9; l is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9. In some embodiments, the ionizable amino lipid of Formula (AII) is a compound of Formula (AII-c): denotes a point of wherein Raγis selected from the group consisting of C1-12alkyl and C2-12alkenyl; R2and R3are each independently selected from the group consisting of C1-14alkyl and C2-14 alkenyl; R4is selected from the group consisting of -(CH2)nOH wherein n is selected from the group consisting , wherein denotes a point of attachment; wherein R10is N(R)2; each R is independently selected from the group consisting of C1-6alkyl, C2-3alkenyl, and H; and n2 is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; R’ is a C1-12 alkyl or C2-12 alkenyl; m is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9; l is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9. In some embodiments, the ionizable amino lipid of Formula (AII) is a compound of Formula : (AII-d), or its N-oxide, or a salt or isomer thereof, R’branchedis: and R’bis: ; wherein denotes a point of attachment; wherein Raγand Rbγare each independently selected from the group consisting of C1-12alkyl and C2-12alkenyl; R4is selected from the group consisting of -(CH2)nOH wherein n is selected from the group consisting , wherein denotes a point of attachment; 2; from the group consisting of C1-6 alkyl, C2-3 alkenyl, and H; and n2 is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; each R’ independently is a C1-12alkyl or C2-12alkenyl; m is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9; l is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9. In some embodiments, the ionizable amino lipid of Formula (AII) is a compound of Formula (AII-e): denotes a point of attachment; wherein Raγis selected from the group consisting of C1-12alkyl and C2-12alkenyl; R2and R3are each independently selected from the group consisting of C1-14 alkyl and C2-14 alkenyl; R4is -(CH2)nOH wherein n is selected from the group consisting of 1, 2, 3, 4, and 5; R’ is a C1-12alkyl or C2-12alkenyl; m is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9; l is selected from 1, 2, 3, 4, 5, 6, 7, 8, and 9. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d), or (AII-e), m and l are each independently selected from 4, 5, and 6. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII-e), m and l are each 5. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d), or (AII-e), each R’ independently is a C1-12alkyl. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII-e), each R’ independently is a C2-5 alkyl. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d), or (AII-e), R’bis: and R2and R3are each independently a C1-14alkyl. In some embodiments of the of Formula (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII-e), R’bis: R3are each independently a C6-10alkyl. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII-e), R’b R2and R3are each a C8alkyl. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d) and R3are each independently a C6-10 alkyl. In some embodiments of the compound of Formula is: embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII-e), ,6alkyl, and R2and R3are each a C8 alkyl. In some embodiments of the of Formula , , , , (AII- d), or , , , are each a , (AII-d), or (AII-e), R’branchedis: , R’bis: , and Raγand Rbγare each a C2-6 alkyl. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d), or (AII-e), m and l are each independently selected from 4, 5, and 6 and each R’ independently is a C1-12alkyl. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII-e), m and l are each 5 and each R’ independently is a C2-5alkyl. In some embodiments of the compound of (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII-e), R’branchedis: independently Raγand Rbγare each a C1-12alkyl. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), l are each 5, each R’ independently is a C2-5 alkyl, and Raγand are each a C2-6 alkyl. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d) l are each independently selected from 4, 5, and 6, R’ is a C1-12alkyl, Raγis a C1-12alkyl and R2and R3are each independently a C6-10alkyl. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d) l are each 5, R’ is a C2-5alkyl, Raγis a C2-6alkyl, and R2and R3are each a C8alkyl. In some embodiments of the compound of (AII), (AII-a), (AII-b), (AII-c), (AII-d), or , , wherein R10is NH(C1-6 alkyl) and n2 is 2. In some embodiments of the of Formula (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII-e), R4 is , R10is NH(CH3) and n2 is 2. c), (AII- d), or (AII-e), R’branchedis: , R’bis: , m and l are each independently selected from 4, 5, and 6, each R’ independently is a C1-12alkyl, Raγand Rbγare each a C1-12alkyl, and R4is wherein R10is NH(C1-6alkyl), and n2 is 2. In some embodiments of the (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII- e), R’branchedis: independently is a C2-5alkyl, Raγand Rbγare each a C2-6alkyl, and R4 , wherein R10is NH(CH3) and n2 is 2. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d) each independently selected from 4, 5, and 6, R’ is a C1-12 alkyl, R2and R3are each independently a C6-10alkyl, Raγis a C1-12alkyl, and R4is , wherein R10is NH(C1-6alkyl) and n2 is 2. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d) l are each 5, R’ is a C2- aγ 2 3 4 5alkyl, R is a C2-6alkyl, R and R are each a C8alkyl, and R , wherein R10is NH(CH3) and n2 is 2. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII- d), or (AII-e), R4is -(CH2)nOH and n is 2, 3, or 4. In some embodiments of the compound of Formula (AII), (AII-a), (AII-b), (AII-c), (AII-d), or (AII-e), R4is -(CH2)nOH and n is 2. c), (AII- d), , , , independently selected from 4, 5, and 6, each R’ independently is a C1-12alkyl, Raγand Rbγare each a C1-12alkyl, R4is -(CH2)nOH, and n is 2, 3, or 4. In some embodiments of the compound of Formula , R’bis: , m and l are each 5, each R’ independently is a C2-5 alkyl, Raγand Rbγare each a C2-6alkyl, R4is -(CH2)nOH, and n is 2. In some embodiments, the ionizable amino lipid of Formula (AII) is a compound of R’branchedis: and R’bis: ; wherein denotes a point of attachment; Raγis a C1-12alkyl; R2and R3are each independently a C1-14alkyl; R4is -(CH2)nOH wherein n is selected from the group consisting of 1, 2, 3, 4, and 5; R’ is a C1-12alkyl; m is selected from 4, 5, and 6; and l is selected from 4, 5, and 6. In some embodiments of the compound of Formula (AII-f), m and l are each 5, and n is 2, 3, or 4. In some embodiments of the compound of Formula (AII-f) R’ is a C2-5 alkyl, Raγis a C2-6 alkyl, and R2and R3are each a C6-10 alkyl. In some embodiments of the compound of Formula (AII-f), m and l are each 5, n is 2, 3, or 4, R’ is a C2-5alkyl, Raγis a C2-6alkyl, and R2and R3are each a C6-10alkyl. In some embodiments, the ionizable amino lipid of Formula (AII) is a compound of Formula (AII-g): Raγis a C2-6 alkyl; R’ is a C2-5alkyl; and R4is selected from the group consisting of -(CH2)nOH wherein n is selected from the group consisting wherein denotes a point of attachment, R10is NH(C1-6alkyl), and n2 is selected from the group consisting of 1, 2, and 3. In some embodiments, the ionizable amino lipid of Formula (AII) is a compound of Formula (AII-h): thereof; wherein Raγand Rbγare each independently a C2-6alkyl; each R’ independently is a C2-5alkyl; and R4is selected from the of - nOH wherein n is selected from the group consisting , wherein denotes a point of attachment, R10is NH(C1-6 alkyl), and n2 is selected from the group consisting of 1, 2, and 3. of the compound of Formula (AII-g) or (AII-h), R4is , wherein R10is NH(CH3) and n2 is 2. In some embodiments of the compound of Formula (AII-g) or (AII-h), R4is -(CH2)2OH. Formula (AIII) In some embodiments, the ionizable amino lipids of a lipid nanoparticle may be one or more of compounds of Formula (AIII): (AIII), or their N-oxides, or salts or isomers thereof, wherein: R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, and -R”M’R’; R2and R3are independently selected from the group consisting of H, C1-14alkyl, C2-14alkenyl, -R*YR”, -YR”, and -R*OR”, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle; R4is selected from the group consisting of hydrogen, a C3-6carbocycle, -(CH2)nQ, -(CH2)nCHQR, -CHQR, -CQ(R)2, and unsubstituted C1-6 alkyl, where Q is selected from a carbocycle, heterocycle, -OR, -O(CH2)nN(R)2, -C(O)OR, -OC(O)R, -CX3, -CX2H, -CXH2, -CN, -N(R)2, -C(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)C(O)N(R)2, -N(R)C(S)N(R)2, -N(R)R8, -N(R)S(O)2R8, -O(CH2)nOR, -N(R)C(=NR9)N(R)2, -N(R)C(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, -N(OR)C(O)R, -N(OR)S(O)2R, -N(OR)C(O)OR, -N(OR)C(O)N(R)2, -N(OR)C(S)N(R)2, -N(OR)C(=NR9)N(R)2, -N(OR)C(=CHR9)N(R)2, -C(=NR9)N(R)2, -C(=NR9)R, -C(O)N(R)OR, and –C(R)N(R)2C(O)OR, and each n is independently selected from 1, 2, 3, 4, and 5; each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; M and M’ are independently selected from -C(O)O-, -OC(O)-, -OC(O)-M”-C(O)O-, -C(O)N(R’)-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -S-S-, an aryl group, and a heteroaryl group, in which M” is a bond, C1-13 alkyl or C2-13 alkenyl; R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; R8is selected from the group consisting of C3-6carbocycle and heterocycle; R9 is selected from the group consisting of H, CN, NO2, C1-6 alkyl, -OR, -S(O)2R, -S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle and heterocycle; each R is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R’ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, -R*YR”, -YR”, and H; each R” is independently selected from the group consisting of C3-15alkyl and C3-15alkenyl; each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl; each Y is independently a C3-6 carbocycle; each X is independently selected from the group consisting of F, Cl, Br, and I; and m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13; and wherein when R4is -(CH2)nQ, -(CH2)nCHQR, –CHQR, or -CQ(R)2, then (i) Q is not -N(R)2when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2. In some embodiments, another subset of compounds of Formula (AIII) includes those in which: R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, and -R”M’R’; R2and R3are independently selected from the group consisting of H, C1-14alkyl, C2-14alkenyl, -R*YR”, -YR”, and -R*OR”, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle; R4is selected from the group consisting of a C3-6carbocycle, -(CH2)nQ, -(CH2)nCHQR, -CHQR, -CQ(R)2, and unsubstituted C1-6alkyl, where Q is selected from a C3-6carbocycle, a 5- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S, -OR, -O(CH2)nN(R)2, -C(O)OR, -OC(O)R, -CX3, -CX2H, -CXH2, -CN, -C(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)C(O)N(R)2, -N(R)C(S)N(R)2, -CRN(R)2C(O)OR, -N(R)R8, -O(CH2)nOR, -N(R)C(=NR9)N(R)2, -N(R)C(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, -N(OR)C(O)R, -N(OR)S(O)2R, -N(OR)C(O)OR, -N(OR)C(O)N(R)2, -N(OR)C(S)N(R)2, -N(OR)C(=NR9)N(R)2, -N(OR)C(=CHR9)N(R)2, -C(=NR9)N(R)2, -C(=NR9)R, -C(O)N(R)OR, and a 5- to 14-membered heterocycloalkyl having one or more heteroatoms selected from N, O, and S which is substituted with one or more substituents selected from oxo (=O), OH, amino, mono- or di-alkylamino, and C1-3alkyl, and each n is independently selected from 1, 2, 3, 4, and 5; each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; each R6is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; M and M’ are independently selected from -C(O)O-, -OC(O)-, -C(O)N(R’)-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -S-S-, an aryl group, and a heteroaryl group; R7is selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; R8is selected from the group consisting of C3-6carbocycle and heterocycle; R9 is selected from the group consisting of H, CN, NO2, C1-6 alkyl, -OR, -S(O)2R, -S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle and heterocycle; each R is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R’ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, -R*YR”, -YR”, and H; each R” is independently selected from the group consisting of C3-14alkyl and C3-14alkenyl; each R* is independently selected from the group consisting of C1-12alkyl and C2-12alkenyl; each Y is independently a C3-6 carbocycle; each X is independently selected from the group consisting of F, Cl, Br, and I; and m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13, or salts or isomers thereof. In some embodiments, another subset of compounds of Formula (AIII) includes those in which: R1is selected from the group consisting of C5-30alkyl, C5-20alkenyl, -R*YR”, -YR”, and -R”M’R’; R2and R3are independently selected from the group consisting