Methods and compositions for making ketocarotenoids
Transgenic plants engineered with specific nucleic acids enhance astaxanthin production in seeds and tissues, addressing the demand for sustainable astaxanthin sources with high yields and purity, while maintaining seed viability and oil content.
Patent Information
- Application Number
- PCT/US2024/050529
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2023-10-09
- Filing Date
- 2024-10-09
- Publication Date
- 2025-09-25
AI Technical Summary
The rising global demand for astaxanthin as a natural food coloring agent and human health supplement necessitates the development of sustainable, plant-based feedstocks like camelina, soybean, corn, and canola to supplement current sources, while maintaining high astaxanthin production without impairing seed germination or oil content.
Engineering transgenic plants with nucleic acids encoding carotenoid β-ring 4-dehydrogenase, 4-hydroxy-β-ring 4-dehydrogenase, phytoene synthase, and phytyl ester synthase, under promoters such as cauliflower mosaic virus or seed-specific promoters, to enhance astaxanthin and ester production in seeds and vegetative tissues.
This approach achieves 2-10-fold higher astaxanthin concentrations in engineered seeds, maintaining seed germination and oil content, with purity exceeding 90-95% in saponified extracts, and significantly increasing astaxanthin ester production.
Smart Images

Figure IMGF000004_0001 
Figure 00000048_0000 
Figure 00000050_0000
Abstract
Description
[0001]Attorney Ref No: 24742-0149WO1 METHODS AND COMPOSITIONS FOR MAKING KETOCAROTENOIDS FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT This invention was made with government support under 2021-67013-33899 awarded by the United States Department of Agriculture, National Institute of Food and Agriculture. The government has certain rights in the invention. CROSS REFERENCE TO RELATED APPLICATIONS This application claims the benefit of priority under 35 U.S.C. § 119(e) to U.S. Application No.63 / 543,241 filed October 9, 2023, which is incorporated by reference in its entirety. TECHNICAL FIELD This disclosure generally relates to transgenic plants for making ketocarotenoids including astaxanthin and its esters. BACKGROUND The rising global demand for astaxanthin as a natural food coloring agent and human health supplement requires a sustainable supply, which necessitates the development of alternative plant-based feedstock such as camelina, soybean, corn, palm or canola to supplement the current sources of astaxanthin. SUMMARY This document describes novel approaches to develop a source of astaxanthin in crops such as camelina, soybean, corn, palm or canola. Depending upon the plant, high levels of astaxanthin can be produced in seeds and / or photosynthetic tissues such as leaves. Methods are described herein for engineering high astaxanthin-ester producing transgenic plants. Such transgenic plants typically include nucleic acids (e.g., exogenous nucleic acids) that encode at least one carotenoid β-ring 4-dehydrogenase (CBFD; e.g., an Adonis CBFD); at least one carotenoid 4-hydroxy-β-ring 4-dehydrogenase (HBFD; an Adonis HBFD); with or without a phytoene synthase (PSY; a maize PSY) and a phytyl ester synthase (e.g., an astaxanthin ester Attorney Ref No: 24742-0149WO1 synthase (AES; e.g., an Adonis AES) or a xanthophyll esterase (XES; e.g., a tomato XES)). This approach has been shown to be effective with the Adonis AES gene along with two paralogue genes for CBFD or HBFD, and the high astaxanthin production is maintained over multiple genetic generations of transgenic plant. This approach is not only effective in conferring accumulation of astaxanthin-ester, but also yielded 2-10-fold higher concentrations of total astaxanthin in engineered seeds compared to previous reports. Furthermore, the purity of astaxanthin within the ketocarotenoids in the saponified extracts from engineered camelina seeds was >90 to 95%. Moreover, the seeds engineered to produce high levels of astaxanthin showed no impairment in germination and little to no reduction in total oil content relative to non- engineered camelina seeds. In one aspect, nucleic acid constructs are provided. Such nucleic acid constructs typically include a nucleic acid molecule that encodes at least one carotenoid beta-ring 4-dehydrogenase (CBFD), a nucleic acid molecule that encodes at least one carotenoid 4-hydroxy-beta-ring 4- dehydrogenase (HBFD), optionally, a nucleic acid molecule that encodes at least one phytoene synthase (PSY), and at least one promoter driving expression of the at least one CBFD, the at least one HBFD, and the optionally at least one PSY. In some embodiments, the at least one nucleic acid molecule that encodes the at least one CBFD is an Adonis aestivalis nucleic acid molecule. In some embodiments, the at least one nucleic acid molecule that encodes the at least one CBFD has the nucleic acid sequence shown in SEQ ID NO:1 or SEQ ID NO:3. In some embodiments, the at least one CBFD has the amino acid sequence shown in SEQ ID NO:2 or SEQ ID NO:4, respectively. In some embodiments, the at least one nucleic acid molecule that encodes the at least one HBFD is an Adonis aestivalis nucleic acid molecule. In some embodiments, the at least one nucleic acid molecule that encodes the at least one HBFD has the nucleic acid sequence shown in SEQ ID NO:5 or SEQ ID NO:7. In some embodiments, the at least one HBFD has the amino acid sequence shown in SEQ ID NO:6 or SEQ ID NO:8, respectively. In some embodiments, the at least one nucleic acid molecule that encodes the at least one PSY is a maize nucleic acid molecule. In some embodiments, the at least one nucleic acid molecule that encodes the at least one PSY has the nucleic acid sequence shown in SEQ ID NO:15 or SEQ ID NO:17. In some embodiments, the at least one PSY has the amino acid sequence shown in SEQ ID NO:16 or SEQ ID NO:18, respectively. Attorney Ref No: 24742-0149WO1 In some embodiments, the transgenic plant further includes at least one nucleic acid molecule that encodes at least one phytyl ester synthase under control of the at least one promoter. In some embodiments, the at least one phytyl ester synthese is an astaxanthin ester synthase (AES) or xanthophyll esterase (XES). In some embodiments, the at least one nucleic acid molecule that encodes the at least one AES is an Adonis aestivalis nucleic acid molecule. In some embodiments, the at least one nucleic acid molecule the at least one AES has the nucleic acid sequence shown in SEQ ID NO:9 or In some embodiments, the at least one AES has the amino acid sequence shown in SEQ ID NO:10 or SEQ ID NO:12, respectively. In some embodiments, the at least one nucleic acid molecule that encodes the at least one XES is a tomato nucleic acid molecule. In some embodiments, the at least one nucleic acid molecule that encodes the at least one XES has the nucleic acid sequence shown in SEQ ID NO:13. In some embodiments, the at least one XES has the amino acid sequence shown in SEQ ID NO:14. In some embodiments, the at least one promoter is a constitutive promoter, a tissue- specific promoter, or an inducible promoter. In some embodiments, the constitutive promoter is selected from a mosaic virus promoter (e.g., cauliflower mosaic virus promoter) or a ubiquitin promoter. In some embodiments, the tissue-specific promoter is a promoter from a seed storage protein gene. In some embodiments, the inducible promoter is selected from a promoter for dexamethasone or a promoter for methoxyfenoside. In another aspect, transgenic plants are provided that include at least one nucleic acid molecule that encodes at least one carotenoid beta-ring 4-dehydrogenase (CBFD), at least one carotenoid 4-hydroxy-beta-ring 4-dehydrogenase (HBFD), and, optionally, at least one phytoene synthase (PSY) under control of at least one promoter. In some embodiments, the transgenic plant further comprises at least one nucleic acid molecule that encodes at least one phytyl ester synthase under control of the at least one promoter. In some embodiments, the transgenic plants are soybean plants. In some embodiments, the transgenic plants are camelina plants. In some embodiments, the transgenic plants are selected from canola, rapeseed, Ethiopian mustard, black mustard, pennycress, sunflower, peanut, and safflower plants. Attorney Ref No: 24742-0149WO1 In still another aspect, seed produced from the transgenic plants described herein are provided. In yet another aspect, vegetative (i.e., non-seed) tissue produced from the transgenic plants described herein are provided. In some embodiments, the vegetative (non-seed) tissue is selected from fruits, roots, tubers, and other vegetative tissues. In yet another aspect, methods of making astaxanthin and / or astaxanthin-esters are provided. Such methods typically include providing tissue from the transgenic plants described herein; and collecting the astaxanthin and / or astaxanthin-esters contained in the tissue. In some embodiments, the tissue from the transgenic plant