of H, C1-14alkyl, C2-14alkenyl, -R*YR”, -YR”, and -R*OR”, or R2and R3, together with the atom to which they are attached, form a heterocycle or carbocycle; R4 is selected from the group consisting of a C3-6 carbocycle, -(CH2)nQ, -(CH2)nCHQR, -CHQR, -CQ(R)2, and unsubstituted C1-6alkyl, where Q is selected from a C3-6carbocycle, a 5- to 14-membered heterocycle having one or more heteroatoms selected from N, O, and S, -OR, -O(CH2)nN(R)2, -C(O)OR, -OC(O)R, -CX3, -CX2H, -CXH2, -CN, -C(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)C(O)N(R)2, -N(R)C(S)N(R)2, -CRN(R)2C(O)OR, -N(R)R8, -O(CH2)nOR, -N(R)C(=NR9)N(R)2, -N(R)C(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, -N(OR)C(O)R, -N(OR)S(O)2R, -N(OR)C(O)OR, -N(OR)C(O)N(R)2, -N(OR)C(S)N(R)2, -N(OR)C(=NR9)N(R)2, -N(OR)C(=CHR9)N(R)2, -C(=NR9)R, -C(O)N(R)OR, and -C(=NR9)N(R)2, and each n is independently selected from 1, 2, 3, 4, and 5; and when Q is a 5- to 14-membered heterocycle and (i) R4 is -(CH2)nQ in which n is 1 or 2, or (ii) R4 is -(CH2)nCHQR in which n is 1, or (iii) R4 is -CHQR, and -CQ(R)2, then Q is either a 5- to 14-membered heteroaryl or 8- to 14-membered heterocycloalkyl; each R5is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; M and M’ are independently selected from -C(O)O-, -OC(O)-, -C(O)N(R’)-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -S-S-, an aryl group, and a heteroaryl group; R7is selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; R8is selected from the group consisting of C3-6carbocycle and heterocycle; R9 is selected from the group consisting of H, CN, NO2, C1-6 alkyl, -OR, -S(O)2R, -S(O)2N(R)2, C2-6alkenyl, C3-6carbocycle and heterocycle; each R is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R’ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, -R*YR”, -YR”, and H; each R” is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl; each R* is independently selected from the group consisting of C1-12alkyl and C2-12alkenyl; each Y is independently a C3-6 carbocycle; each X is independently selected from the group consisting of F, Cl, Br, and I; and m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13, or salts or isomers thereof. In some embodiments, another subset of compounds of Formula (AIII) includes those in which: R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, and -R”M’R’; R2and R3are independently selected from the group consisting of H, C1-14alkyl, C2-14alkenyl, -R*YR”, -YR”, and -R*OR”, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle; R4is selected from the group consisting of a C3-6carbocycle, -(CH2)nQ, -(CH2)nCHQR, -CHQR, -CQ(R)2, and unsubstituted C1-6alkyl, where Q is selected from a C3-6carbocycle, a 5- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S, -OR, -O(CH2)nN(R)2, -C(O)OR, -OC(O)R, -CX3, -CX2H, -CXH2, -CN, -C(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)C(O)N(R)2, -N(R)C(S)N(R)2, -CRN(R)2C(O)OR, -N(R)R8, -O(CH2)nOR, -N(R)C(=NR9)N(R)2, -N(R)C(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, -N(OR)C(O)R, -N(OR)S(O)2R, -N(OR)C(O)OR, -N(OR)C(O)N(R)2, -N(OR)C(S)N(R)2, -N(OR)C(=NR9)N(R)2, -N(OR)C(=CHR9)N(R)2, -C(=NR9)R, -C(O)N(R)OR, and -C(=NR9)N(R)2, and each n is independently selected from 1, 2, 3, 4, and 5; each R5is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; M and M’ are independently selected from -C(O)O-, -OC(O)-, -C(O)N(R’)-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -S-S-, an aryl group, and a heteroaryl group; R7is selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; R8 is selected from the group consisting of C3-6 carbocycle and heterocycle; R9 is selected from the group consisting of H, CN, NO2, C1-6 alkyl, -OR, -S(O)2R, -S(O)2N(R)2, C2-6alkenyl, C3-6carbocycle and heterocycle; each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; each R’ is independently selected from the group consisting of C1-18alkyl, C2-18alkenyl, -R*YR”, -YR”, and H; each R” is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl; each R* is independently selected from the group consisting of C1-12alkyl and C2-12alkenyl; each Y is independently a C3-6 carbocycle; each X is independently selected from the group consisting of F, Cl, Br, and I; and m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13, or salts or isomers thereof. In some embodiments, another subset of compounds of Formula (AIII) includes those in which R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, and -R”M’R’; R2and R3are independently selected from the group consisting of H, C2-14alkyl, C2-14alkenyl, -R*YR”, -YR”, and -R*OR”, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle; R4is -(CH2)nQ or -(CH2)nCHQR, where Q is -N(R)2, and n is selected from 3, 4, and 5; each R5is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; M and M’ are independently selected from -C(O)O-, -OC(O)-, -C(O)N(R’)-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -S-S-, an aryl group, and a heteroaryl group; R7is selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R’ is independently selected from the group consisting of C1-18alkyl, C2-18alkenyl, -R*YR”, -YR”, and H; each R” is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl; each R* is independently selected from the group consisting of C1-12alkyl and C1-12alkenyl; each Y is independently a C3-6 carbocycle; each X is independently selected from the group consisting of F, Cl, Br, and I; and m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13, or salts or isomers thereof. In some embodiments, another subset of compounds of Formula (AIII) includes those in which R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, and -R”M’R’; R2and R3are independently selected from the group consisting of C1-14alkyl, C2-14alkenyl, -R*YR”, -YR”, and -R*OR”, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle; R4is selected from the group consisting of -(CH2)nQ, -(CH2)nCHQR, -CHQR, and -CQ(R)2, where Q is -N(R)2, and n is selected from 1, 2, 3, 4, and 5; each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; each R6is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; M and M’ are independently selected from -C(O)O-, -OC(O)-, -C(O)N(R’)-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -S-S-, an aryl group, and a heteroaryl group; R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; each R is independently selected from the group consisting of C1-3alkyl, C2-3alkenyl, and H; each R’ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, -R*YR”, -YR”, and H; each R” is independently selected from the group consisting of C3-14alkyl and C3-14alkenyl; each R* is independently selected from the group consisting of C1-12alkyl and C1-12alkenyl; each Y is independently a C3-6 carbocycle; each X is independently selected from the group consisting of F, Cl, Br, and I; and m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13, or salts or isomers thereof. In certain embodiments, a subset of compounds of Formula (AIII) includes those of Formula (AIII-A): (AIII-A), or its N-oxide, or a salt or isomer thereof, wherein l is selected from 1, 2, 3, 4, and 5; m is selected from 5, 6, 7, 8, and 9; M1 is a bond or M’; R4 is hydrogen, unsubstituted C1-3alkyl, or -(CH2)nQ, in which Q is -OH, -NHC(S)N(R)2, -NHC(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)R8,-NHC(=NR9)N(R)2, -NHC(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M’ are independently selected from -C(O)O-, -OC(O)-, -OC(O)-M”-C(O)O-, -C(O)N(R’)-, -P(O)(OR’)O-, -S-S-, an aryl group, and a heteroaryl group,; and R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl. For example, m is 5, 7, or 9. For example, Q is OH, -NHC(S)N(R)2, or -NHC(O)N(R)2. For example, Q is -N(R)C(O)R, or -N(R)S(O)2R. In certain embodiments, a subset of compounds of Formula (AIII) includes those of Formula (AIII-B): (AIII-B), or its N-oxide, or a salt or isomer thereof in which all are as For example, m is selected from 5, 6, 7, 8, and 9; R4is hydrogen, unsubstituted C1-3alkyl, or -(CH2)nQ, in which Q is H, -NHC(S)N(R)2, -NHC(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)R8, -NHC(=NR9)N(R)2, -NHC(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M’ are independently selected from -C(O)O-, -OC(O)-, -OC(O)-M”-C(O)O-, -C(O)N(R’)-, -P(O)(OR’)O-, -S-S-, an aryl group, and a heteroaryl group; and R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl. For example, m is 5, 7, or 9. For example, Q is OH, -NHC(S)N(R)2, or -NHC(O)N(R)2. For example, Q is -N(R)C(O)R, or -N(R)S(O)2R. In certain embodiments, a subset of compounds of Formula (AIII) includes those of Formula (AIII-C): (AIII-C), or its N-oxide, or a salt or isomer thereof, wherein l is selected from 1, 2, 3, 4, and 5; M1 is a bond or M’; R4 is hydrogen, unsubstituted C1- 3 alkyl, or -(CH2)nQ, in which n is 2, 3, or 4, and Q is OH, -NHC(S)N(R)2, -NHC(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)R8, -NHC(=NR9)N(R)2, -NHC(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M’ are independently selected from -C(O)O-, -OC(O)-, -OC(O)-M”-C(O)O-, -C(O)N(R’)-, -P(O)(OR’)O-, -S-S-, an aryl group, and a heteroaryl group; and R2and R3are independently selected from the group consisting of H, C1-14alkyl, and C2-14alkenyl. In (AIII) are of Formula (AIII-D), (AIII-D), or their N-oxides, or salts or isomers thereof, wherein R4 is as described in this “Lipid Compositions” section. In another embodiment, the compounds of Formula (AIII) are of Formula (AIII-E), their N-oxides, or salts or isomers section. In another embodiment, the compounds of Formula (AIII) are of Formula (AIII-F) or (AIII-G): their N-oxides, or salts or isomers thereof, wherein R4is as described in this “Lipid Compositions” section. In another embodiment, the compounds of Formula (AIII) are of Formula (AIII-H): their N-oxides, or salts or isomers thereof, wherein M is -C(O)O- or –OC(O)-, M” is C1-6alkyl or C2-6alkenyl, R2and R3are independently selected from the group consisting of C5-14alkyl and C5-14alkenyl, and n is selected from 2, 3, and 4. In a further embodiment, the compounds of Formula (AIII) are of Formula (AIII-I): (AIII-I), or their N-oxides, or salts or isomers thereof, wherein n is 2, 3, or 4; and m, R’, R”, and R2through R6are as described in this “Lipid Compositions” section. For example, each of R2 and R3 may be independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl. In some embodiments, an ionizable amino lipid comprises a compound having structure: (Compound 1). In some embodiments, an ionizable amino lipid comprises a compound having structure: . In a further embodiment, the compounds of Formula (AIII) are of Formula (AIII-J), (AIII-J), or their N-oxides, or salts or isomers thereof, wherein l is selected from 1, 2, 3, 4, and 5; m is selected from 5, 6, 7, 8, and 9; M1is a bond or M’; M and M’ are independently selected from -C(O)O-, -OC(O)-, -OC(O)-M”-C(O)O-, -C(O)N(R’)-, -P(O)(OR’)O-, -S-S-, an aryl group, and a heteroaryl group; and R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl. For example, M” is C1-6 alkyl (e.g., C1-4alkyl) or C2-6alkenyl (e.g. C2-4alkenyl). For example, R2and R3are independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl. In some embodiments, the ionizable amino lipids are one or more of the compounds described in U.S. Application Nos. 62 / 220,091, 62 / 252,316, 62 / 253,433, 62 / 266,460, 62 / 333,557, 62 / 382,740, 62 / 393,940, 62 / 471,937, 62 / 471,949, 62 / 475,140, and 62 / 475,166, and PCT Application No. PCT / US2016 / 052352. The central amine moiety of a lipid according to Formula (AIII), (AIII-A), (AIII-B), (AIII-C), (AIII-D), (AIII-E), (AIII-F), (AIII-G), (AIII-H), (AIII-I), or (AIII-J) may be protonated at a physiological pH. Thus, a lipid may have a positive or partial positive charge at physiological pH. Such amino lipids may be referred to as cationic lipids, ionizable lipids, cationic amino lipids, or ionizable amino lipids. Amino lipids may also be zwitterionic, i.e., neutral molecules having both a positive and a negative charge. Formula (AIV) In some embodiments, the ionizable amino lipids of a lipid nanoparticle may be one or more of compounds of formula (AIV), t is 1 or 2; A1 and A2 are each independently selected from CH or N; Z is CH2or absent wherein when Z is CH2, the dashed lines (1) and (2) each represent a single bond; and when Z is absent, the dashed lines (1) and (2) are both absent; R1, R2, R3, R4, and R5 are independently selected from the group consisting of C5-20 alkyl, C5-20alkenyl, -R”MR’, -R*YR”, -YR”, and -R*OR”; RX1and RX2are each independently H or C1-3alkyl; each M is independently selected from the group consisting of -C(O)O-, -OC(O)-, -OC(O)O-, -C(O)N(R’)-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -C(O)S-, -SC(O)-, an aryl group, and a heteroaryl group; M* is C1-C6 alkyl, W1and W2are each independently selected from the group consisting of -O- and -N(R6)-; each R6is independently selected from the group consisting of H and C1-5alkyl; X1, X2, and X3are independently selected from the group consisting of a bond, -CH2-, -(CH2)2-, -CHR-, -CHY-, -C(O)-, -C(O)O-, -OC(O)-, -(CH2)n-C(O)-, -C(O)-(CH2)n-, -(CH2)n-C(O)O-, -OC(O)-(CH2)n-, -(CH2)n-OC(O)-, -C(O)O-(CH2)n-, -CH(OH)-, -C(S)-, and -CH(SH)-; each Y is independently a C3-6 carbocycle; each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl; each R is independently selected from the group consisting of C1-3 alkyl and a C3-6 carbocycle; each R’ is independently selected from the group consisting of C1-12alkyl, C2-12alkenyl, and H; each R” is independently selected from the group consisting of C3-12 alkyl, C3-12 alkenyl and -R*MR’; and n is an integer from 1-6; wherein when ring , then i) at least one of X1, X2, and X3is not -CH2-; and / or ii) at least one of R1, R2, R3, R4, and R5is -R”MR’. In some embodiments, the compound is of any of formulae (AIVa)-(AIVh): , (AIVd), In some embodiments, the ionizable amino lipid is a salt thereof. The central amine moiety of a lipid according to Formula (AIV), (AIVa), (AIVb), (AIVc), (AIVd), (AIVe), (AIVf), (AIVg), or (AIVh) may be protonated at a physiological pH. Thus, a lipid may have a positive or partial positive charge at physiological pH. Formula (AV) In some the comprises a lipid having the structure: (AV), or a pharmaceutically acceptable salt, tautomer, or stereoisomer thereof, wherein: R1is optionally substituted C1-C24 alkyl or optionally substituted C2-C24 alkenyl; R2and R3are each independently optionally substituted C1-C36 alkyl; R4and R5are each independently optionally substituted C1-C6alkyl, or R4and R5join, along with the N to which they are attached, to form a heterocyclyl or heteroaryl; L1, L2, and L3are each independently optionally substituted C1-CI 8alkylene; G1is a direct bond, -(CH2)nO(C=O)-, -(CH2)n(C=O)O-, or -(C=O)-; G2and G3are each independently -(C=O)O- or -O(C=O)-; and n is an integer greater than 0. Formula (AVI) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: acceptable salt, tautomer, or stereoisomer thereof, wherein: G1is -N(R3)R4or -OR5; R1is optionally substituted branched, saturated or unsaturated C12-C36 alkyl; R2is optionally substituted branched or unbranched, saturated or unsaturated C12-C36 alkyl when L is -C(=O)-; or R2is optionally substituted branched or unbranched, saturated or unsaturated C4-C36alkyl when L is C6-C12alkylene, C6-C12alkenylene, or C2-C6alkynylene; R3and R4are each independently H, optionally substituted branched or unbranched, saturated or unsaturated C1-C6alkyl; or R3and R4are each independently optionally substituted branched or unbranched, saturated or unsaturated C1-C6alkyl when L is C6-C12alkylene, C6- C12 alkenylene, or C2-C6 alkynylene; or R3and R4, together with the nitrogen to which they are attached, join to form a heterocyclyl; R5is H or optionally substituted C1-C6alkyl; L is -C(=O)-, C6-C 12 alkylene, C6-C12 alkenylene, or C2-C6 alkynylene; and n is an integer from 1 to 12. Formula (AVII) In some embodiments, the comprises a lipid having the structure: (AVII), or a pharmaceutically acceptable salt thereof, wherein: each R1ais independently hydrogen, R1c, or R1d; each R1bis independently R1cor R1d; each R1cis independently –[CH2]2C(O)X1R3; each R1dIs independently -C(O)R4; each R2is independently -[C(R2a)2]cR2b; each R2ais independently hydrogen or C1-C6alkyl; R2bis -N(L1-B)2; -(OCH2CH2)6OH; or -(OCH2CH2)bOCH3; each R3and R4is independently C6-C30 aliphatic; each I.3is independently C1-C10alkylene; each B is independently hydrogen or an ionizable nitrogen-containing group; each X1is independently a covalent bond or O; each a is independently an integer of 1-10; each b is independently an integer of 1-10; and each c is independently an integer of 1-10. Formula (AVIII) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: pharmaceutically acceptable salt, prodrug or stereoisomer thereof, wherein: X is N, and Y is absent; or X is CR, and Y is NR; L1is -O(C-O)R1, -(C=O)OR1, -C(=O)R1, -OR1, -S(O)xR1, -S-SR1, -C(=O)SR1, -SC(=O)R1, -NRaC(=O)R1, -C(=O)NRbRc, -NRaC(=O)NRbRc, -OC(=O)NRbRc, or -NRaC(=O)OR1; L2is -O(C=O)R2, -(C=O)OR2, -C(=O)R2, -OR2, -S(O)xR2, -S-SR2, -C(=O)SR2, -SC(=O)R2, -NRdC(=O)R2, -C(=O)NReRf, -NRdC(=O)NReRf, -OC(=O)NReRf; -NRdC(=O)OR2or a direct bond to R2; L3is -O(C=O)R3or -(C=O)OR3; G1and G2are each independently C2-C12 alkylene or C2-C12 alkenylene; G3is C1-C24alkylene, C2-C24alkenylene, C1-C24heteroalkylene or C2-C24heteroalkenylene when X is CR, and Y is NR; and G3is C1-C24 heteroalkylene or C2-C24 heteroalkenylene when X is N, and Y is absent; Ra, Rb, Rdand Reare each independently H or C1-C12alkyl or C1-C12alkenyl; Rcand Rfare each independently C1-C12alkyl or C2-C12alkenyl; each R is independently H or C1-C12 alkyl; R1, R2and R3are each independently C1-C24 alkyl or C2-C24 alkenyl; and x is 0, 1 or 2, and wherein each alkyl, alkenyl, alkylene, alkenylene, heteroalkylene and heteroalkenylene is independently substituted or unsubstituted unless otherwise specified. Formula (AIX) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: pharmaceutically acceptable salt, tautomer, or L1and L2are each independently -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, -SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, -NRaC(=O)NRa-, -OC(=O)NRa-, -NRaC(=O)O- or a direct bond; G1is C1-C2alkylene, -(C=O)-, -O(C=O)-, -SC(=O)-, -NRaC(=O)- or a direct bond; G2is -C(O)-, -(CO)O-, -C(=O)S-, -C(=O)NRa- or a direct bond; G3is C1-C6 alkylene; Rais H or C1-C12alkyl; R1aand R1bare, at each occurrence, independently either: (a) H or C1-C12alkyl; or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond; R2aand R2bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R2ais H or C1-C12alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond; R3aand R3bare, at each occurrence, independently either (a): H or C1-C12 alkyl; or (b) R3ais H or C1-C12alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R and the carbon atom to which it is bound to form a carbon-carbon double bond; R4aand R4bare, at each occurrence, independently either: (a) H or C1-C12alkyl; or (b) R4ais H or C1-C12alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond; R5and R6are each independently H or methyl; R7is H or C1-C20 alkyl; R8is OH, -N(R9)(C=O)R10, -(C=O)NR9R10, -NR9R10, -(C=0)0R"1or -O(C=O)R", provided that G3is C4-C6alkylene when R8is -NR9R10, R9and R10are each independently H or C1-C12 alkyl; R" is aralkyl; a, b, c and d are each independently an integer from 1 to 24; and x is 0, 1 or 2, wherein each alkyl, alkylene and aralkyl is optionally substituted. Formula (AX) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: pharmaceutically acceptable salt, prodrug or stereoisomer thereof, wherein: X and X' are each independently N or CR; Y and Y' are each independently absent, -O(C=O)-, -(C=O)O- or NR, provided that: a) Y is absent when X is N; b) Y' is absent when X' is N; c) Y is -O(C=O)-, -(C=O)O- or NR when X is CR; and d) Y' is -O(C=O)-, -(C=O)O- or NR when X' is CR, L1and L1'are each independently -O(C=O)R', -(C=O)OR' , -C(=O)R', -OR1, -S(O)zR', -S- SR1, -C(=O)SR', -SC(=O)R', -NRaC(=O)R', -C(=O)NRbRc, -NRaC(=O)NRbRc, -OC(=O)NRbRcor -NRaC(=O)OR'; L2and L2’are each independently -O(C=O)R2, -(C=O)OR2, -C(=O)R2, -OR2, -S(O)zR2, - R2, -NRdC(=O)R2, -C(=O)NReRf, -NRdC(=O)NReRf, - OR2or a direct bond to R2; are each independently C2-C12 alkylene or C2-C12 alkenylene; G is C2-C24heteroalkylene or C2-C24heteroalkenylene; Ra, Rb, Rdand Reare, at each occurrence, independently H, C1-C12alkyl or C2-C12alkenyl; Rcand Rfare, at each occurrence, independently C1-C12 alkyl or C2-C12 alkenyl; R is, at each occurrence, independently H or C1-C12alkyl; R1and R2are, at each occurrence, independently branched C6-C24 alkyl or branched C6-C24 alkenyl; z is 0, 1 or 2, and wherein each alkyl, alkenyl, alkylene, alkenylene, heteroalkylene and heteroalkenylene is independently substituted or unsubstituted unless otherwise specified. Formula (AXI) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: - - - - G1and G2are each independently C2-C12alkylene or C2-C12alkenylene; G3is C1-C24 alkylene, C2-C24 alkenylene, C3-C8 cycloalkylene or C3-C8 cycloalkenylene; Ra, Rb, Rdand Reare each independently H or C1-C12alkyl or C1-C12alkenyl; Rcand Rfare each independently C1-C12alkyl or C2-C12alkenyl; R1and R2are each independently branched C6-C24 alkyl or branched C6-C24 alkenyl; R3is -N(R4)R5; R4is C1-C12alkyl; R5is substituted C1-C12 alkyl; and x is 0, 1 or 2, and wherein each alkyl, alkenyl, alkylene, alkenylene, cycloalkylene, cycloalkenylene, aryl and aralkyl is independently substituted or unsubstituted unless otherwise specified. In some embodiments, the lipid nanoparticle comprises a lipid having the structure: or , or a pharmaceutically acceptable salt, prodrug or stereoisomer thereof, wherein: L1is -O(C=O)R1, -(C=O)OR1, -C(=O)R1, -OR1, -S(O)xR1, -S-SR1, -C(=O)SR1, -SC(=O)R1, -NRaC(=O)R1, -C(=O)NRbRc, -NRaC(=O)NRbRc, -OC(=O)NRbRcor -NRaC(=O)OR1; L2is -O(C=O)R2, -(C=O)OR2, -C(=O)R2, -OR2, -S(O)xR2, -S-SR2, -C(=O)SR2, -SC(=O)R2, -NRdC(=O)R2, -C(=O)NReRf, -NRdC(=O)NReRf, -OC(=O)NReRf, -NRdC(=O)OR2or a direct bond to R2; G1aand G2bare each independently C2-C12alkylene or C2-C12alkenylene; G1band G2bare each independently C1-C12alkylene or C2-C12alkenylene; G3is C1-C24alkylene, C2-C24alkenylene, C3-C8cycloalkylene or C3-C8cycloalkenylene; Ra, Rb, Rdand Reare each independently H or C1-C12 alkyl or C2-C12 alkenyl; Rcand Rfare each independently C1-C12 alkyl or C2-C12 alkenyl; R1and R2are each independently branched C6-C24alkyl or branched C6-C24alkenyl; R3ais -C(=O)N(R4a)R5aor -C(=O)OR6; R3bis -NR4bC(=O)R5b; R4ais C1-C12alkyl; R4bis H, C1-C12alkyl or C2-C12alkenyl; R5ais H, C1-C8 alkyl or C2-C8 alkenyl; R5bis C2-C12alkyl or C2-C12alkenyl when R4bis H; or R5bis C1-C12alkyl or C2-C12alkenyl when R4bis C1-C12alkyl or C2-C12alkenyl; R6is H, aryl or aralkyl; and x is 0, 1 or 2, and wherein each alkyl, alkenyl, alkylene, alkenylene, cycloalkylene, cycloalkenylene, aryl and aralkyl is independently substituted or unsubstituted. Formula (AXII) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: acceptable salt, prodrug or stereoisomer thereof, wherein: G1is -OH, -R3R4, -(C=O)R5or -R3(C=O)R5; G2is -CH2- or -(C=O)-; R is, at each occurrence, independently H or OH; R1and R2are each independently optionally substituted branched, saturated or unsaturated C12-C36 alkyl; R3and R4are each independently H or optionally substituted straight or branched, saturated or unsaturated C1-C6 alkyl; R5is optionally substituted straight or branched, saturated or unsaturated C1-C6 alkyl; and n is an integer from 2 to 6. Formula (AXIII) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: pharmaceutically acceptable salt, prodrug or one of G1or G2is, at each occurrence, -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O) , -S-S-, -C(=O)S-, SC(=O)-, -N(Ra)C(=O)-, -C(=O)N(Ra)-, -N(Ra)C(=O)N(Ra)-, -OC(=O)N(Ra)- or -N(Ra)C(=O)O-, and the other of G1or G2is, at each occurrence, -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O) , -S-S-, -C(=O)S-, -SC(=O)-, -N(Ra)C(=O)-, -C(=O)N(Ra)-, -N(Ra)C(=O)N(Ra)-, -OC(=O)N(Ra)- or -N(Ra)C(=O)O- or a direct bond; L is, at each occurrence, ~O(C=O)-, wherein ~ represents a covalent bond to X; X is CRa; Z is alkyl, cycloalkyl or a monovalent moiety comprising at least one polar functional group when n is 1; or Z is alkylene, cycloalkylene or a polyvalent moiety comprising at least one polar functional group when n is greater than 1; Rais, at each occurrence, independently H, C1-C12 alkyl, C1-C12 hydroxylalkyl, C1-C12 aminoalkyl, C1-C12alkylaminylalkyl, C1-C12alkoxyalkyl, C1-C12alkoxycarbonyl, C1-C12alkylcarbonyloxy, C1-C12 alkylcarbonyloxyalkyl or C1-C12 alkylcarbonyl; R is, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R together with the carbon atom to which it is bound is taken together with an adjacent R and the carbon atom to which it is bound to form a carbon-carbon double bond; R1and R2have, at each occurrence, the following structure, respectively: a1and a2are, at each occurrence, independently an integer from 3 to 12; b1and b2are, at each occurrence, independently 0 or 1; c1and c2are, at each occurrence, independently an integer from 5 to 10; d1and d2are, at each occurrence, independently an integer from 5 to 10; y is, at each occurrence, independently an integer from 0 to 