is vegetative. In some embodiments, the tissue from the transgenic plant is seed. In one aspect, methods of making astaxanthin and / or astaxanthin-esters are provided. Such methods typically include providing seed from the transgenic plants described herein; growing the seed into a transgenic plant under conditions where the nucleic acid molecules are expressed; and collecting the transgenic plant or plant tissue from the transgenic plant that comprises the astaxanthin and / or astaxanthin-esters. In some embodiments, the transgenic plant or plant tissue from the transgenic plant comprises greater than about 100 ^g of astaxanthin and / or astaxanthin-esters per g of dry weight of the transgenic plant tissue. In some embodiments, the transgenic plant or plant tissue from the transgenic plant comprises about 100 to about 200 ^g of astaxanthin and / or astaxanthin-esters per g of dry weight of the transgenic plant tissue. In still another aspect, genetically-engineered microbes are provided. Such genetically- engineered microbes typically include at least one nucleic acid molecule that encodes at least one carotenoid beta-ring 4-dehydrogenase (CBFD), at least one carotenoid 4-hydroxy-beta-ring 4- dehydrogenase (HBFD), and, optionally, at least one phytoene synthase (PSY) under control of at least one promoter. In some embodiments, the genetically-engineered microbe further comprises at least one nucleic acid molecule that encodes at least one phytyl ester synthase under control of the at least one promoter. In yet another aspect, methods of making astaxanthin and / or astaxanthin-esters are provided. Such methods typically include providing the genetically-engineered microbes described herein; culturing the genetically-engineered microbe under conditions where the Attorney Ref No: 24742-0149WO1 nucleic acid molecules are expressed; and collecting the astaxanthin and / or astaxanthin-esters produced by the genetically-engineered microbe. In still another aspect, astaxanthin and / or astaxanthin-esters made by the methods described herein are provided. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the methods and compositions of matter belong. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the methods and compositions of matter, suitable methods and materials are described below. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. DESCRIPTION OF DRAWINGS FIG.1 is a thin layer chromatography (TLC) plate showing carotenoid separation in leaves from Adonis aestivalis flower sepal and petal.1, astaxanthin; 2, astaxanthin monoester; 3, adonirubin ester; 4, astaxanthin-diesters. FIG.2 is a schematic representation of key transcript expressions in the carotenoid / astaxanthin biosynthesis pathway in Adonis aestivalis flower petals. FIG.3 are schematic structures of T-DNAs for transient expression into Nicotiana benthamiana and generation of transgenic camelina plants. Transient expression vectors, p35S- ASX, p35S-ASX-AES1, p35S-ASX-AES2 and p35S-ASX-XES. Camelina transformation vectors, pASXx2, pASXx2-AES and pASXx2-XES. Soybean transformation vectors, Soy- pASX, Soy-pASXx2, Soy-pASXx2-AES and Soy-pASXx2-XES. LB, left border; RB, right border; 35S Pro, cauliflower mosaic virus 35S promoter; Gly Pro, soybean glycinin promoter; Gly Ter, soybean glycinin terminator; T, cauliflower mosaic virus 35S terminator; CBFD, Adonis carotenoid β-ring 4-dehydrogenase; HBFD, Adonis carotenoid 4-hydroxy-β-ring 4- dehydrogenase; ZmPSY, maize phytoene synthase; AaAES, Adonis astaxanthin ester synthase; SlXES, tomato xanthophyll esterase (XES). Attorney Ref No: 24742-0149WO1 FIG.4 is a TLC plate showing carotenoid separation in leaves from transiently expressed p35S-ASX, p35S-ASX-AES1, p35S-ASX-AES2, or p35S-ASX-XES.1, adonixanthin; 2, astaxanthin; 3, adonirubin; 4, canthaxanthin; 5, echinenone; 6, beta-carotene; 7, astaxanthin- diesters. FIG.5 are images of camelina seed showing seed color differentiation between non- transgenic (NT) seed and transgenic seed (T2generation) expressing pASXx2, pASXx2-AES or pASXx2-XES. FIG.6A-6B are graphs showing seed weight comparison between NT and transgenic (6A, T2generation; 6B, T3generation) lines expressing pASXx2, pASXx2-AES, or pASXx2- XES. Error bar indicates mean ±SD. FIG.7 is a photo showing growth comparison in greenhouse-grown plants between NT and transgenic (T2 generation) lines expressing pASXx2, pASXx2-AES, or pASXx2-XES. FIG.8 is a graph showing results of seed germination assays between NT and transgenic (T2 generation) lines expressing pASXx2, pASXx2-AES, or pASXx2-XES. Error bar indicates mean ±SD. FIG. 9 is a graph showing seed oil content in seed of NT and transgenic (T3generation) lines expressing pASXx2, pASXx2-AES, or pASXx2-XES. Error bar indicates mean ±SD. FIG.10 is a TLC plate showing carotenoid separation using seeds of NT and transgenic (T2generation) lines expressing pASXx2, pASXx2-AES, or pASXx2-XES.1, lutein; 2, astaxanthin; 3, astaxanthin-monoester; 4, astaxanthin-diesters. FIG.11 is a bar graph showing carotenoid content in seed of NT and transgenic (T2 generation) lines expressing pASXx2, pASXx2-AES, or pASXx2-XES. Error bar indicates mean ±SD. FIG.12 are images of soybean seed showing seed color differentiation between Soy- pASX lines or Soy-pASXx2-XES lines (T2 generation). FIG.13 is a TLC plate showing carotenoid separation using seeds of NT and transgenic (T2 generation) soybean lines expressing Soy-pASX, or Soy-pASXx2-XES. Lane 1 “Adonis extracts” are carotenoid extracts from Adonis petals. Lane 2 “Syn-ASX” are synthetic astaxanthin.1, ketocarotenoid, astaxanthin; 3, astaxanthin-monoester; 4, adonis-ester; 5, astaxanthin-diesters. Attorney Ref No: 24742-0149WO1 FIG.14 shows carotenoid content (μg / g dry weight (dw)) in seed of NT and transgenic (T2 generation) soybean lines expressing Soy-pASX, or Soy-pASXx2-XES. FIG.15 are schematic structures for microbial expression vectors. Yeast triose phosphate isomerase 1 (TPI1) promoter was selected to drive the astaxanthin biosynthetic gene set constitutively. To optimize the expression of enzymes, plastid transit peptide of AaAES1, CBFD1, and CBFD2 were deleted based on TargetP-2.0 prediction (N-terminal 28 aa of AaAES1, 55 aa of CBFD1, and 53 aa of CBFD2, respectively). Each CBFD and HBFD gene was fused with self-cleaving P2A peptide. The vectors shown were generated using the commercial plasmid backbones pRS42H, pRS42N and pRS42K, and contain HBFD1 and CBFD1 genes with transit peptides deleted (“dN”) for vector pRS42H-TPI1-Asta1; HBFD2 and CBFD2 with transit peptides deleted (“dN”) for pRS42H-TPI1-Asta2; and AsAES1 in pRS42K-TPI1-AaAES. DETAILED DESCRIPTION This disclosure describes a new biosynthetic pathway for generating astaxanthing or astaxanthin esters based on transcriptome analysis of Adonis flower petals. Arabidopsis carotenoid pathway (ath00906) from KEGG (Kyoto Encyclopedia of Genes and Genomes) pathway was used as a reference. It was discovered that many of the genes involved in carotenoid biosynthesis, including adonixanthin adonirubin, astaxanthin and astaxanthin esters, have two isoforms. This disclosure describes the carotenoid pathway in the Adonis plant, and methods and compositions for enriching astaxanthin and astaxanthin esters in vegetative tissues and seeds of crops. The methods include co-expressing, under direction of at least one constitutive promoter (e.g., a mosaic virus promoter (e.g., cauliflower mosaic virus promoter) or a ubiquitin promoter), tissue-specific promoter (e.g., a promoter from a seed-storage protein gene) or inducible promoter (e.g., a promoter for dexamethasone or methoxyfenoside), at least one transgene for carotenoid β-ring 4-dehydrogenase (CBFD1 or CBFD2), at least one transgene for carotenoid 4- hydroxy-β-ring 4-dehydrogenase (HBFD1 or HBFD2), and, optionally, at least one transgene for phytoene synthase (PSY1 or PSY2) and at least one transgene for phytyl ester synthase (e.g., astaxanthin ester synthase (AES1 of AES2) or xanthophyll esterase (SlXES)). Representative sequences involved in astaxanthin biosynthesis and suitable for use in the compositions and methods described herein are carotenoid β-ring 4-dehydrogenase (CBFD1 Attorney Ref No: 24742-0149WO1 (SEQ ID NO:2 encoded by SEQ ID NO:1) or CBFD2 (SEQ ID NO:4 encoded by SEQ ID NO:3)), which catalyze the hydroxylation of β-ring of β-carotene, and carotenoid 4-hydroxy-β- ring 4-dehydrogenase (HBFD1 (SEQ ID NO:6 encoded by SEQ ID NO:5) or HBFD2 (SEQ ID NO:8 encoded by SEQ ID NO:7)) which involve conversion of the hydroxyl group to the ketone group of 4-hydroxy-β-ring. Representative phytoene synthase sequences suitable for use in the compositions and methods described herein is a maize phytoene synthase (PSY1 (SEQ ID NO:16 encoded by SEQ ID NO:15; see, also, GenBank Accession No, NP_001108124.2 encoded by GenBank Accession No, NM_001114652.2) or PSY2 (SEQ ID NO:18 encoded by SEQ ID NO:17)). The inclusion of a phytyl ester synthase (e.g., astaxanthin ester synthase or xanthophyll esterase) significantly increases the amount of