2; and n is an integer from 1 to 6, wherein each alkyl, alkylene, hydroxylalkyl, aminoalkyl, alkylaminylalkyl, alkoxyalkyl, alkoxycarbonyl, alkylcarbonyloxy, alkylcarbonyloxyalkyl and alkylcarbonyl is optionally substituted with one or more substituent. Formula (AXIV) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: pharmaceutically acceptable salt, prodrug or stereoisomer thereof, wherein: one of L1or L2is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, - the other of L1 -, -RaC(=O)-, -C(=O)Ra-, RaC(=O)Ra-, -OC(=O)Ra- or -NRaC(=O)O- or a direct bond; G1and G2are each independently unsubstituted C1-C12alkylene or C1-C12alkenylene; G3is C1-C24alkylene, C1-C24alkenylene, C3-C8cycloalkylene, C3-C8cycloalkenylene; Rais H or C1-C12 alkyl; R1and R2are each independently C6-C24alkyl or C6-C24alkenyl; R3is H, OR5, CN, -C(=O)OR4, -OC(=O)R4or -R5C(=O)R4; R4is C1-C12 alkyl; R5is H or C1-C6 alkyl; and x is 0, 1 or 2. Formula (AXV) In some embodiments, the comprises a lipid having the structure: (AXV), or a pharmaceutically acceptable salt, tautomer, prodrug or stereoisomer thereof, wherein: L1and L2are each independently -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, -SC(=O)-, -RaC(=O)-, -C(=O)Ra-, -RaC(=O)Ra-, -OC(=O)Ra-, -RaC(=O)O- or a direct bond; G1is C1-C2 alkylene, -(C=O)-, -O(C=O)-, -SC(=O)-, -RaC(=O)- or a direct bond: G2is -C(=O)-, -(C=O)O-, -C(=O)S-, -C(=O)NRa- or a direct bond; G3is C1-C6 alkylene; Rais H or C1-C12 alkyl; R1aand R1bare, at each occurrence, independently either: (a) H or C1-C12alkyl; or (b) R1ais H or C1-C12alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond; R2aand R2bare, at each occurrence, independently either: (a) H or C1-C12alkyl; or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond; R3aand R3bare, at each occurrence, independently either (a): H or C1-C12 alkyl; or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R and the carbon atom to which it is bound to form a carbon-carbon double bond; R4aand R4bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R4ais H or C1-C12alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond; R5and R6are each independently H or methyl; R7is C4-C20alkyl; R8and R9are each independently C1-C12 alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring; a, b, c and d are each independently an integer from 1 to 24; and x is 0, 1 or 2. Formula (AXVI) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: pharmaceutically acceptable salt, tautomer, L1and L2are each independently -O(C=O)-, -(C=O)O- or a carbon-carbon double bond; R1aand R1bare, at each occurrence, independently either (a) H or C1-C12alkyl, or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond; R2aand R2bare, at each occurrence, independently either (a) H or C1-C12alkyl, or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond; R3aand R3bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond; R4aand R4bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R4ais H or C1-C12alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond; R5and R6are each independently methyl or cycloalkyl; R7is, at each occurrence, independently H or C1-C12alkyl; R8and R9are each independently unsubstituted C1-C12 alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7- membered heterocyclic ring comprising one nitrogen atom; a and d are each independently an integer from 0 to 24; b and c are each independently an integer from 1 to 24; and e is 1 or 2, provided that: at least one of R1a, R2a, R3aor R4ais C1-C12alkyl, or at least one of L1or L2is -O(C=O)- or -(C=O)O-; and R1aand R1bare not isopropyl when a is 6 or n-butyl when a is 8. Formula (AXVII) In some embodiments, the lipid nanoparticle comprises a lipid having the structure: pharmaceutically acceptable salt thereof, wherein are same or a linear or branched alkyl with 1-9 carbons, or as alkenyl or alkynyl with 2 to 11 carbon atoms, L1 and L2 are the same or different, each a linear alkyl having 5 to 18 carbon atoms, or form a heterocycle with N, X1is a bond, or is -CG-G- whereby L2-CO-O-R2is formed, X2 is S or O, L3is a bond or a lower alkyl, or form a heterocycle with N, R3is a lower alkyl, and R4 and R5 are the same or different, each a lower alkyl. Compounds (A1)-(A11) In some embodiments, the lipid nanoparticle comprises an ionizable lipid having the structure: , or a pharmaceutically acceptable salt thereof. In some embodiments, the lipid nanoparticle comprises a lipid having the structure: , or a pharmaceutically acceptable salt thereof. (A3), or a pharmaceutically acceptable salt thereof. In some embodiments, the lipid nanoparticle comprises a lipid having the structure: (A4), or a pharmaceutically acceptable salt thereof. In some embodiments, the lipid nanoparticle comprises a lipid having the structure: a pharmaceutically acceptable salt thereof. In some embodiments, the lipid nanoparticle comprises a lipid having the structure: (A6), or a pharmaceutically acceptable salt thereof. In some embodiments, the lipid nanoparticle comprises a lipid having the structure: (A7), or a pharmaceutically acceptable salt thereof. In some embodiments, the lipid nanoparticle comprises a lipid having the structure: (A8), or a pharmaceutically acceptable salt thereof. In some embodiments, the lipid nanoparticle comprises a lipid having the structure: (A9), or a pharmaceutically acceptable salt thereof. some comprises a lipid having the structure: pharmaceutically acceptable salt In some embodiments, the lipid nanoparticle comprises a lipid having the structure: (A11), or a pharmaceutically acceptable salt thereof. Non-cationic lipids In certain embodiments, the lipid nanoparticles comprise one or more non-cationic lipids. Non-cationic lipids may be phospholipids. In some embodiments, the lipid nanoparticle comprises 5-25 mol% non-cationic lipid. For example, the lipid nanoparticle may comprise 5-20 mol%, 5-15 mol%, 5-10 mol%, 10-25 mol%, 10-20 mol%, 10-25 mol%, 15-25 mol%, 15-20 mol%, or 20-25 mol% non-cationic lipid. In some embodiments, the lipid nanoparticle comprises 5 mol%, 10 mol%, 15 mol%, 20 mol%, or 25 mol% non-cationic lipid. In some embodiments, a non-cationic lipid comprises 1,2-distearoyl-sn-glycero-3- phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2- dilinoleoyl-sn-glycero-3-phosphocholine (DLPC), 1,2-dimyristoyl-sn-gly cero-phosphocholine (DMPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), l,2-dipalmitoyl-sn-glycero-3- phosphocholine (DPPC), 1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC), 1-palmitoyl-2- oleoyl-sn-glycero-3-phosphocholine (POPC), 1,2-di-O-octadecenyl-sn-glycero-3- phosphocholine (18:0 Diether PC), 1-oleoyl-2 cholesterylhemisuccinoyl-sn-glycero-3- phosphocholine (OChemsPC), 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC), 1,2- dilinolenoyl-sn-glycero-3-phosphocholine,1,2-diarachidonoyl-sn-glycero-3-phosphocholine, 1,2- didocosahexaenoyl-sn-glycero-3-phosphocholine, 1,2-diphytanoyl-sn-glycero-3- phosphoethanolamine (ME 16.0 PE), 1,2-distearoyl-sn-glycero-3-phosphoethanolamine, 1,2- dilinoleoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinolenoyl-sn-glycero-3- phosphoethanolamine, 1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine, 1,2- didocosahexaenoyl-sn-glycero-3-phosphoethanolamine, 1,2-dioleoyl-sn-glycero-3-phospho-rac- (1-glycerol) sodium salt (DOPG), sphingomyelin, or mixtures thereof. In some embodiments, the lipid nanoparticle comprises 5–15 mol%, 5–10 mol%, or 10– 15 mol% DSPC. For example, the lipid nanoparticle may comprise 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mol% DSPC. In certain embodiments, the lipid composition of the lipid nanoparticle composition disclosed herein can comprise one or more phospholipids, for example, one or more saturated or (poly)unsaturated phospholipids or a combination thereof. In general, phospholipids comprise a phospholipid moiety and one or more fatty acid moieties. A phospholipid moiety can be selected, for example, from the non-limiting group consisting of phosphatidyl choline, phosphatidyl ethanolamine, phosphatidyl glycerol, phosphatidyl serine, phosphatidic acid, 2-lysophosphatidyl choline, and a sphingomyelin. A fatty acid moiety can be selected, for example, from the non-limiting group consisting of lauric acid, myristic acid, myristoleic acid, palmitic acid, palmitoleic acid, stearic acid, oleic acid, linoleic acid, alpha-linolenic acid, erucic acid, phytanoic acid, arachidic acid, arachidonic acid, eicosapentaenoic acid, behenic acid, docosapentaenoic acid, and docosahexaenoic acid. Particular phospholipids can facilitate fusion to a membrane. For example, a cationic phospholipid can interact with one or more negatively charged phospholipids of a membrane (e.g., a cellular or intracellular membrane). Fusion of a phospholipid to a membrane can allow one or more elements (e.g., a therapeutic agent) of a lipid-containing composition (e.g., LNPs) to pass through the membrane permitting, e.g., delivery of the one or more elements to a target tissue. Non-natural phospholipid species including natural species with modifications and substitutions including branching, oxidation, cyclization, and alkynes are also contemplated. For example, a phospholipid can be functionalized with or cross-linked to one or more alkynes (e.g., an alkenyl group in which one or more double bonds is replaced with a triple bond). Under appropriate reaction conditions, an alkyne group can undergo a copper-catalyzed cycloaddition upon exposure to an azide. Such reactions can be useful in functionalizing a lipid bilayer of a nanoparticle composition to facilitate membrane permeation or cellular recognition or in conjugating a nanoparticle composition to a useful component such as a targeting or imaging moiety (e.g., a dye). Phospholipids include, but are not limited to, glycerophospholipids such as phosphatidylcholines, phosphatidylethanolamines, phosphatidylserines, phosphatidylinositols, phosphatidy glycerols, and phosphatidic acids. Phospholipids also include phosphosphingolipid, such as sphingomyelin. In some embodiments, a phospholipid comprises 1,2-distearoyl-sn-glycero-3- phosphocholine (DSPC), 1,2-Distearoyl-sn-glycero-3-phosphoethanolamine (DSPE), 1,2- dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dilinoleoyl-sn-glycero-3- phosphocholine (DLPC), 1,2-dimyristoyl-sn-gly cero-phosphocholine (DMPC), 1,2-dioleoyl-sn- glycero-3-phosphocholine (DOPC), l,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2- diundecanoyl-sn-glycero-phosphocholine (DUPC), 1-palmitoyl-2-oleoyl-sn-glycero-3- phosphocholine (POPC), 1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC), 1-oleoyl-2 cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine (OChemsPC), 1-hexadecyl- sn-glycero-3-phosphocholine (C16 Lyso PC), 1,2-dilinolenoyl-sn-glycero-3-phosphocholine,1,2- diarachidonoyl-sn-glycero-3-phosphocholine, 1,2-didocosahexaenoyl-sn-glycero-3- phosphocholine, 1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16.0 PE), 1,2- distearoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinoleoyl-sn-glycero-3- phosphoethanolamine, 1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine, 1,2-diarachidonoyl- sn-glycero-3-phosphoethanolamine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine, 1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt (DOPG), sphingomyelin, or mixtures thereof. Formula (HI) In certain embodiments, a phospholipid is an analog or variant of DSPC. In certain embodiments, a phospholipid is a compound of Formula (HI): (HI), or a salt thereof, wherein: each R1is independently optionally substituted alkyl; or optionally two R1are joined together with the intervening atoms to form optionally substituted monocyclic carbocyclyl or optionally substituted monocyclic heterocyclyl; or optionally three R1are joined together with the intervening atoms to form optionally substituted bicyclic carbocyclyl or optionally substitute bicyclic heterocyclyl; n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10; m is 0, 1, 2, 3, 4, 5, A is of the formula: or ; each instance of L2is independently a bond or optionally substituted C1-6alkylene, wherein one methylene unit of the optionally substituted C1-6alkylene is optionally replaced with O, N(RN), S, C(O), C(O)N(RN), NRNC(O), C(O)O, OC(O), OC(O)O, OC(O)N(RN), NRNC(O)O, or NRNC(O)N(RN); each instance of R2is independently optionally substituted C1-30alkyl, optionally substituted C1-30 alkenyl, or optionally substituted C1-30 alkynyl; optionally wherein one or more methylene units of R2are independently replaced with optionally substituted carbocyclylene, optionally substituted heterocyclylene, optionall...

Claims

CLAIMS What is claimed is:

1. A composition comprising a lipid nanoparticle and a messenger ribonucleic acid (mRNA) comprising an open reading frame encoding a SARS-CoV-2 chimeric protein comprising: (i) a SARS-CoV-2 nucleocapsid (N) protein portion; (ii) a SARS-CoV-2 non-structural protein 3 (NSP3) protein portion; and (iii) a SARS-CoV-2 matrix (M) protein portion comprising one or more transmembrane domains.

2. The composition of claim 1, wherein the SARS-CoV-2 N protein portion comprises (a) a truncated or modified N-terminal domain of a full-length SARS-CoV-2 N protein, and (b) a C- terminal domain of the full-length SARS-CoV-2 N protein.

3. The composition of claim 2, wherein the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein.

4. The composition of claim 2 or 3, wherein the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104–143 of the full- length SARS-CoV-2 N protein.

5. The composition of claim 4, wherein the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to amino acids 43– 87 of the full-length SARS-CoV-2 N protein.

6. The composition of claim 5, wherein the first and second N-terminal domain amino acid sequences are connected by a linker.

7. The composition of claim 6, wherein the linker is a glycine linker or glycine-serine linker.

8. The composition of any one of claims 2–6, wherein the SARS-CoV-2 N protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213–366 of the full-length SARS-CoV-2 N protein.

9. The composition of any one of claims 2–8, wherein the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO:

84.

10. The composition of any one of claims 1–8, wherein the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO:

92.

11. The composition of any one of claims 1–10, wherein the SARS-CoV-2 NSP3 protein portion comprises two or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein.

12. The composition of claim 11, wherein the SARS-CoV-2 NSP3 protein portion comprises 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein.

13. The composition of claim 11 or 12, wherein the two or more CD8+ T cell epitopes occur in a different order in the SARS-CoV-2 NSP3 protein portion, relative to the order of the epitopes in a full-length SARS-CoV-2 NSP3 protein.

14. The composition of any one of claims 11–13, wherein one or more junctional epitopes, which are present in a concatenated amino acid sequence consisting of the two or more CD8+ T cell epitopes, are not present in the SARS-CoV-2 NSP3 protein portion.

15. The composition of any one of claims 11–14, wherein the full-length SARS-CoV-2 NSP3 protein comprises the amino acid sequence of SEQ ID NO:

85.

16. The composition of any one of claims 11–15, wherein the SARS-CoV-2 NSP3 protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

93.

17. The composition of any one of claims 1–16, wherein the SARS-CoV-2 M protein portion does not comprise an N-terminal glycosylation site, relative to a full-length SARS-CoV-2 M protein.

18. The composition of any one of claims 1–17, wherein the SARS-CoV-2 M protein portion comprises, in N-to-C-terminal order, (a) one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and (b) a β-sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell.

19. The composition of claim 18, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

96.

20. The composition of any one of claims 1–17, wherein the SARS-CoV-2 M protein portion comprises, in N-to-C-terminal order, (a) a β-sheet domain of a full-length SARS-CoV-2 M protein, and (b) one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell.

21. The composition of claim 20, wherein the β-sheet domain is connected to the one or more transmembrane domains by a linker.

22. The composition of claim 21, wherein the linker is a glycine or glycine-serine linker.

23. The composition of any one of claims 11–14, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

97.

24. The composition of any one of claims 18–23, wherein the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO:

86.

25. The composition of any one of claims 1–24, wherein two or more of the N protein portion, NSP3 protein portion, and M protein portion are separated by a linker.

26. The composition of claim 25, wherein: (i) the N protein portion and the NSP3 protein portion are separated by a first linker, and / or (ii) the NSP3 protein portion and the M protein portion are separated by a second linker.

27. The composition of claim 25, wherein: (i) the N protein portion and the M protein portion are separated by a first linker, and / or (ii) the M protein portion and the NSP3 protein portion are separated by a second linker.

28. The composition of claim 25, wherein: (i) the M protein portion and the N protein portion are separated by a first linker, and / or (ii) the N protein portion and the NSP3 protein portion are separated by a second linker.