astaxanthin produced in the plant. Representative phytyl ester synthase genes suitable for use in the compositions and methods described herein are astaxanthin ester synthase (AES1 (SEQ ID NO:10 encoded by SEQ ID NO:9) or AES2 (SEQ ID NO:12 encoded by SEQ ID NO:11)), which are involved in production of astaxanthin ester, and SlXES (XES (SEQ ID NO:14 encoded by SEQ ID NO:13; GenBank Accession No, XP_004230141.1 encoded by GenBank Accession No, XM_004230093)), which encodes xanthophyll esterase in tomato. Co-expression of the combination of genes described herein (e.g., astaxanthin biosynthetic genes (CBFD1 or CBFD2 and HBFD1 or HBFD2) and, optionally, phytoene synthase gene (PSY1 or PSY2) and / or phytyl ester synthase (e.g., astaxanthin ester synthase (AES)) unexpectedly enhanced astaxanthin ester production in seeds. Top-performing T2 events contained > 250 µg astaxanthin / g plant tissue, measured following saponification of astaxanthin esters (e.g., greater than 100 µg astaxanthin / g plant tissue; between about 100 to about 150 µg astaxanthin / g plant tissue; between about 100 µg and about 300 µg astaxanthin / g plant tissue). This represents an increase in astaxanthin concentrations of greater than 1.8-fold higher (e.g., greater than 2-fold higher; greater than 2.5-fold higher) than that conferred by expression of only the astaxanthin biosynthetic genes and phytoene synthase gene (i.e., in the absence of the AES gene). Thus, a phytyl ester synthase such as astaxanthin ester synthase can be included to significantly improve astaxanthin quantity and relative purity in plant material. Simply by way of example, transient expression of two distinct astaxanthin biosynthetic genes, CBFD1 or CBFD2 and HBFD1 or HBFD2, with or without co-expression of a phytyl Attorney Ref No: 24742-0149WO1 ester synthase gene (e.g., AES1 or AES2 or SlXES), under control of a constitutive promoter producted astaxanthin and astaxanthin esters in leaves of Nicotiana benthamiana. In the presence of AES1 or SlXES, however, expression of astaxanthin and astaxanthin esters was significantly increased. In one embodiment, transgenic expression of astaxanthin biosynthetic genes, CBFD1 or 2 and HBFD1 or 2, phytoene synthase gene, and astaxanthin ester synthase gene were shown to yield 137 to 250 ^g astaxanthin / g of seed dry weight (dw) (free type of astaxanthin and astaxanthin esters) in camelina. In the absence of the astaxanthin ester synthase gene, expression of the astaxanthin biosynthetic genes and phytoene synthase gene yielded 140 to 151 ^g astaxanthin / g seed dw in camelina. In another embodiment, transgenic soybean lines expressing astaxanthin biosynthetic genes, CBFD1 or CBFD2 and HBFD1 or HBFD2, and astaxanthin ester synthase gene, SlXES, were shown to yield 10.5 to 12.6 μg astaxanthin / g of seed dw and 35.9 to 38.2 μg astaxanthin esters / g of seed dw in seed of Soy-pASXx2-XES that includes SlXES. In the absence of the SlXES astaxanthin ester synthase gene, seed of Soy-pASX accumulated 8.4 to 11.1 μg astaxanthin / g of seed dw and 11.1 to 21.2 μg astaxanthin esters / g seed dw. These results show that an astaxanthin ester synthase such as SlXES can confer >two-fold increase in total astaxanthin (free and esterified) concentrations. Additional sequences involved in various aspects of the carotenoid biosynthetic pathway include, for example, phytoene desaturase (PDS1 (SEQ ID NO:20 encoded by SEQ ID NO:19) or PDS2 (SEQ ID NO:22 encoded by SEQ ID NO:21)), 15-cis-ζ-carotene isomerase (Z-ISO1 (SEQ ID NO:24 encoded by SEQ ID NO:23) or Z-ISO2 (SEQ ID NO:26 encoded by SEQ ID NO:25)), ζ-carotene desaturase (ZDS1 (SEQ ID NO:28 encoded by SEQ ID NO:27) or ZDS2 (SEQ ID NO:30 encoded by SEQ ID NO:29)), carotenoid isomerase (CRTISO1 (SEQ ID NO:32 encoded by SEQ ID NO:31) or CRTISO2 (SEQ ID NO:34 encoded by SEQ ID NO:33)), LYCOPENE CYCLASe (LYC1 (SEQ ID NO:36 encoded by SEQ ID NO:35) or LYC2 (SEQ ID NO:38 encoded by SEQ ID NO:37)), CYP96A3 (CYP96A3-1 (SEQ ID NO:40 encoded by SEQ ID NO:39) or CYP96A3-2 (SEQ ID NO:44 encoded by SEQ ID NO:43)), and β-carotenoid hydroxylase (BCH1 (SEQ ID NO:46 encoded by SEQ ID NO:45) or BCH2 (SEQ ID NO:48 encoded by SEQ ID NO:47)). Such additional sequences optionally can be co-expressed in the transgenic plants described herein in order to alter, for example, the amount of astaxanthin and astaxanthin esters and other ketocarotenoids produced. Attorney Ref No: 24742-0149WO1 Nucleic Acids and Polypeptides As used herein, nucleic acids include DNA and RNA, and also can include one or more nucleotide analogs or backbone modifications. A nucleic acid can be single stranded or double stranded, and circular or linear. A construct for expressing a nucleic acid (e.g., a nucleic acid that encodes a polypeptide) also is provided. Expression constructs are commercially available or can be produced by recombinant DNA techniques routine in the art. A construct containing a nucleic acid can have expression elements operably linked to such a nucleic acid, and further can include sequences such as those encoding a selectable marker (e.g., an antibiotic resistance gene). A construct containing a nucleic acid can encode a chimeric or fusion polypeptide (i.e., a polypeptide operatively linked to a heterologous polypeptide, which can be at either the N-terminus or C- terminus of the polypeptide). Representative heterologous polypeptides are those that can be used in purification of the encoded polypeptide (e.g., 6xHis tag, glutathione S-transferase (GST)) Expression elements include nucleic acid sequences that direct and regulate expression of nucleic acid coding sequences. One example of an expression element is a promoter sequence. Expression elements also can include introns, enhancer sequences, response elements, or inducible elements that modulate expression of a nucleic acid. Expression elements can be of bacterial, yeast, insect, mammalian, or viral origin, and constructs can contain a combination of elements from different origins. As used herein, operably linked means that a promoter or other expression element(s) are positioned in a construct relative to a nucleic acid in such a way as to direct or regulate expression of the nucleic acid. Many methods for introducing nucleic acids into host cells, both in vivo and in vitro, are well known to those skilled in the art and include, without limitation, electroporation, calcium phosphate precipitation, polyethylene glycol (PEG) transformation, heat shock, lipofection, microinjection, and viral-mediated nucleic acid transfer. Constructs as described herein can be introduced into a host cell. As used herein, “host cell” refers to the particular cell into which the nucleic acid is introduced and also includes the progeny or potential progeny of such a cell. A host cell can be any prokaryotic or eukaryotic cell. For example, nucleic acids can be expressed in bacterial cells such as E. coli, or in insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art. Attorney Ref No: 24742-0149WO1 As used herein, an “isolated” nucleic acid molecule is a nucleic acid molecule that is free of sequences that naturally flank one or both ends of the nucleic acid in the genome of the organism from which the isolated nucleic acid molecule is derived (e.g., a cDNA or genomic DNA fragment produced by PCR or restriction endonuclease digestion). Such an isolated nucleic acid molecule is generally introduced into a construct (e.g., a cloning vector, or an expression construct) for convenience of manipulation or to generate a fusion nucleic acid molecule. In addition, an isolated nucleic acid molecule can include an engineered nucleic acid molecule such as a recombinant or a synthetic nucleic acid molecule. As used herein, a “purified” polypeptide is a polypeptide that has been separated or purified from cellular components that naturally accompany it. Typically, the polypeptide is considered “purified” when it is at least 70% (e.g., at least 75%, 80%, 85%, 90%, 95%, or 99%) by dry weight, free from the proteins and naturally occurring molecules with which it is naturally associated. Since a polypeptide that is chemically synthesized is, by nature, separated from the components that naturally accompany it, a synthetic polypeptide is “purified.” Nucleic acids can be isolated using techniques known in the art. For example, nucleic acids can be isolated using any method including, without limitation, recombinant nucleic acid technology and / or the polymerase chain reaction (PCR). General PCR techniques are described, for example in PCR Primer: A Laboratory Manual, Dieffenbach & Dveksler, Eds., Cold Spring Harbor Laboratory Press, 1995. Recombinant nucleic acid techniques include, for example, restriction enzyme digestion and ligation, which can be used to isolate a nucleic acid. Isolated nucleic acids also can be chemically synthesized, either as a single nucleic acid molecule or as a series of oligonucleotides. Polypeptides can be purified from natural sources (e.g., a biological sample) by known methods such as DEAE ion exchange, gel filtration, and hydroxyapatite chromatography. A polypeptide also can be purified, for example, by expressing a nucleic acid in an expression construct. In addition, a purified polypeptide can be obtained by chemical synthesis. The extent of purity of a polypeptide can be measured using any appropriate method, e.g., column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis. Nucleic acids can be detected using any number of amplification techniques (see, e.g., PCR Primer: A Laboratory Manual, 1995, Dieffenbach & Dveksler, Eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; and U.S. Patent Nos.4,683,195; 4,683,202; Attorney Ref No: 24742-0149WO1 4,800,159; and 4,965,188) with an appropriate pair of oligonucleotides (e.g., primers). A number of modifications to the original PCR have been developed and can be used to detect a nucleic acid. Nucleic acids also can be detected using hybridization. Hybridization between nucleic acids is discussed in detail in Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Sections 7.37-7.57, 9.47-9.57, 11.7-11.8, and 11.45-11.57). Sambrook et al. discloses suitable Southern blot conditions for oligonucleotide probes less than about 100 nucleotides (Sections 11.45-11.46). The Tm between a sequence that is less than 100 nucleotides in length and a second sequence can be calculated using the formula provided in Section 11.46. Sambrook et al. additionally discloses Southern blot conditions for oligonucleotide probes greater than about 100 nucleotides (see Sections 9.47-9.54). The Tm between a sequence greater than 100 nucleotides in length and a second sequence can be calculated using the formula provided in Sections 9.50-9.51 of Sambrook et al. The conditions under which membranes containing nucleic acids are prehybridized and hybridized, as well as the conditions under which membranes containing nucleic acids are washed to remove excess and non-specifically bound probe, can play a significant role in the stringency of the hybridization. Such hybridizations and washes can be performed, where appropriate, under moderate or high stringency conditions. For example, washing conditions can be made more stringent by decreasing the salt concentration in the wash solutions and / or by increasing the temperature at which the washes are performed. In addition, interpreting the amount of hybridization can be affected, for example, by the specific activity of the labeled oligonucleotide probe, by the number of probe-binding sites on the template nucleic acid to which the probe has hybridized, and by the amount of exposure of an autoradiograph or other detection medium. It will be readily appreciated by those of ordinary skill in the art that although any number of hybridization and washing conditions can be used to examine hybridization of a probe nucleic acid molecule to immobilized target nucleic acids, it is more important to examine hybridization of a probe to target nucleic acids under identical hybridization, washing, and exposure conditions. Preferably, the target nucleic acids are on the same membrane. Attorney Ref No: 24742-0149WO1 A nucleic acid molecule is deemed to hybridize to a nucleic acid but not to another nucleic acid if hybridization to a nucleic acid is at least 5-fold (e.g., at least 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 50-fold, or 100-fold) greater than hybridization to another nucleic acid. The amount of hybridization can be quantitated directly on a membrane or from an autoradiograph using, for example, a PhosphorImager or a Densitometer (Molecular Dynamics, Sunnyvale, CA). Polypeptides can be detected using antibodies. Techniques for detecting polypeptides using antibodies include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations and immunofluorescence. An antibody can be polyclonal or monoclonal. An antibody having specific binding affinity for a polypeptide can be generated using methods well known in the art. The antibody can be attached to a solid support such as a microtiter plate using methods known in the art. In the presence of a polypeptide, an antibody-polypeptide complex is formed. Detection (e.g., of an amplification product, a hybridization complex, or a polypeptide) is usually accomplished using detectable labels. The term “label” is intended to encompass the use of direct labels as well as indirect labels. Detectable labels include enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. A skilled artisan will appreciate that changes can be introduced into a nucleic acid molecule (e.g., into SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, or 47), thereby leading to changes in the amino acid sequence of the encoded polypeptide (e.g., SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46 or 48). For example, changes can be introduced into nucleic acid coding sequences using mutagenesis (e.g., site-directed mutagenesis, PCR-mediated mutagenesis) or by chemically synthesizing a nucleic acid molecule having such changes. Such nucleic acid changes can lead to conservative and / or non-conservative amino acid substitutions at one or more amino acid residues. A “conservative amino acid substitution” is one in which one amino acid residue is replaced with a different amino acid residue having a similar side chain (see, for example, Dayhoff et al. (1978, in Atlas of Protein Sequence and Structure, 5(Suppl.3):345-352), which provides frequency tables for amino acid substitutions), and a non-conservative substitution is one in which an amino acid residue is replaced with an amino acid residue that does not have a similar side chain. Attorney Ref No: 24742-0149WO1 A skilled artisan will appreciate that a nucleic acid molecule into which one or more changes have been introduced (e.g., SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, or 47), thereby leading to changes in the amino acid sequence of the encoded polypeptide (e.g., SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46 or 48), can be used in the constructs and methods described herein. For example, nucleic acids and polypeptides that differ in sequence from SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, or 47 and SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46 or 48, can have at least 80% sequence identity (e.g., at least 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity) to SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, or 47 and SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46 or 48, respectively. In calculating percent sequence identity, two sequences are aligned and the number of identical matches of nucleotides or amino acid residues between the two sequences is determined. The number of identical matches is divided by the length of the aligned region (i.e., the number of aligned nucleotides or amino acid residues) and multiplied by 100 to arrive at a percent sequence identity value. It will be appreciated that the length of the aligned region can be a portion of one or both sequences up to the full-length size of the shortest sequence. It also will be appreciated that a single sequence can align with more than one other sequence and hence, can have different percent sequence identity values over each aligned region. The alignment of two or more sequences to determine percent sequence identity can be performed using the algorithm described by Altschul et al. (1997, Nucleic Acids Res., 25:3389 3402) as incorporated into BLAST (Basic Local Alignment Search Tool) programs, available at ncbi.nlm.nih.gov on the World Wide Web. BLASTN is the program used to align and compare the identity between nucleic acid sequences, while BLASTP is the program used to align and compare the identity between amino acid sequences. When utilizing BLAST programs to calculate the percent identity between a sequence and another sequence, the default parameters of the respective programs generally are used. Attorney Ref No: 24742-0149WO1 Plants and Methods of Making Transgenic plants are provided that contain a nucleic acid construct as described herein. Such transgenic plants exhibit an increase in the amount of astaxanthin in vegetative tissues (e.g., fruits, roots, tubers, and other vegetative tissues) or seeds relative to a plant lacking or not expressing the construct. Plants that can be made transgenic using the compositions and methods described herein include, without limitation, oilseed crops such as, without limitation, soybean, canola, rapeseed, sunflower, camelina, safflower, peanut, pennycress, Ethiopian mustard, black mustard, and Brassica rapa as well as biomass crops such as, without limitation, sorghum, miscanthus, tobacco, maize, rice, wheat, duckweed, rye, and sugarcane. Methods of introducing a nucleic acid (e.g., a nucleic acid construct) into plant cells are known in the art and include, for example, particle bombardment, Agrobacterium-mediated transformation, microinjection, polyethylene glycol-mediated transformation (e.g., of protoplasts, see, for example, Yoo et al. (2007, Nature Protocols, 2(7):1565-72)), liposome- mediated