29. The composition of any one of claims 26–28, wherein each of the first and second linkers is a glycine or glycine-serine linker.

30. The composition of any one of claims 26–28, wherein each of the first and second linkers comprises the amino acid sequence AAY.

31. The composition of any one of claims 1–30, wherein the SARS-CoV-2 chimeric protein further comprises a signal peptide.

32. The composition of claim 31, wherein the signal peptide comprises an influenza A virus hemagglutinin (HA) signal peptide.

33. A composition comprising a lipid nanoparticle and a messenger RNA (mRNA) comprising an open reading frame encoding a SARS-CoV-2 chimeric protein comprising: (i) a SARS-CoV-2 Spike (S) protein portion; and (ii) a SARS-CoV-2 nucleocapsid (N) protein portion; and (iii) a transmembrane portion comprising a transmembrane domain.

34. The composition of claim 33, wherein the SARS-CoV-2 N protein portion comprises (a) a truncated or modified N-terminal domain of a full-length SARS-CoV-2 N protein, and (b) a C- terminal domain of the full-length SARS-CoV-2 N protein.

35. The composition of claim 34, wherein the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein.

36. The composition of claim 34 or 35, wherein the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104–143 of a full-length SARS-CoV-2 N protein.

37. The composition of claim 36, wherein the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to amino acids 43– 87 of the full-length SARS-CoV-2 N protein.

38. The composition of claim 37, wherein the first and second N-terminal domain amino acid sequences are connected by a linker.

39. The composition of claim 38, wherein the linker is a glycine or glycine-serine linker.

40. The composition of any one of claims 34–39, wherein the SARS-CoV-2 N protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213– 366 of the full-length SARS-CoV-2 N protein.

41. The composition of any one of claims 34–40, wherein the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO:

84.

42. The composition of any one of claims 33–41, wherein the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO:

92.

43. The composition of any one of claims 33–42, wherein the transmembrane portion comprises an influenza virus hemagglutinin (HA) transmembrane domain.

44. The composition of any one of claims 33–42, wherein the transmembrane portion comprises a SARS-CoV-2 M protein portion comprising one or more transmembrane domains of a full-length SARS-CoV-2 M protein.

45. The composition of claim 44, wherein the SARS-CoV-2 M protein portion does not comprise an N-terminal glycosylation site, relative to a full-length SARS-CoV-2 M protein.

46. The composition of claim 44 or 45, wherein the SARS-CoV-2 M protein portion comprises, in N-to-C-terminal order, (a) one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and (b) a β-sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell.

47. The composition of claim 46, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

96.

48. The composition of claim 44 or 45, wherein the SARS-CoV-2 M protein portion, comprises, in N-to-C-terminal order, (a) a β-sheet domain of a full-length SARS-CoV-2 M protein, and (b) one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell.

49. The composition of claim 48, wherein the β-sheet domain is connected to the one or more transmembrane domains by a linker.

50. The composition of claim 49, wherein the linker is a glycine or glycine-serine linker.

51. The composition of claim 48, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

97.

52. The composition of any one of claims 44–51, wherein the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO:

86.

53. The composition of any one of claims 33–51, wherein the SARS-CoV-2 N protein portion is C-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell.

54. The composition of any one of claims 33–53, wherein the SARS-CoV-2 N protein portion is N-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell.

55. The composition of any one of claims 33–54, wherein the SARS-CoV-2 N protein portion and the transmembrane portion are connected by a linker.

56. The composition of claim 55, wherein the linker is a glycine linker or a glycine-serine linker.

57. The composition of any one of claims 33–55, wherein the SARS-CoV-2 S protein portion comprises an N-terminal domain (NTD) and a receptor-binding domain (RBD) of a full-length SARS-CoV-2 S protein.

58. The composition of claim 57, wherein the NTD corresponds to amino acids 1–290 of the full-length SARS-CoV-2 S protein, and / or the RBD corresponds to amino acids 316–517 of the full-length SARS-CoV-2 S protein.

59. The composition of claim 57 or 58, wherein the full-length SARS-CoV-2 S protein is a BA.4 or BA.5 lineage S protein.

60. The composition of claim 57or 58, wherein the full-length SARS-CoV-2 S protein is a Wuhan-Hu-1 lineage S protein.

61. The composition of any one of claims 57–59, wherein the full-length SARS-CoV-2 S protein comprises the amino acid sequence of SEQ ID NO:

87.

62. The composition of any one of claims 33–61, wherein the S protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

98.

63. The composition of any one of claims 33–61, wherein two or more of the S protein portion, N protein portion, and transmembrane portion are separated by a linker.

64. The composition of claim 63, wherein:(i) the S protein portion and the N protein portion are separated by a first linker, and / or (ii) the N protein portion and the transmembrane portion are separated by a second linker.

65. The composition of claim 63, wherein: (i) the S protein portion and the transmembrane portion are separated by a first linker, and / or (ii) the transmembrane portion and the N protein portion are separated by a second linker.

66. The composition of claim 64 or 65, wherein each of the first and second linkers is a glycine or glycine-serine linker.

67. The composition of claim 64 or 65, wherein each of the first and second linkers comprises the amino acid sequence AAY.

68. A composition comprising a lipid nanoparticle and a messenger ribonucleic acid comprising an open reading frame (ORF) encoding a protein comprising an amino acid sequence with at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 101–124 or 170–183.

69. The composition of any one of claims 1–68, wherein the mRNA comprises a 5′ untranslated region (UTR), wherein the 5′ UTR comprises a nucleotide sequence with at least 90% sequence identity to a nucleotide sequence selected from SEQ ID NOs: 1, 2, 5–35, 66, 70– 72, 75, 76, and 81.

70. The composition of claim 69, wherein the 5′ UTR comprises a nucleotide sequence selected from SEQ ID NOs: 1, 2, 5–35, 66, 70–72, 75, 76, and 81.

71. The composition of any one of claims 1–70, wherein the mRNA comprises a 3′ untranslated region (UTR), wherein the 5′ UTR comprises a nucleotide sequence with at least 90% sequence identity to a nucleotide sequence selected from SEQ ID NOs: 3–4, 36–44, 68, 69, 73, 74, 77–79, and 82.

72. The composition of claim 71, wherein the 3′ UTR comprises a nucleotide sequence selected from SEQ ID NOs: 3–4, 36–44, 68, 69, 73, 74, 77–79, and 82.

73. The composition of any one of claims 1–72, wherein the mRNA comprises one or more stop codons immediately downstream from the open reading frame.

74. The composition of claim 73, wherein the one or more stop codons comprise the nucleotide sequence UGAUGA.

75. The composition of claim 73, wherein the one or more stop codons comprise the nucleotide sequence UGAUAAUAG.

76. The composition of any one of claims 1–75, wherein the mRNA comprises a polyadenosine (polyA) sequence comprising 20 or more consecutive adenosine nucleotides.

77. The composition of claim 76, wherein the polyA sequence comprises 100 consecutive adenosine nucleotides.

78. The composition of claim 76, wherein the polyA sequence comprises, in 5′-to-3′ order, a first nucleotide sequence comprising 30 consecutive adenosine nucleotides, an intervening sequence comprising no more than three adenosine nucleotides, and a second nucleotide sequence comprising 70 consecutive adenosine nucleotides.

79. The composition of claim 76 or 78, wherein the polyA sequence comprises the nucleotide sequence of SEQ ID NO:

80.

80. The composition of claim 76, wherein the mRNA further comprises a polycytidine (polyC) sequence comprising 20 or more consecutive cytidine nucleotides.

81. The composition of claim 80, wherein the polyC sequence comprises 30 consecutive cytidine nucleotides.

82. The composition of claim 80 or 81, wherein the polyC sequence is downstream from the polyA sequence, wherein the polyA sequence comprises 64 consecutive adenosine nucleotides.

83. The composition of claim 76, wherein the polyA sequence comprises 109 consecutive adenosine nucleotides.

84. The composition of any one of claims 1–83, wherein the mRNA comprises a 5′ cap analog.

85. The composition of claim 84, wherein the 5′ cap analog comprises a 7mG(5′)ppp(5′)NlmpNp cap.

86. The composition of any one of claims 1–85, wherein the lipid nanoparticle comprises 40- 55 mol% ionizable amino lipid, 30-45 mol% sterol, 5-15 mol% neutral lipid, and 1-5 mol% PEG-modified lipid.

87. The composition of any one of claims 1–86, wherein the ionizable amino lipid comprises a compound of Formula (I):salt or isomer thereof, wherein: R1is R”M’R’ or C5-20alkenyl; R2 and R3 are each independently selected from C1-14 alkyl and C2-14 alkenyl; R4 is -(CH2)nQ, wherein Q is OH and n is selected from 3, 4, and 5; M and M’ are each independently -OC(O)- or -C(O)O-; R5, R6, and R7 are each H; R’ is a linear C1-12 alkyl, or C1-12 alkyl substituted with C6-9 alkyl; R” is C3-14alkyl; m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13.

88. The the ionizable amino lipid comprisesCompound 1: (Compound 1).

89. The composition of any one of claims 1–87, wherein the ionizable amino lipid comprises a compound of the structure A7: .

90. The composition of any one of claims 86–89, wherein the neutral lipid is 1,2 distearoyl- sn-glycero-3-phosphocholine (DSPC).

91. The composition of any one of claims 86–90, wherein the sterol is cholesterol.

92. The composition of any one of claims 86–91, wherein the PEG-modified lipid is PEG2000-DMG.

93. The composition of any one of claims 1–92, wherein the open reading frame comprises one or more chemically modified nucleotides.

94. The composition of any one of claims 1–93, wherein the open reading frame comprises N1-methylpseudouridine.

95. The composition of any one of claims 1–94, wherein at least 80% of uracil nucleotides in the open reading frame comprise N1-methylpseudouridine.

96. The composition of any one of claims 1–95, wherein 100% of uracil nucleotides in the open reading frame comprise N1-methylpseudouridine.

97. The composition of any one of claims 1–96, wherein the open reading frame comprises 5-methylcytidine.

98. The composition of any one of claims 1–97, wherein at least 80% of cytosine nucleotides in the open reading frame comprise 5-methylcytidine.

99. The composition of any one of claims 1–98, wherein 100% of cytosine nucleotides in the open reading frame comprise 5-methylcytidine.

100. The composition of any one of claims 1-93 or 97-99, wherein the open reading frame comprises 5-methyluridine.

101. The composition of any one of claims 1-93 or 97-100, wherein at least 80% of uracil nucleotides in the open reading frame comprise 5-methyluridine.

102. The composition of any one of claims 1–93 or 97-101, wherein 100% of uracil nucleotides in the open reading frame comprise 5-methyluridine.

103. A pharmaceutical composition comprising the composition of any one of claims 1–102 and a pharmaceutically acceptable excipient.

104. A method comprising administering to a subject the composition of any one of claims 1– 102.

105. The method of claim 104, wherein the composition is administered intramuscularly.

106. The method of claim 104 or 105, wherein the composition is effective to induce, in the subject, CD4+ and / or CD8+ T cells specific to one or more epitopes of the protein.

107. The method of any one of claims 104–106, the method comprising administering a first dose and a second dose of the composition.