DNA uptake, or electroporation. Following transformation, the transgenic plant cells can be regenerated into transgenic plants. As described herein, expression of the nucleic acid construct results in plants that exhibit an increase in the amount of astaxanthin in the vegetative tissues or seeds relative to a plant not expressing the nucleic acid construct. Following transformation, cells can be regenerated into T0transgenic plants or a subsequent generation of plants (e.g., T1, T2, T3, etc.), which can be screened for expression of one or more genes from the nucleic acid construct and / or the amount of astaxanthin in the vegetative tissues and the seeds. Screening for plants expressing one or more genes from the nucleic acid construct or for the amount of astaxanthin in the vegetative tissues and the seeds can be performed using methods routine in the art (e.g., immunoassay, chromatography). Plants having increased amounts of astaxanthin in the vegetative tissues or seeds (compared to the amount of astaxanthin in the vegetative tissues or seeds of a corresponding plant lacking the construct) can be selected and used, for example, in a breeding program as discussed herein. As used herein, an increase in the amount of astaxanthin in the vegetative tissues or seeds of the plant refers to an increase (e.g., a statistically significant increase) in the amount of astaxanthin in the vegetative tissues or seeds by at least about 5% up to about 95% (e.g., about 5% to about 10%, about 5% to about 20%, about 5% to about 50%, about 5% to about 75%, Attorney Ref No: 24742-0149WO1 about 10% to about 25%, about 10% to about 50%, about 10% to about 90%, about 20% to about 40%, about 20% to about 60%, about 20% to about 80%, about 25% to about 75%, about 50% to about 75%, about 50% to about 85%, about 50% to about 95%, and about 75% to about 95%) relative to the amount of astaxanthin in the vegetative tissues or seeds from a corresponding plant lacking the nucleic acid construct grown under corresponding conditions. As used herein, statistical significance refers to a p-value of less than 0.05, e.g., a p-value of less than 0.025 or a p-value of less than 0.01, using an appropriate measure of statistical significance, e.g., a one- tailed two sample t-test. A transgenic plant as described herein can be used in a plant breeding program to create new and useful cultivars, lines, varieties and hybrids. Thus, in some embodiments, a T1, T2, T3or later generation plant containing the nucleic acid construct can be crossed with a second plant, and progeny of the cross in which the construct is present can be identified. It will be appreciated that the second plant can exhibit a phenotypic trait such as, for example, disease resistance, high yield, leaf quality, height, plant maturation, stalk size, and / or leaf number per plant. In some instances, the second plant can express the same or a different transgene or nucleic acid construct as the plant to which it is crossed. Additionally or alternatively, the second plant can have one or more mutations, or be a wild-type plant. Plant breeding is carried out using known procedures. DNA fingerprinting, SNP or similar technologies may be used in a marker-assisted selection (MAS) breeding program to transfer or breed mutant alleles into other lines, varieties or cultivars, as described herein. Progeny of the cross can be screened for the construct, expression of the construct, or the phenotype using methods described herein, and plants having the desired feature can be selected. For example, plants in the backcross generations (BC1) can be screened using one or more of the methods described herein. Plants also can be screened for the amount of astaxanthin in the vegetative tissues or seeds, and those plants having the desired phenotype, compared to a corresponding plant that lacks the construct, can be selected. Plants identified as possessing the nucleic acid construct or the desired phenotype can be backcrossed or self-pollinated to create a second population to be screened. Backcrossing or other breeding procedures can be repeated until the desired phenotype of the recurrent parent is recovered. Successful crosses yield F1plants that are fertile and that can be backcrossed with one of the parents if desired. In some embodiments, a plant population in the F2 generation is screened Attorney Ref No: 24742-0149WO1 for the appropriate gene expression using standard methods (e.g., PCR). Selected plants then can be crossed with one of the parents and the first backcross (BC1) generation plants can be self- pollinated to produce a BC1F2population that is again screened for appropriate gene expression. The process of backcrossing, self-pollination, and screening can be repeated, for example, four or more times until the final screening produces a plant that is fertile and reasonably similar to the recurrent parent. This plant, if desired, can be self-pollinated and the progeny can be subsequently screened again to confirm that the plant expresses the appropriate sequences and exhibits the proper phenotype. Breeder’s seed of the selected plant can be produced using standard methods including, for example, field testing, genetic analysis, and / or confirmation of the phenotype. The result of a plant breeding program using the transgenic plants described herein are new and useful cultivars, varieties, lines, and hybrids. As used herein, the term “variety” refers to a population of plants that share constant characteristics which separate them from other plants of the same species. A variety is often, although not always, sold commercially. While possessing one or more distinctive traits, a variety can be further characterized by a very small overall variation between individuals with that variety. A “pure line” variety may be created by several generations of self-pollination and selection, or vegetative propagation from a single parent using tissue or cell culture techniques. A “line,” as distinguished from a variety, most often denotes a group of plants used non-commercially, for example, in plant research. A line typically displays little overall variation between individuals for one or more traits of interest, although there may be some variation between individuals for other traits. Depending on the plant, hybrids can be produced by preventing self-pollination of female parent plants (i.e., seed parents) of a first variety, permitting pollen from male parent plants of a second variety to fertilize the female parent plants, and allowing F1 hybrid seeds to form on the female plants. Self-pollination of female plants can be prevented by emasculating the flowers at an early stage of flower development. Alternatively, pollen formation can be prevented on the female parent plants using a form of male sterility. For example, male sterility can be produced by cytoplasmic male sterility (CMS), nuclear male sterility, genetic male sterility, molecular male sterility wherein a transgene inhibits microsporogenesis and / or pollen formation, or self- incompatibility. Female parent plants containing CMS are particularly useful. In embodiments in which the female parent plants are CMS, the male parent plants typically contain a fertility Attorney Ref No: 24742-0149WO1 restorer gene to ensure that the F1 hybrids are fertile. In other embodiments in which the female parents are CMS, male parents can be used that do not contain a fertility restorer. F1 hybrids produced from such parents are male sterile. Male sterile hybrid seed can be interplanted with male fertile seed to provide pollen for seed-set on the resulting male sterile plants. Methods of Making Astaxanthin Transgenic plants described herein can be used to obtain astaxanthin and / or astaxanthin- esters using known methods (see, e.g., the Example section). As described herein, astaxanthin and / or astaxanthin-esters can be obtained from vegetative tissues or seed tissue. Additionally or alternatively, transgenic seed as described herein can be grown into a transgenic plant that expresses the nucleic acid molecule, and the astaxanthin and / or astaxanthin-esters can be obtained from tissue from the transgenic plant. Host cells as described herein (e.g., a microbe) can be genetically engineered to contain a vector as described herein expressing at least one carotenoid beta-ring 4-dehydrogenase (CBFD), at least one carotenoid 4-hydroxy-beta-ring 4-dehydrogenase (HBFD), and, optionally, at least one phytoene synthase (PSY) under control of a promoter. As described herein, such genetically- engineered microbes also can express at least one phytyl ester synthase under control of the same or a different promoter. Such genetically engineered microbes can be used to produce astaxanthin and / or astaxanthin-esters by culturing the genetically-engineered microbes under conditions in which expression takes place and collecting the astaxanthin and / or astaxanthin-esters produced by the genetically-engineered microbe in culture. Methods of obtaining (e.g., extracting, purifying, etc.) are known in the art. As described herein, large amounts of astaxanthin and / or astaxanthin-esters can be made using the methods described herein. In accordance with the present invention, there may be employed molecular biology, microbiology, biochemical, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. The invention will be further described in the following examples, which do not limit the scope of the methods and compositions of matter described in the claims. Attorney Ref No: 24742-0149WO1 EXAMPLES Example 1—Plant Material and Growth Conditions Adonis aestivalis seeds were sown into plastic pots with soil mix composed of Metromix 300 (Sun Gro Horticulture, Agawam, MA) and cold-treated at 4°C for 1 month to break dormancy. After that, pots were transferred to the walk-in growth chamber and grown under condition utilizing a 16 / 8 h photoperiod with day / night temperatures of 27~29°C / 19~21°C. Camelina were sown into plastic pots with the same soil mix as the Adonis plants and grown under the greenhouse condition (16 / 8 h photoperiod with day / night temperatures of 27~29°C / 19~21°C). Tobacco (Nicotiana benthamiana) plants were grown for 3 weeks in the greenhouse under condition of 16 / 8 h photoperiod with day / night temperatures of 27~29°C / 19~21°C. Example 2—Transcriptome Total RNA was isolated from astaxanthin-rich flower petals of Adonis aestivalis using a RNeasy Plant Mini Kit according to the manufacturer’s protocol (Qiagen) with modified from those described previously (Kim et al., 2015, J. Exp. Bot., 66(14):4251-65). RNA was cleaned from genomic DNA contamination using DNaseI treatment (ThermoScientific). PacBio IsoSeq transcriptome and Illumina RNAseq was carried out using the isolated RNA by Genewiz Company (South Plainfield, NJ). Raw data was analyzed by standard bioinformatics methods to obtain a de novo Adonis aestivalis flower petal transcriptome and to map Illumina reads onto the transcriptome. The latter also generated quantitative measurements of the expression of each gene in the Adonis aestivalis flower petals. These data were mined to obtain sequences for candidate astaxanthin biosynthetic and astaxanthin ester synthase genes based on similarity to known astaxanthin biosynthetic and phytyl ester synthase genes. Candidate genes and their use for engineering astaxanthin and astaxanthin esters in transgenic camelina and soybean seeds, and in microbes and for functional evaluation by transient transformation of Nicotiana benthamiana leaves, are described herein. Attorney Ref No: 24742-0149WO1 Example 3—Binary Vectors Binary vectors for camelina plants were constructed by GoldenBraid assembly method (Sarrion-Perdigones et al., 2013, Plant Phys., 162:1618-31). Genes used in vector construction were GoldenBraid-domesticated by gene synthesis (GenScript Biotech, Piscataway, NJ). Genes used in this study are listed; Adonis aestivalis carotenoid β-ring 4-dehydrogenase 1 (CBFD1, SEQ ID NO:2 encoded by SEQ ID NO:1), Adonis aestivalis carotenoid β-ring 4-dehydrogenase 2 (CBFD2, SEQ ID NO:4 encoded by SEQ ID NO:3), Adonis aestivalis carotenoid 4-hydroxy-β- ring 4-dehydrogenase 1 (HBFD1, SEQ ID NO:6 encoded by SEQ ID NO:5), Adonis aestivalis carotenoid 4-hydroxy-β-ring 4-dehydrogenase 2 (HBFD2, SEQ ID NO:8 encoded by SEQ ID NO:7), maize phytoene synthase (ZmPSY, GenBank NO, NM_001114652.2), tomato xanthophyll esterase (SlXES1, GenBank NO, XM_004230093), Adonis aestivalis ester synthase 1 (AaAES1, SEQ ID NO:10 encoded by SEQ ID NO:9), and Adonis aestivalis ester synthase 2 (AaAES2, SEQ ID NO:12 encoded by SEQ ID NO:11). Each gene was driven by constitutive cauliflower mosaic virus 35S promoter for Nicotiana benthamiana infiltration assay or seed- specific Glycinin promoter for generating transgenic camelina and soybean plants. For binary vector for camelina transformation, coding regions of CBFD1, HBFD1, and ZmPSY were translationally fused with peptide linker, P2A and T2A. In addition, coding regions of CBFD2 and HBFD2 were translationally fused with peptide linker, P2A. Herbicide resistance gene (BASTA) were used for transgenic plant selection. Example 4—Nicotiana benthamiana Infiltration Assay Three-week-old tobacco plants were used for transient expression assays to functionally characterize candidate astaxanthin and astaxanthin ester biosynthetic genes. Binary vector- containing Agrobacterium was inoculated in 10 ml of liquid YEP with the appropriate antibiotics and grown for 16 h at 30°C. Agrobacterium was harvested by centrifugation and washed two times with distilled water. Cell pellet was resuspended in infiltration solution containing 10 mM MES (pH5.7), 10 mM MgCl2, and 200 mM acetosyringone to adjust OD600 = 0.2. P19-harboring Agrobacterium was co-infiltrated to increase transgene expression efficiency (Hellens et al., 2005, Plant Methods, 1:13). After five days of infiltration, leaves were collected and analyzed. Attorney Ref No: 24742-0149WO1 Example 5—Camelina or Soybean Transformation Agrobacterium-mediated floral-dip transformation was carried out to generate stable transgenic camelina plants using previously described floral vacuum infiltration method (Lu and Kang, 2008, Plant Cell Rep., 27(2):273-8). Soybean transformations were performed using the procedures previously described (Xing et al., 2000, In Vitro Cellular & Developmental Biology – Plant, 36:456-63; Zhang et al., 1999, Plant Cell, Tissue and Organ Culture, 56:37-46). Transformations were conducted using the gene expression constructs described herein. Example 6— Thin Layer Chromatography Analysis The production of ketocarotenoids, astaxanthin and astaxanthin esters in engineered plant material was assessed as described herein. The camelina and soybean seeds or N. benthamiana leaves were ground into a fine powder with liquid nitrogen using mortar and pestle. Extraction solvent (methanol:dichloromethane, 75:25, v / v) was added. One volume of distilled water was added to the samples and carotenoids were subsequently extracted with chloroform. The organic phase was transferred and evaporated under nitrogen gas. The residue was resuspended in 100% acetone. Carotenoids and neutral lipids (triacylglycerol and wax ester) from extracts were separated by a first TLC with a first mobile phase (heptane:ethyl ether:acetic acid; 80:20:0.1, v / v / v) and a subsequent second TLC with a second mobile phase (toluene:acetone; 80:20, v / v). Example 7—HPLC Analysis The production and quantification of ketocarotenoids, astaxanthin and astaxanthin esters in engineered plant material was conducted as described herein. Extraction solvent (methanol:dichloromethane, 9:1, v / v) and beta-apo-8’-carotenal as internal standards of carotenoids and tocopherol were added into ground tissues and the supernatant directly used for HPLC (Agilent 1200 Series) equipped with diode array detection (DAD). Carotenoids were separated using C18 reverse-phase columns (Agilent Eclipse XDB-C18; 5 μm, 4.6 x 150 mm) with a mobile phase that includes water (A) and methanol:methyl tert-butyl ether (8:2, v / v) (B). The gradient was 10% A: 90% B for 10 min with a flow rate of 1.0 ml / min, stepped to 10% A: 90% B for 5 min with a flow rate of 1.5 ml / min, and then to 100% B for 25 min with a flow rate of 1.5 ml / min. The column temperature was maintained at 30°C and carotenoids and tocopherols were detected by DAD at 455 nm. Using this method and the method described in Example 6, Attorney Ref No: 24742-0149WO1 transgenic expression of astaxanthin biosynthetic genes as described in Example 5, CBFD1 or CBFD2 and HBFD1 or HBFD2, SlXES1 phytoene synthase gene, and AaAES1 astaxanthin ester synthase genes assembled in binary vectors (Example 3) yielded 137 to 250 µg astaxanthin / g of seed dw (free type of astaxanthin and astaxanthin esters) in camelina. In the absence of the astaxanthin ester synthase gene, expression of the astaxanthin biosynthetic genes and phytoene synthase gene yielded 140 to 151 µg astaxanthin / g seed dw in camelina. Example 8—Agronomic Trait Measurement To assess the agronomic fitness of engineered seeds, germination assays were conducted as described herein. The dry seed weight of camelina was measured by weighing 50 seeds of each event. Germination assays were carried out by measuring the percentage of radicle emergence. Camelina seeds were sterilized with 30% clorox solution at room temp for 30 min and then washed three times with distilled water. Sterilized seeds were plated on wet filter papers and sealed in Petri dishes. Example 9—Microbial Production of Astaxanthin and Astaxanthin Esters Microbial production platforms, including bacterial, fungal, cyanobacterial, algal and yeast platforms, can be engineered for production of astaxanthin and astaxanthin esters. For example, a microbial species is engineered for beta-carotene production or a species that naturally synthesizes beta-carotene (e.g., cyanbobacteria, algae) is engineered to introduce Adonis aestivalis carotenoid beta-ring 4-dehydrogenase 1 (CBFD1, SEQ ID NO:1 encoding SEQ ID NO:2) or Adonis