108. A SARS-CoV-2 chimeric protein comprising: (i) a SARS-CoV-2 nucleocapsid (N) protein portion; (ii) a SARS-CoV-2 non-structural protein 3 (NSP3) protein portion; and (iii) a SARS-CoV-2 matrix (M) protein portion comprising one or more transmembrane domains.

109. The SARS-CoV-2 chimeric protein of claim 108, wherein the SARS-CoV-2 N protein portion comprises (a) a truncated or modified N-terminal domain of a full-length SARS-CoV-2 N protein, and (b) a C-terminal domain of the full-length SARS-CoV-2 N protein.

110. The SARS-CoV-2 chimeric protein of claim 109, wherein the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein.

111. The SARS-CoV-2 chimeric protein of claim 109 or 110, wherein the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104–143 of the full-length SARS-CoV-2 N protein.

112. The SARS-CoV-2 chimeric protein of claim 111, wherein the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to amino acids 43–87 of the full-length SARS-CoV-2 N protein.

113. The SARS-CoV-2 chimeric protein of claim 112, wherein the first and second N-terminal domain amino acid sequences are connected by a linker.

114. The SARS-CoV-2 chimeric protein of claim 113, wherein the linker is a glycine linker or glycine-serine linker.

115. The SARS-CoV-2 chimeric protein of any one of claims 109–113, wherein the SARS- CoV-2 N protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213–366 of the full-length SARS-CoV-2 N protein.

116. The SARS-CoV-2 chimeric protein of any one of claims 109–115, wherein the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO:

84.

117. The SARS-CoV-2 chimeric protein of any one of claims 108–115, wherein the SARS- CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO:

92.

118. The SARS-CoV-2 chimeric protein of any one of claims 108–117, wherein the SARS- CoV-2 NSP3 protein portion comprises two or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein.

119. The SARS-CoV-2 chimeric protein of claim 118, wherein the SARS-CoV-2 NSP3 protein portion comprises 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein.

120. The SARS-CoV-2 chimeric protein of claim 118 or 119, wherein the two or more CD8+ T cell epitopes occur in a different order in the SARS-CoV-2 NSP3 protein portion, relative to the order of the epitopes in a full-length SARS-CoV-2 NSP3 protein.

121. The SARS-CoV-2 chimeric protein of any one of claims 118–120, wherein one or more junctional epitopes, which are present in a concatenated amino acid sequence consisting of the two or more CD8+ T cell epitopes, are not present in the SARS-CoV-2 NSP3 protein portion.

122. The SARS-CoV-2 chimeric protein of any one of claims 118–121, wherein the full-length SARS-CoV-2 NSP3 protein comprises the amino acid sequence of SEQ ID NO:

85.

123. The SARS-CoV-2 chimeric protein of any one of claims 118–122, wherein the SARS- CoV-2 NSP3 protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

93.

124. The SARS-CoV-2 chimeric protein of any one of claims 108–123, wherein the SARS- CoV-2 M protein portion does not comprise an N-terminal glycosylation site, relative to a full- length SARS-CoV-2 M protein.

125. The SARS-CoV-2 chimeric protein of any one of claims 108–124, wherein the SARS- CoV-2 M protein portion comprises, in N-to-C-terminal order, (a) one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and (b) a β-sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell.

126. The SARS-CoV-2 chimeric protein of claim 125, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

96.

127. The SARS-CoV-2 chimeric protein of any one of claims 108–124, wherein the SARS- CoV-2 M protein portion comprises, in N-to-C-terminal order, (a) a β-sheet domain of a full-length SARS-CoV-2 M protein, and (b) one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell.

128. The SARS-CoV-2 chimeric protein of claim 127, wherein the β-sheet domain is connected to the one or more transmembrane domains by a linker.

129. The SARS-CoV-2 chimeric protein of claim 128, wherein the linker is a glycine or glycine-serine linker.

130. The SARS-CoV-2 chimeric protein of any one of claims 118–121, wherein the SARS- CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

97.

131. The SARS-CoV-2 chimeric protein of any one of claims 125–130, wherein the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO:

86.

132. The SARS-CoV-2 chimeric protein of any one of claims 108–131, wherein two or more of the N protein portion, NSP3 protein portion, and M protein portion are separated by a linker.

133. The SARS-CoV-2 chimeric protein of claim 132, wherein: (i) the N protein portion and the NSP3 protein portion are separated by a first linker, and / or (ii) the NSP3 protein portion and the M protein portion are separated by a second linker.

134. The SARS-CoV-2 chimeric protein of claim 132, wherein: (i) the N protein portion and the M protein portion are separated by a first linker, and / or (ii) the M protein portion and the NSP3 protein portion are separated by a second linker.

135. The SARS-CoV-2 chimeric protein of claim 132, wherein: (i) the M protein portion and the N protein portion are separated by a first linker, and / or(ii) the N protein portion and the NSP3 protein portion are separated by a second linker.

136. The SARS-CoV-2 chimeric protein of any one of claims 133–135, wherein each of the first and second linkers is a glycine or glycine-serine linker.

137. The SARS-CoV-2 chimeric protein of any one of claims 133–135, wherein each of the first and second linkers comprises the amino acid sequence AAY.

138. The SARS-CoV-2 chimeric protein of any one of claims 108–137, wherein the SARS- CoV-2 chimeric protein further comprises a signal peptide.

139. The SARS-CoV-2 chimeric protein of claim 138, wherein the signal peptide comprises an influenza A virus hemagglutinin (HA) signal peptide.

140. A SARS-CoV-2 chimeric protein comprising: (i) a SARS-CoV-2 Spike (S) protein portion; and (ii) a SARS-CoV-2 nucleocapsid (N) protein portion; and (iii) a transmembrane portion comprising a transmembrane domain.

141. The SARS-CoV-2 chimeric protein of claim 140, wherein the SARS-CoV-2 N protein portion comprises (a) a truncated or modified N-terminal domain of a full-length SARS-CoV-2 N protein, and (b) a C-terminal domain of the full-length SARS-CoV-2 N protein.

142. The SARS-CoV-2 chimeric protein of claim 141, wherein the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein.

143. The SARS-CoV-2 chimeric protein of claim 141 or 142, wherein the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104–143 of a full-length SARS-CoV-2 N protein.

144. The SARS-CoV-2 chimeric protein of claim 143, wherein the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to amino acids 43–87 of the full-length SARS-CoV-2 N protein.

145. The SARS-CoV-2 chimeric protein of claim 144, wherein the first and second N-terminal domain amino acid sequences are connected by a linker.

146. The SARS-CoV-2 chimeric protein of claim 145, wherein the linker is a glycine or glycine-serine linker.

147. The SARS-CoV-2 chimeric protein of any one of claims 141–146, wherein the SARS- CoV-2 N protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213–366 of the full-length SARS-CoV-2 N protein.

148. The SARS-CoV-2 chimeric protein of any one of claims 141–147, wherein the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO:

84.

149. The SARS-CoV-2 chimeric protein of any one of claims 140–148, wherein the SARS- CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO:

92.

150. The SARS-CoV-2 chimeric protein of any one of claims 140–149, wherein the transmembrane portion comprises an influenza virus hemagglutinin (HA) transmembrane domain.

151. The SARS-CoV-2 chimeric protein of any one of claims 140–149, wherein the transmembrane portion comprises a SARS-CoV-2 M protein portion comprising one or more transmembrane domains of a full-length SARS-CoV-2 M protein.

152. The SARS-CoV-2 chimeric protein of claim 151, wherein the SARS-CoV-2 M protein portion does not comprise an N-terminal glycosylation site, relative to a full-length SARS-CoV-2 M protein.

153. The SARS-CoV-2 chimeric protein of claim 151 or 152, wherein the SARS-CoV-2 M protein portion comprises, in N-to-C-terminal order, (a) one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and (b) a β-sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the full-length SARS- CoV-2 chimeric protein is expressed in a cell.

154. The SARS-CoV-2 chimeric protein of claim 153, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

96.

155. The SARS-CoV-2 chimeric protein of claim 151 or 152, wherein the SARS-CoV-2 M protein portion, comprises, in N-to-C-terminal order, (a) a β-sheet domain of a full-length SARS- CoV-2 M protein, and (b) one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell.

156. The SARS-CoV-2 chimeric protein of claim 155, wherein the β-sheet domain is connected to the one or more transmembrane domains by a linker.

157. The SARS-CoV-2 chimeric protein of claim 156, wherein the linker is a glycine or glycine-serine linker.

158. The SARS-CoV-2 chimeric protein of claim 155, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

97.

159. The SARS-CoV-2 chimeric protein of any one of claims 151–158, wherein the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO:

86.

160. The SARS-CoV-2 chimeric protein of any one of claims 140–158, wherein the SARS- CoV-2 N protein portion is C-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell.

161. The SARS-CoV-2 chimeric protein of any one of claims 140–160, wherein the SARS- CoV-2 N protein portion is N-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is extracellular when the SARS- CoV-2 chimeric protein is expressed in a cell.

162. The SARS-CoV-2 chimeric protein of any one of claims 140–161, wherein the SARS- CoV-2 N protein portion and the transmembrane portion are connected by a linker.

163. The SARS-CoV-2 chimeric protein of claim 162, wherein the linker is a glycine linker or a glycine-serine linker.

164. The SARS-CoV-2 chimeric protein of any one of claims 140–162, wherein the SARS- CoV-2 S protein portion comprises an N-terminal domain (NTD) and a receptor-binding domain (RBD) of a full-length SARS-CoV-2 S protein.

165. The SARS-CoV-2 chimeric protein of claim 164, wherein the NTD corresponds to amino acids 1–290 of the full-length SARS-CoV-2 S protein, and / or the RBD corresponds to amino acids 316–517 of the full-length SARS-CoV-2 S protein.

166. The SARS-CoV-2 chimeric protein of claim 164 or 165, wherein the full-length SARS- CoV-2 S protein is a BA.4 or BA.5 lineage S protein.

167. The SARS-CoV-2 chimeric protein of claim 164or 165, wherein the full-length SARS- CoV-2 S protein is a Wuhan-Hu-1 lineage S protein.

168. The SARS-CoV-2 chimeric protein of any one of claims 164–166, wherein the full-length SARS-CoV-2 S protein comprises the amino acid sequence of SEQ ID NO:

87.

169. The SARS-CoV-2 chimeric protein of any one of claims 140–168, wherein the S protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

98.

170. The SARS-CoV-2 chimeric protein of any one of claims 140–169, wherein two or more of the S protein portion, N protein portion, and transmembrane portion are separated by a linker.

171. The SARS-CoV-2 chimeric protein of claim 170, wherein: (i) the S protein portion and the N protein portion are separated by a first linker, and / or (ii) the N protein portion and the transmembrane portion are separated by a second linker.

172. The SARS-CoV-2 chimeric protein of claim 170, wherein: (i) the S protein portion and the transmembrane portion are separated by a first linker, and / or (ii) the transmembrane portion and the N protein portion are separated by a second linker.

173. The SARS-CoV-2 chimeric protein of any one of claim 171 or 172, wherein each of the first and second linkers is a glycine or glycine-serine linker.

174. The SARS-CoV-2 chimeric protein of any one of claim 171 or 172, wherein each of the first and second linkers comprises the amino acid sequence AAY.

175. A SARS-CoV-2 chimeric protein comprising an amino acid sequence with at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 101–124 or 170–183.

176. A ribonucleic acid (RNA) comprising an open reading frame (ORF) encoding the protein of any one of claims 108–175.

177. A messenger ribonucleic acid (mRNA) comprising an open reading frame encoding the SARS-CoV-2 chimeric protein of claim 176.

178. The mRNA of claim 176 or 177, wherein the mRNA comprises a chemical modification.

179. The mRNA of any one of claims 176–178, wherein 100% of the uracil nucleotides of the mRNA comprise a chemical modification.

180. The mRNA of claim 179, wherein 100% of uracil nucleotides of the mRNA comprise N1-methylpseudouridine.

181. A self-amplifying ribonucleic acid (saRNA) comprising an open reading frame encoding a SARS-CoV-2 chimeric protein comprising: (i) a SARS-CoV-2 nucleocapsid (N) protein portion; (ii) a SARS-CoV-2 non-structural protein 3 (NSP3) protein portion; and(iii) a SARS-CoV-2 matrix (M) protein portion comprising one or more transmembrane domains.

182. The saRNA of claim 181, wherein the SARS-CoV-2 N protein portion comprises (a) a truncated or modified N-terminal domain of a full-length SARS-CoV-2 N protein, and (b) a C- terminal domain of the full-length SARS-CoV-2 N protein.

183. The saRNA of claim 182, wherein the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein.

184. The saRNA of claim 182 or 183, wherein the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104–143 of the full- length SARS-CoV-2 N protein.

185. The saRNA of claim 184, wherein the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to amino acids 43–87 of the full-length SARS-CoV-2 N protein.

186. The saRNA of claim 185, wherein the first and second N-terminal domain amino acid sequences are connected by a linker.

187. The saRNA of claim 186, wherein the linker is a glycine linker or glycine-serine linker.

188. The saRNA of any one of claims 182–186, wherein the SARS-CoV-2 N protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213–366 of the full-length SARS-CoV-2 N protein.

189. The saRNA of any one of claims 182–188, wherein the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO:

84.

190. The saRNA of any one of claims 181–188, wherein the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO: 92.

191. The saRNA of any one of claims 181–190, wherein the SARS-CoV-2 NSP3 protein portion comprises two or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein.

192. The saRNA of claim 191, wherein the SARS-CoV-2 NSP3 protein portion comprises 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or more CD8+ T cell epitopes of a full-length SARS-CoV-2 NSP3 protein.

193. The saRNA of claim 191 or 192, wherein the two or more CD8+ T cell epitopes occur in a different order in the SARS-CoV-2 NSP3 protein portion, relative to the order of the epitopes in a full-length SARS-CoV-2 NSP3 protein.

194. The saRNA of any one of claims 191–193, wherein one or more junctional epitopes, which are present in a concatenated amino acid sequence consisting of the two or more CD8+ T cell epitopes, are not present in the SARS-CoV-2 NSP3 protein portion.

195. The saRNA of any one of claims 191–194, wherein the full-length SARS-CoV-2 NSP3 protein comprises the amino acid sequence of SEQ ID NO:

85.

196. The saRNA of any one of claims 191–195, wherein the SARS-CoV-2 NSP3 protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

93.

197. The saRNA of any one of claims 181–196, wherein the SARS-CoV-2 M protein portion does not comprise an N-terminal glycosylation site, relative to a full-length SARS-CoV-2 M protein.

198. The saRNA of any one of claims 181–197, wherein the SARS-CoV-2 M protein portion comprises, in N-to-C-terminal order, (a) one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and (b) a β-sheet domain of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell.

199. The saRNA of claim 198, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 96.

200. The saRNA of any one of claims 181–197, wherein the SARS-CoV-2 M protein portion comprises, in N-to-C-terminal order, (a) a β-sheet domain of a full-length SARS-CoV-2 M protein, and (b) one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β-sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell.

201. The saRNA of claim 200, wherein the β-sheet domain is connected to the one or more transmembrane domains by a linker.

202. The saRNA of claim 201, wherein the linker is a glycine or glycine-serine linker.

203. The saRNA of any one of claims 191–194, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

97.

204. The saRNA of any one of claims 198–203, wherein the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO:

86.

205. The saRNA of any one of claims 181–204, wherein two or more of the N protein portion, NSP3 protein portion, and M protein portion are separated by a linker.

206. The saRNA of claim 205, wherein: (i) the N protein portion and the NSP3 protein portion are separated by a first linker, and / or (ii) the NSP3 protein portion and the M protein portion are separated by a second linker.

207. The saRNA of claim 205, wherein: (i) the N protein portion and the M protein portion are separated by a first linker, and / or (ii) the M protein portion and the NSP3 protein portion are separated by a second linker.

208. The saRNA of claim 205, wherein:(i) the M protein portion and the N protein portion are separated by a first linker, and / or (ii) the N protein portion and the NSP3 protein portion are separated by a second linker.

209. The saRNA of any one of claims 206–208, wherein each of the first and second linkers is a glycine or glycine-serine linker.

210. The saRNA of any one of claims 206–208, wherein each of the first and second linkers comprises the amino acid sequence AAY.

211. The saRNA of any one of claims 181–210, wherein the SARS-CoV-2 chimeric protein further comprises a signal peptide.

212. The saRNA of claim 211, wherein the signal peptide comprises an influenza A virus hemagglutinin (HA) signal peptide.

213. A self-amplifying ribonucleic acid (saRNA) encoding a SARS-CoV-2 chimeric protein comprising: (i) a SARS-CoV-2 Spike (S) protein portion; and (ii) a SARS-CoV-2 nucleocapsid (N) protein portion; and (iii) a transmembrane portion comprising a transmembrane domain.

214. The saRNA of claim 213, wherein the SARS-CoV-2 N protein portion comprises (a) a truncated or modified N-terminal domain of a full-length SARS-CoV-2 N protein, and (b) a C- terminal domain of the full-length SARS-CoV-2 N protein.

215. The saRNA of claim 214, wherein the SARS-CoV-2 N protein portion does not comprise a basic loop of an N-terminal domain, relative to the full-length SARS-CoV-2 N protein.

216. The saRNA of claim 214 or 215, wherein the SARS-CoV-2 N protein portion comprises a first N-terminal domain amino acid sequence corresponding to amino acids 104–143 of a full- length SARS-CoV-2 N protein.

217. The saRNA of claim 216, wherein the SARS-CoV-2 N protein portion further comprises a second N-terminal domain amino acid sequence corresponding to amino acids 43–87 of the full-length SARS-CoV-2 N protein.

218. The saRNA of claim 217, wherein the first and second N-terminal domain amino acid sequences are connected by a linker.

219. The saRNA of claim 218, wherein the linker is a glycine or glycine-serine linker.

220. The saRNA of any one of claims 214–219, wherein the SARS-CoV-2 N protein portion comprises a C-terminal domain amino acid sequence corresponding to amino acids 213–366 of the full-length SARS-CoV-2 N protein.

221. The saRNA of any one of claims 214–220, wherein the full-length SARS-CoV-2 N protein comprises the amino acid sequence of SEQ ID NO:

84.

222. The saRNA of any one of claims 213–221, wherein the SARS-CoV-2 N protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO: 91 or SEQ ID NO:

92.

223. The saRNA of any one of claims 213–222, wherein the transmembrane portion comprises an influenza virus hemagglutinin (HA) transmembrane domain.

224. The saRNA of any one of claims 213–222, wherein the transmembrane portion comprises a SARS-CoV-2 M protein portion comprising one or more transmembrane domains of a full- length SARS-CoV-2 M protein.

225. The saRNA of claim 224, wherein the SARS-CoV-2 M protein portion does not comprise an N-terminal glycosylation site, relative to a full-length SARS-CoV-2 M protein.

226. The saRNA of claim 224 or 225, wherein the SARS-CoV-2 M protein portion comprises, in N-to-C-terminal order, (a) one or more transmembrane domains of a full-length SARS-CoV-2 M protein, and (b) a β-sheet domain of the full-length SARS-CoV-2 M protein, wherein the β- sheet domain is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell.

227. The saRNA of claim 226, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

96.

228. The saRNA of claim 224 or 225, wherein the SARS-CoV-2 M protein portion, comprises, in N-to-C-terminal order, (a) a β-sheet domain of a full-length SARS-CoV-2 M protein, and (b) one or more transmembrane domains of the full-length SARS-CoV-2 M protein, wherein the β- sheet domain is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell.

229. The saRNA of claim 228, wherein the β-sheet domain is connected to the one or more transmembrane domains by a linker.

230. The saRNA of claim 229, wherein the linker is a glycine or glycine-serine linker.

231. The saRNA of claim 228, wherein the SARS-CoV-2 M protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

97.

232. The saRNA of any one of claims 224–231, wherein the full-length SARS-CoV-2 M protein comprises the amino acid sequence of SEQ ID NO:

86.

233. The saRNA of any one of claims 213–231, wherein the SARS-CoV-2 N protein portion is C-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is present in the cytoplasm when the SARS-CoV-2 chimeric protein is expressed in a cell.

234. The saRNA of any one of claims 213–233, wherein the SARS-CoV-2 N protein portion is N-terminal to the transmembrane portion in the SARS-CoV-2 chimeric protein, wherein the SARS-CoV-2 N protein portion is extracellular when the SARS-CoV-2 chimeric protein is expressed in a cell.

235. The saRNA of any one of claims 213–234, wherein the SARS-CoV-2 N protein portion and the transmembrane portion are connected by a linker.

236. The saRNA of claim 235, wherein the linker is a glycine linker or a glycine-serine linker.

237. The saRNA of any one of claims 213–235, wherein the SARS-CoV-2 S protein portion comprises an N-terminal domain (NTD) and a receptor-binding domain (RBD) of a full-length SARS-CoV-2 S protein.

238. The saRNA of claim 237, wherein the NTD corresponds to amino acids 1–290 of the full- length SARS-CoV-2 S protein, and / or the RBD corresponds to amino acids 316–517 of the full- length SARS-CoV-2 S protein.

239. The saRNA of claim 237 or 238, wherein the full-length SARS-CoV-2 S protein is a BA.4 or BA.5 lineage S protein.

240. The saRNA of claim 237or 238, wherein the full-length SARS-CoV-2 S protein is a Wuhan-Hu-1 lineage S protein.

241. The saRNA of any one of claims 237–239, wherein the full-length SARS-CoV-2 S protein comprises the amino acid sequence of SEQ ID NO:

87.

242. The saRNA of any one of claims 213–241, wherein the S protein portion comprises an amino acid sequence with at least 90% identity to the amino acid sequence of SEQ ID NO:

98.

243. The saRNA of any one of claims 213–241, wherein two or more of the S protein portion, N protein portion, and transmembrane portion are separated by a linker.

244. The saRNA of claim 243, wherein: (i) the S protein portion and the N protein portion are separated by a first linker, and / or (ii) the N protein portion and the transmembrane portion are separated by a second linker.

245. The saRNA of claim 243, wherein: (i) the S protein portion and the transmembrane portion are separated by a first linker, and / or (ii) the transmembrane portion and the N protein portion are separated by a second linker.

246. The saRNA of claim 244 or 245, wherein each of the first and second linkers is a glycine or glycine-serine linker.

247. The saRNA of claim 244 or 245, wherein each of the first and second linkers comprises the amino acid sequence AAY.

Images