aestivalis carotenoid beta-ring 4-dehydrogenase 2 (CBFD2, SEQ ID NO:3 encoding SEQ ID NO:4) and Adonis aestivalis carotenoid 4-hydroxy-beta-ring 4-dehydrogenase 1 (HBFD1, SEQ ID NO:5 encoding SEQ ID NO:6) or Adonis aestivalis carotenoid 4-hydroxy- beta-ring 4-dehydrogenase 2 (HBFD2, SEQ ID NO:7 encoding SEQ ID NO:8) genes. These genes are introduced under control of a promoter, including constitutive or inducible promoters, in a microbial platform that produce beta-carotene. Expression of these genes in these platforms confers astaxanthin production. To increase the astaxanthin and ketocarotenoid titer and purity of the astaxanthin as a component of total ketocarotenoids, tomato xanthophyll esterase (SlXES1, GenBank NO, XM_004230093), Adonis aestivalis ester synthase 1 (AaAES1, SEQ ID NO:9 encoding SEQ ID NO:10), and Adonis aestivalis ester synthase 2 (AaAES2, SEQ ID NO:11 Attorney Ref No: 24742-0149WO1 encoding SEQ ID NO:12) or related ester synthase gene is introduced under control of a promoter, including constitutive and inducible promotes, into the astaxanthin-producing microbes. High titers of astaxanthin esters that are enriched in astaxanthin relative to other ketocarotenoids are produced in the microbial platform. Example 10—Microbial Expression Vectors Genes used in this study are listed; Adonis aestivalis carotenoid beta-ring 4- dehydrogenase 1 (CBFD1, SEQ ID NO:2 encoded by SEQ ID NO:1), Adonis aestivalis carotenoid beta-ring 4-dehydrogenase 2 (CBFD2, SEQ ID NO:4 encoded by SEQ ID NO:3), Adonis aestivalis carotenoid 4-hydroxy-beta-ring 4-dehydrogenase 1 (HBFD1, SEQ ID NO:6 encoded by SEQ ID NO:5), Adonis aestivalis carotenoid 4-hydroxy-beta-ring 4-dehydrogenase 2 (HBFD2, SEQ ID NO:8 encoded by SEQ ID NO:7), tomato xanthophyll esterase (SlXES1, GenBank NO, XM_004230093), Adonis aestivalis astaxanthin ester synthase 1 (AaAES1, SEQ ID NO:10 encoded by SEQ ID NO:9), and Adonis aestivalis astaxanthin ester synthase 2 (AaAES2, SEQ ID NO:12 encoded by SEQ ID NO:11). To produce astaxanthin in Baker’s yeast (Saccharomyces cerevisiae) using the aforementioned genes, beta-carotene-synthesizing yeast strain SR8B (protoproph) was used (Sun et al., Biotechnology and bioengineering, 117(11): 3522-3532.). Promoer-less yeast expression vectors pRS42H, pRS42N, and pRS42K (Taxis and Knop, 2006, Biotechniques, 40(1):73-8) were used to express ΔN_CBFD1-P2A-HBFD1 (Asta1), HBFD2-P2A-ΔN_CBFD2 (Asta2), and ΔN_AaAES1, respectively. Each vector contains drug resistantce genes as selective markers (hygromycin B phosphotransferase, kanMX, nourseothricin acetyltransferase). To add constitutive promoter to vectors, TPI1 promoter with multiple cloning sites of pYX242 (R&D systems) was amplified using the gene-specific primer set. Amplified DNA fragment was inserted into subcloning vector pCR-II Blunt (Invitrogen) and removed using BsaI restriction enzyme. BsaI-cut fragment was then ligated into NotI / SalI cut pRS42H, pRS42K, and pRS42N vectors to produce pRS42H-TPI1, pRS42K-TPI1, and pRS42N- TPI1, respectively. Asta1, Asta2, and ΔN_AaAES1 fragments were amplified using gene specific primer set. Amplified DNA fragments were inserted into subcloning vector pCR-II Blunt. Insertion and pRS42H / K / N-TPI1 were then ligated using AvrII / EcoRV restriction sites. Attorney Ref No: 24742-0149WO1 Completed vector constructs were transformed into SR8B strain using PEG-mediated transformation method. Example 11—Nucleotide and Polypeptide Sequences of the Genes The following sequences were used as described herein. >CBFD1 ATGGCAGCAGCAATCTCAGTGTTCAGTACAAGTTATTCTTTCCACAAGAATCTCTTGTTGCACT CAAAACAAGACATTCTCAACCGCCCATGTTTGCTCTTCTCTCCAGTTGTGGTGGAGTCGCCTAT GAGAAAGAAAAAGACACATCGTGCTGCATGTATCTGCTCTGTTGCAGAGAGAACAAGGAACCTT GATATTCCTCAAATTGAAGAAGAGGAAGAGAACGAGGAAGAACTAATAGAACAGACGGATTCTG GCATAATTCATATAAAGAAAACGCTAGGGGGGAAACAATCAAGACGGTCCACTGGCTCCATTGT CGCACCCGTATCTTGTCTTGGGATCCTTTCAATGATCGGACCTGCTGTTTACTTCAAGTTTTCA CGGCTAATGGAGTGTGGAGATATTCCTGTCGCAGAAATGGGGATTACGTTTGCCGCCTTTGTTG CTGCTGCGATTGGCACGGAATTTTTGTCAGGATGGGTTCACAAAGAACTCTGGCACGATTCTTT GTGGTACATTCACAAGTCTCACCATAGGTCACGAAAAGGCCGCTTCGAGTTCAATGATGTGTTT GCTATTATTAACGCGCTTCCTGCTATTGCTCTTATCAATTATGGATTCTCAAATGAAGGCCTCC TTCCTGGAGCCTGCTTTGGTACCGGTCTTGGAACGACAGTCTGTGGCATGGCTTACATTTTTCT TCACAATGGCCTTTCACACCGAAGGTTCCCAGTAGGGCTTATTGCAAACGTCCCTTATTTCCAC AAGCTGGCTGCAGCTCACCAAATCCATCACTCAGGAAAATTTCAGGGTGTACCATTTGGCCTGT TCCTTGGACCCCAGGAATTGGAAGAAGTAAGAGGAGGCACTGAAGAATTGGAGAGGGTGATCAG TCGTACAGCTAAACGAACGCAATCATCTACATGA (SEQ ID NO:1) MAAAISVFSTSYSFHKNLLLHSKQDILNRPCLLFSPVVVESPMRKKKTHRAACICSVAERTRNL DIPQIEEEEENEEELIEQTDSGIIHIKKTLGGKQSRRSTGSIVAPVSCLGILSMIGPAVYFKFS RLMECGDIPVAEMGITFAAFVAAAIGTEFLSGWVHKELWHDSLWYIHKSHHRSRKGRFEFNDVF AIINALPAIALINYGFSNEGLLPGACFGTGLGTTVCGMAYIFLHNGLSHRRFPVGLIANVPYFH KLAAAHQIHHSGKFQGVPFGLFLGPQELEEVRGGTEELERVISRTAKRTQSST (SEQ ID NO:2) >CBFD2 ATGGCAGCAGCAATTTCAGTGTTCAGTTCAGGTTATTCTTTCTACAAGAATCTCTTGTTGGACT CAAAACCAAATATTCTCAAACCCCCATGCCTGCTATTCTCTCCAGTTGTGATCATGTCGCCTAT GAGAAAGAAAAAGAAACATGGTGATCCATGTATCTGCTCCGTTGCAGGGAGAACAAGGAACCTT GATATTCCTCAAATTGAAGAAGAGGAAGAGAATGTGGAAGAACTAATAGAACAGACCGATTCTG ACATAGTGCATATAAAGAAAACACTAGGGGGGAAACAATCAAAACGGCCCACTGGCTCCATTGT CGCACCCGTATCTTGTCTTGGGATCCTTTCAATGATTGGACCTGCTGTTTACTTCAAGTTTTCA CGGCTAATGGAGGGTGGAGATATACCTGTAGCAGAAATGGGGATTACGTTTGCCACCTTTGTTG CTGCTGCTGTTGGCACGGAGTTTTTGTCAGCATGGGTTCACAAAGAACTCTGGCACGAGTCTTT GTGGTACATTCACAAGTCTCACCATCGGTCACGAAAAGGCCGCTTCGAGTTCAATGATGTGTTT GCTATTATTAACGCGCTTCCCGCTATTGCTCTTATCAATTATGGATTCTCCAATGAAGGCCTCC TTCCTGGAGCGTGCTTTGGTGTCGGTCTTGGAACAACAGTCTGTGGTATGGCTTACATTTTTCT TCACAATGGCCTATCACACCGAAGGTTCCCAGTATGGCTTATTGCGAACGTCCCTTATTTCCAC AAGCTGGCTGCAGCTCACCAAATACACCACTCAGGAAAATTTCAGGGTGTACCATTTGGCCTGT TCCTTGGACCCAAGGAATTGGAAGAAGTAAGAGGAGGCACTGAAGAGTTGGAGAGGGTAATCAG TCGTACAACTAAACGAACGCAACCATCTACCTGA (SEQ ID NO:3) Attorney Ref No: 24742-0149WO1 MAAAISVFSSGYSFYKNLLLDSKPNILKPPCLLFSPVVIMSPMRKKKKHGDPCICSVAGRTRNL DIPQIEEEEENVEELIEQTDSDIVHIKKTLGGKQSKRPTGSIVAPVSCLGILSMIGPAVYFKFS RLMEGGDIPVAEMGITFATFVAAAVGTEFLSAWVHKELWHESLWYIHKSHHRSRKGRFEFNDVF AIINALPAIALINYGFSNEGLLPGACFGVGLGTTVCGMAYIFLHNGLSHRRFPVWLIANVPYFH KLAAAHQIHHSGKFQGVPFGLFLGPKELEEVRGGTEELERVISRTTKRTQPST (SEQ ID NO:4) >HBFD1 ATGGCTCCTGTTCTCCTTGGATTGAAACCAACTCTCTCCACTGGAAGCGTCGTCAAAGAGACTA ATGTAGGAAGCACACTTGCTAGTCCCCTTAACAAAACCCAGAATTCAAGGGTTTTGGTTTTGGG CGGAACAGGGAAGGTCGGTGGTTCCACAGCTTTGGCTCTCTCCAAGTTCTCACCTGACCTCAGG CTTGTGATTGGAGGTCGAAACAGGGAGAAAGGTGATGCTGTAGTGTCTAAACTAGGAGAAAACT CCGAGTTTGTTGAAGTCAACGTTGACAGTGTGAGATCTTTAGAATCTGCTCTCGAAGATGTGGA CCTTGTAGTTCATGCAGCTGGACCTTTTCAACAAGCGGAGAAGTGCACTGTTCTAGAAGCTGCA ATATCTACCAGGACGGCCTATGTGGATGTATGTGATAATACAAGTTATTCCATGCAAGCAAAGT CTTTTCATGATAAAGCAGTGGCTGCCAACGTTCCTGCCATAACAACTGCTGGAATTTTCCCTGG AGTGAGCAATGTGATAGCAGCTGAGCTAGTGCGATCAGCAAGAGATGAAAACACTGAACCTCAA AGACTAAGATTCTCCTATTTTACCGCGGGTTCTGGTGGTGCTGGTCCAACGTCGTTAGTTACTA GCTTCTTGCTTCTTGGTGAAGAGGTTGTTGCTTACAGTGAAGGCGAAAAAGTCGAATTAAAGCC TTATACAGGGAAGCTTAACATTGACTTCGGGAAGGGAGTTGGGAAAAGAGACGTTTATTTGTGG AACTTGCCGGAAGTAAGAAGTGGTCATGAGATCTTAGGAGTACCAACTGTGAGTGCTCGATTCG GTACTGCACCTTTCTTCTGGAATTGGGCGATGGTAGCTATGACAACTCTCCTTCCTCCTGGTAT TCTGAGAGACAGAAATAAAATCGGAATGTTGGCAAATTTTGTGTACCCTTCTGTACAAATTTTT GATGGGATTGCAGGAGAATGTCTTGCAATGCGGGTTGATTTAGAGTGCGCAAATGGGCGCAATA CTTTTGGTATACTCAGTCATGAACGTCTCTCTGTATTAGTGGGAACTTCAACTGCGGTGTTTGC TATGGCAATTCTTGAAGGAAGTACGCAGCCTGGAGTTTGGTTTCCAGAAGAGCCTGGAGGGATT GCAATAAGTGACAGAGAGTTACTTCTACAACGAGCATCACAAGGAGCGATTAACTTCATTATGA AGCAGTAG (SEQ ID NO:5) MAPVLLGLKPTLSTGSVVKETNVGSTLASPLNKTQNSRVLVLGGTGKVGGSTALALSKFSPDLR LVIGGRNREKGDAVVSKLGENSEFVEVNVDSVRSLESALEDVDLVVHAAGPFQQAEKCTVLEAA ISTRTAYVDVCDNTSYSMQAKSFHDKAVAANVPAITTAGIFPGVSNVIAAELVRSARDENTEPQ RLRFSYFTAGSGGAGPTSLVTSFLLLGEEVVAYSEGEKVELKPYTGKLNIDFGKGVGKRDVYLW NLPEVRSGHEILGVPTVSARFGTAPFFWNWAMVAMTTLLPPGILRDRNKIGMLANFVYPSVQIF DGIAGECLAMRVDLECANGRNTFGILSHERLSVLVGTSTAVFAMAILEGSTQPGVWFPEEPGGI AISDRELLLQRASQGAINFIMKQ (SEQ ID NO:6) >HBFD2 ATGGCGCGTGTCTTCCTTGGATTGAAACCAACTCTCTCCACTGGAAGCATCGTCAAAGAGACTA CTGTAGGAAACACACTTGTTAGTCCCCTTAACAAAACCCAGAATTCAAGGGTTTTGGTTTTGGG CGGAACAGGGAAGGTCGGTGGTTCCACAGCTTTCGCTCTCTCCAAGTTCTCACCTGACCTCAGG CTTGTGATTGGAGGTCGAAACAGGGAGAAAGGTGATGCTGTAGTGTCTAAACTAGGAGAAAACT CCGAGTTTGTTGAAGTCAACGTTGACAGCATGAGATCTTTAGAATCTGCCTTCAAAGATGTGGA TCTTGTAGTTCATGCAGCTGGACCTTTTCAACAAGCGGAGAAGTGCACTGTTCTAGAAGCTGCA ATATCTACCAGGACGGCCTATGTGGATGTATGTGATAATACAAGTTACTCCATGCAAGCTAAGT CTTTTCATGATAAAGCAGTGGCTGCCAACGTTCCTGCCATAACAACTGCTGGAATTTTCCCTGG Attorney Ref No: 24742-0149WO1 AGTGAGCAATGTGATAGCAGCTGAGCTAGTGCGATCAGCAAGAGATGAAAACACTGAACCTCAA AGACTAAGATTCTCCTATTTTACCGCGGGTTCTGGTGGTGCTGGTCCAACCTCGTTAGTTACTA GCTTTTTGCTTCTTGGTGAAGAGGTTGTTGCTTACAGTGAAGGTGAAAAGGTCGAATTAAAGCC TTATACAGGGAAGCTTAACATTGACTTCGGGAAGGGAGTTGGAAAAAGAGACGTTTATTTGTGG AACTTACCCGAAGTAAGAAGTGGTCATGAGATCTTAGGAGTACCAACTGTGAGTGCTCGATTCG GTACTGCACCTTTCTTCTGGAATTGGGCGATGGTAGCTATGACAAGTCTCCTTCCTCCTGGTAT TCTGAGAGACAGAAATATAATTGAAAAGTTGGCAAATTTTGTCTACCCTTCTGTACAAGTTTTT GATGGTATTGCAGGAGAATGTCTGGCTATGCGGGTTGATTTGGAGTGCGCAAATGGGCGCAACA CTTCTGCTATACTCAGTCACGAACGTCTCTCTGAATTAGTGGGAACTTCAACCGCGGTGTTTGC TTTGGCAATTCTTGAGGGAAGTACACAGGCTGGTGTTTGGTTTCCAGAAGAGCCCGAGGGGATT GCAGTAGGAGACAGAGAATTACTTCTAAAACGAGCATCACAAGGAGCTATTAACTTCATTATGA AGCAGTAG (SEQ ID NO:7) MARVFLGLKPTLSTGSIVKETTVGNTLVSPLNKTQNSRVLVLGGTGKVGGSTAFALSKFSPDLR LVIGGRNREKGDAVVSKLGENSEFVEVNVDSMRSLESAFKDVDLVVHAAGPFQQAEKCTVLEAA ISTRTAYVDVCDNTSYSMQAKSFHDKAVAANVPAITTAGIFPGVSNVIAAELVRSARDENTEPQ RLRFSYFTAGSGGAGPTSLVTSFLLLGEEVVAYSEGEKVELKPYTGKLNIDFGKGVGKRDVYLW NLPEVRSGHEILGVPTVSARFGTAPFFWNWAMVAMTSLLPPGILRDRNIIEKLANFVYPSVQVF DGIAGECLAMRVDLECANGRNTSAILSHERLSELVGTSTAVFALAILEGSTQAGVWFPEEPEGI AVGDRELLLKRASQGAINFIMKQ (SEQ ID NO:8) >AaAES1 ATGGCTGCTTCCACTTTGAATTTGTATTGCTTATCGCGAGTTCGAGTTTCGTCCTCTTTCCATG GACATAGATATCGAATTCGTGCTTCTTTGAGTGAGACAAATTCGAAGAGTTTGTCTTTGGATTC GTCGATTTCTACTGAGACTAATTATGCTGCATTTGTTAAGGTAAATGGAGGAGTTGATATTGCA GGTAATGGAAATAAGGGGAACGGAGAATTGGGTTCTAGAGGCAAGAAGATGATAGATGCTGCAA TTGATAAAGATTTGGAAGCACTATGGGATGATGGATATGGGACTACTACTGTAAAGGATTATCT TGATTCAGCAAAAAATTTCATTCATGGTGACGGCGGGCCACCCCGTTGGTTTTGTCCTGTGGAT TGTGGGCGGCCCATTCAGGGGTCTCCTGTTCTTTATTTCTTGCCTGGATTAGATGGACTCGGAG TAGGACTTTGTTTGCATCATAAGACACTTGGAAGGATCTTTGAAGTTAGGTGCTTGCACATTCC TATTTATGATCGGACACCCTTTGAAGAACTGGTTATGTTGGTTGAAGATTATGTTAGGCTTGAG CACACTTTATATCCGCATAAACCTATATATTTAGTTGGTGACTCATTTGGAGGGACTCTAGCAC TTGCTGTTGCTGCTCGTAACTCTTCTATCGACCTAGTACTAATACTAGTTAATCCAGCTACGTC TATTGGCAAGTCACAGCTGCAGCCATTGCTCCCTATCTTGGACTTCTTGCCGGATGAACTTCAT GTCACTGTTACTTATCTTCTGTGTTTCATCTTGGGTAGCCCAATTCAGATGGCAATGGTTAATA TCGACAAAAGTCTTCCTCCTACACAAACTCTAAAGGAGTTGTCAGAAAACTTTAGTACATTGTT ACCATATCTTTCAGATTTGGCTGATATTATTCCTAAGGCGTCTCTTCTATGGAAACTAAAGTTG CTCAAATCAGGTGCTTCGTATGCTAATTCTCGTCTGCACGCTGTCAAAGCGGAAGTTCTAGTGC TTGCAAGTGGCATGGATAATTGGTTACCTAGCAGAGATGAAGCTCAGCGCCTTCAAAAGTCACT ACAGAAATGCAAAGTCCGGAATTTCAAGGACAATGGTCATGCCCTTTTACTGGAAGACGGCATG CATTTTTTGGCGGTTCTTAAGGGTTTGTCTATGTACCGACGTTCTCGGTGCCACGATTACATCT CAGATTATATTCCTCTTTCTTCTAAAGAGTTCAAAGTGCACGAACAAGAATGGGTGCTGAGCCA AATGACAAGTCCAGTGATGCTTTCAACTTTGGGCAATGGCAAGATAGTGAGGGGTCTTGGAGGG ATACCAAGTCAAGGTCCTGTTCTGTTTGTTGGTTATCACATGCTGATGGGTCTAGAACTTATGC CACTTCTTGAAGGGTTCTTGAGAGAGAGGAAAGTTCTGATTCATGGTATGGCCCATCCAGTGTT GTTTGATCTGGACTGGCTATTTTCACCACAAGAAAAGTCCATTGCTGATGAAATCAGACAATTT GGTGCAGTACCTGTTACACCAAGTAACTTGTACAGATTGTTGTCATCTAACTCGTTTATTCTTC Attorney Ref No: 24742-0149WO1 TGTATCCTGGTGGTGTACGCGAGGCTCTTCATCGTAAGGGAGAAGAATACAGGTTGTTTTGGCC AGACCAGTCTGAGTTTGTTAGAATGGCAGCTCGATTTAATGCCACAATTGTACCATTTGGTGCT GTTGGAGAAGATGACCTTGTAGAGTTGGTTCTGGATTATAACGACCAAATGAGCATCCCCTTTG TTAGAGACTGGTTAAAAGAAGTCAACGCAGATTTTGCACAATTAAGGGGTGGCGTGAAAGGAGA GGTCGCAAACCAGGATTTGTTCTTCCCTGGATTTGTACCAAAGATACCAGGTCGATTTTATTAC TTATTTGGGAAACCAATTGAAACCAAGGGACAAAAACACTTGTTGACAGATAAAGAGAGTGCCA ATGAACTATACTCAAAGATTAAAGATGAAATACAAGGCATTATGAGTTATTTGAAAGAGAAGCG GGAGAAGGATCCATACAGAGGTATCCTGGAGAGGACTATATATAGAGCTGTTTCGGCTCCTACA GCTGATGTCCCTGCGTTTGATCCATAA (SEQ ID NO:9) MAASTLNLYCLSRVRVSSSFHGHRYRIRASLSETNSKSLSLDSSISTETNYAAFVKVNGGVDIA GNGNKGNGELGSRGKKMIDAAIDKDLEALWDDGYGTTTVKDYLDSAKNFIHGDGGPPRWFCPVD CGRPIQGSPVLYFLPGLDGLGVGLCLHHKTLGRIFEVRCLHIPIYDRTPFEELVMLVEDYVRLE HTLYPHKPIYLVGDSFGGTLALAVAARNSSIDLVLILVNPATSIGKSQLQPLLPILDFLPDELH VTVTYLLCFILGSPIQMAMVNIDKSLPPTQTLKELSENFSTLLPYLSDLADIIPKASLLWKLKL LKSGASYANSRLHAVKAEVLVLASGMDNWLPSRDEAQRLQKSLQKCKVRNFKDNGHALLLEDGM HFLAVLKGLSMYRRSRCHDYISDYIPLSSKEFKVHEQEWVLSQMTSPVMLSTLGNGKIVRGLGG IPSQGPVLFVGYHMLMGLELMPLLEGFLRERKVLIHGMAHPVLFDLDWLFSPQEKSIADEIRQF GAVPVTPSNLYRLLSSNSFILLYPGGVREALHRKGEEYRLFWPDQSEFVRMAARFNATIVPFGA VGEDDLVELVLDYNDQMSIPFVRDWLKEVNADFAQLRGGVKGEVANQDLFFPGFVPKIPGRFYY LFGKPIETKGQKHLLTDKESANELYSKIKDEIQGIMSYLKEKREKDPYRGILERTIYRAVSAPT ADVPAFDP (SEQ ID NO:10) >AaAES2 ATGGCTACCTCTACTATGAATTTACTATCATTTTCGCGTCTTCCAGTTTCGTCTTCTTTTCGTG AACATAGATATCAAATTCGTGCTACTCTGAGTGAGAGTTCGACGGGTTTGTCTTTGGATTCCTC GAATTCTAGTGGAACTAATGGAGCTGCGTTTGTTAAGGTGAATGGAGGAGTTGAGGTTGCAAGT AATGGAGTTAAGCGGAAAGGTGAAATGGGTTCTAGAGGCAAGAAGAAACATGTGGGAATTGATA AAGAGTTGGAAGTACTGTGGGATGATGGCTTTGGAAATACTACTGTTAAGGATTATCTTGATGC AGTGAAGGATATGATTCCCTCTGATGGTGGGCCGCCGCGGTGGTTCTGTCCTGTAGAATGTGGG CGTCCAGTTCAGGGGTCTCCTGTTCTTTTCTTCTTGCCTGGAATGGATGGGCTTGGACTGGGAC TTTGTTTACACCATACAACTCTAGGAAGGGTCTTTGAAGTTAGATGCTTCCACATCCCTGTTTA TGACCGAACACCATTTGAAGAACTGGTTAGAATTGTTGAAAAGGCTGTGAGGCTTGAGCACACT TTAAATCCGGATAAACCGATATATTTAGTTGGCGACTCATTTGGAGGGAGCCTAGCACTTGCTG TTGCTGCTCGTAACTCTTCTATCGACCTAGTACTAATACTAGTTAATCCAGCTACGTCCGTTGG CAAGTCACCACTGCAGCCATTTTTCCCTATCTTGGAGAATTTTCCGGATGATCTTCATCAGACG CTTCCTTATCTTCTTAGCTTCGTCATGGGTGACCCAATGCGGATGGCGATGGTAAATATCGACA AAAGTCTTTCTCCTGAACAAACACTAGAAATGTTGTCAGGAAACTTGACTGCTTTGTTACCATC TCTATCAGCTATCTCTGATATTCTTCCGAAGGAGACTCTTCTATGGAAGCTAAAGATGATCAAG TCAGGTGCTTCTTATGCTAATTCTCGTCTCCACGCTGTCAAAGCGGAAGTTTTGGTGCTTGCAA GTGGCAAGGATAACATGTTACCTAGCAAAGATGAAGCTCAGCGTCTTCTAAAATCGTTGCAAAA TTGCAAAGTTCGCAACTTCAATGACAATGGTCACACCCTTTTATTGGAAGATGGCATGCATTTG TTGGCAGTTATTAAGAGTACGCTTAAGTACCGCCGTTCTCGACGTCAAGATTGCATCTCAGATT ATGTTCCTCCTTCTTCTACAGAGTTCAAATTGCATGAACAAGAATCAGCATTAAGCCGCATTAC TAGTCCTGTGATGCTTTCAACTTTGGGCAACGGCAAAATAGTCAGGGGTCTTGAAGGGGTCCCA ACTCAAGGTCCTATTCTGTTGGTTGGTTACCACATGCTGATGGGACTAGAACTTATTCCACTTA TGGAAGAGTTCTTGAGGCAGAAAAAAGTTATGATTCGTGGAATGGCCCATCCAATGTTGTTTGA Attorney Ref No: 24742-0149WO1 TCTGGACCCCAGATTTACATCGCAAGAGAAATCCATGGTTGATGAAGTCCGGCAGTTTGGCGGG GTACCTGTTACACCAAGCAACTTGTATAGATTGTTGGCATCGAACTCGATTATTCTTCTCTATC CTGGGGGTATTCGCGAGGCCCTTCATCGTAAGGGAGAGGAGTACAGGTTGTTTTGGCCAGAGCA GCCTGAGTTTGTTAGAATGGCAGCTCGATTTGATGCCACAATTGTACCCTTTGGAGTTGTTGGA GAAGATGATATTGCAGAGTTGGTTCTGGATTATAACGACCAAATGAGAATTCCCATTCTTCGAG ACTGGCTGAAAGAATTCAATGGTAATCTTACACGATTAAGGGGTGACTCGCAAGGGGAGGTTGC TAATCAAGATCTAGCCTTTCCTGGACTTGTACCAAAGATACCAGGTAGATTTTACTACTTATTT GGAAAACCAATTGAAACCAAGGGACAAGAACACTTGTTGAAGGATAAAAAGAGTGCAAATGAAT TATACTCAAAGATTAAAGACGAAATACAAGGCATTATGCGTTATTTAAAAGGAAAACGCGAGGA GGACCCTTATAGAGGTATTTTACAGAGGAGTATATATAGTGCTACTTCAGGTTCTATAGATGAT GTTCCTACATTCGACGTGTAA (SEQ ID NO:11) MATSTMNLLSFSRLPVSSSFREHRYQIRATLSESSTGLSLDSSNSSGTNGAAFVKVNGGVEVAS NGVKRKGEMGSRGKKKHVGIDKELEVLWDDGFGNTTVKDYLDAVKDMIPSDGGPPRWFCPVECG RPVQGSPVLFFLPGMDGLGLGLCLHHTTLGRVFEVRCFHIPVYDRTPFEELVRIVEKAVRLEHT LNPDKPIYLVGDSFGGSLALAVAARNSSIDLVLILVNPATSVGKSPLQPFFPILENFPDDLHQT LPYLLSFVMGDPMRMAMVNIDKSLSPEQTLEMLSGNLTALLPSLSAISDILPKETLLWKLKMIK SGASYANSRLHAVKAEVLVLASGKDNMLPSKDEAQRLLKSLQNCKVRNFNDNGHTLLLEDGMHL LAVIKSTLKYRRSRRQDCISDYVPPSSTEFKLHEQESALSRITSPVMLSTLGNGKIVRGLEGVP TQGPILLVGYHMLMGLELIPLMEEFLRQKKVMIRGMAHPMLFDLDPRFTSQEKSMVDEVRQFGG VPVTPSNLYRLLASNSIILLYPGGIREALHRKGEEYRLFWPEQPEFVRMAARFDATIVPFGVVG EDDIAELVLDYNDQMRIPILRDWLKEFNGNLTRLRGDSQGEVANQDLAFPGLVPKIPGRFYYLF GKPIETKGQEHLLKDKKSANELYSKIKDEIQGIMRYLKGKREEDPYRGILQRSIYSATSGSIDD VPTFDV (SEQ ID NO:12) >Tomato XES (SlXES) ATGGCTTCTCTTCTGCATAATTTCTGGGCAGTCCCTCGTTTTGGTCTTAGTCCGGACTATAAGC CTCACTGTATAGCTCGGTTCGCATGCTTAGCTAACAGGGACTCTACATTTTTGTCTTCAGATTC TGTTATAGTTAATGGTGTGTCCTCCATTGAAGAAAAGGAGAAAAGTAGCACAATAATTGATGTG AAAAATAGTCATCTGGCTCCAGCTATTAAGGAGAAGAACAAGGAGGATATTCAAAACAAGTTGG AAACTCTTTGGGATGATGGATATGGAACTCAAACTGTTAAGGATTATCTTGAGATAGGATCAGA GATTATTAAGCCTGATGGAGGTCCTCCGCGGTGGTTTACTCCCATATCAGCTGGCCCTCCTTTG GAAGACTCTCCTCTCCTCCTTTTTCTGCCAGGAATGGATGGCACTGGCATGGGTCTTGTTTTGC ATGAGAAGGCTCTTGGGAAAGTTTTTCAGGTTTGGTGCTTGCATATTCCTGTGTATGATCGAAC ACCATTTGATGAACTGGTGAAATTCGTCGGGAGAACTGTGAGGATGAAGCATGCTTCATCTCCA AACAAGCCAATTTATTTAGTTGGAGATTCATTTGGAGGGTGCTTGGCTCTTGCCATTGCTGCTC ATAACCCTGAGATTGACCTTGTTCTGATATTAGCTAATCCAGCAACTTCATTTGACAGGACACA ACTCCAACCTTTGCTTCCTCTTCTGGAGTCTCTGCCTGATGAATTTCATGTTACAGTCCCTTAT CTTCTGAGTTTTATTATGGGTGATCCACTGAAGATGGCGATGGTTAACATTGATTCAATGCTTC CTCCTGGACAAATTATTCAACGTCTCGCTGGCAACCTCACTGATTTGCTGGCCCACCTCTATGG TTTAGCTGATATTATACCGAAGGAAACTCTTCTCTGGAAGTTGAAGCTTCTAAGATCTGCTTCA TCTTATTCAAATTCCCGTCTCCATGCTGTTAATGCTGAAGTACTTGTGATTGCTAGTGGCAAGG ATAACATGCTTCCAAGTGAGAATGAAGCTCAGAGGCTTGGAAATTCATTAAGAAACTGCACAGT ACGATACTTCAAAGACAACGGGCATACTATTTTATTGGAAGATGGTATTAATCTGCTATCCATC ATCAAAGCTACTAGCAAATATCGTCGTTCAAAAAGGCGTGATTATGTCAAAGATTTTCTGCCTC CTAGTAAGTCAGAGTTCAAGAACGCAATCAAGAACAATAGTTGGTATCTCAATATTACTGGACC AGTTATGCTGTCCACGATGGAAAATGGGAAAATTGTTAGAGGTCTAGCGGGGGTCCCACGTGAA Attorney Ref No: 24742-0149WO1 GGCCCTGTATTGTTGGTCGGTTATCACATGCTTATGGGTTTAGAAATTGTCCCTCTTGTTCAAG AATATATGATGCAGACGAAAATTTTACTTCGTGGAATAGCACATCCATCGTTGTTTACTCAGCT GGTTGAGAGTCGACCTGATGCAAGCTCATTCATTGATATGCTGAAACTATATGGAGCTACACCT GTCACTGCCAGCAACTTTTTTAAGTTGCTTGCAACAAAGTCACATGTTCTGTTGTATCCTGGTG GTGCCCGTGAGGCCTTACATCGTAAGGGAGAAGAGTACAAGGTGATATGGCCTGACCAACCAGA ATTCATCAGAATGGCTGCAAAATTTGGTGCGACAATTGTGCCATTTGGGGTTGTAGGAGAAGAT GATATAGCACAGTTAGTTCTCGACTATGACGACCTAAAAAGTATACCTATATTGGGTGATCGGA TAAGGAGTGAGAACGAAGAGGCAGCCAGGAGGGGCTTAGCAGTCAGGGCGGACATGGACGGGGA GATTGCCAACCAAATGTTGTATATCCCTGGCCTTTTACCTAAGATACCCGGTCGTTTTTACTTC TTTTTTGGGAAACCAATTCATACAAAGGGAAGGCAAGACCTGGTGAAAGATAGAGAAAAAGCAA GAGAATTATACTTGCAGGTAAAATCTGAAGTTCAAAATAACATGAATTATTTGCTTAAGAAAAG AGAGGAGGATCCTTACCGGAACTTCATCGATCGAACCATGTATAGAGCATTTTCTGCCACTTCT GGTGATGTCCCAACATTTGATTTTTAG (SEQ ID NO:13) MASLLHNFWAVPRFGLSPDYKPHCIARFACLANRDSTFLSSDSVIVNGVSSIEEKEKSSTIIDV KNSHLAPAIKEKNKEDIQNKLETLWDDGYGTQTVKDYLEIGSEIIKPDGGPPRWFTPISAGPPL EDSPLLLFLPGMDGTGMGLVLHEKALGKVFQVWCLHIPVYDRTPFDELVKFVGRTVRMKHASSP NKPIYLVGDSFGGCLALAIAAHNPEIDLVLILANPATSFDRTQLQPLLPLLESLPDEFHVTVPY LLSFIMGDPLKMAMVNIDSMLPPGQIIQRLAGNLTDLLAHLYGLADIIPKETLLWKLKLLRSAS SYSNSRLHAVNAEVLVIASGKDNMLPSENEAQRLGNSLRNCTVRYFKDNGHTILLEDGINLLSI IKATSKYRRSKRRDYVKDFLPPSKSEFKNAIKNNSWYLNITGPVMLSTMENGKIVRGLAGVPRE GPVLLVGYHMLMGLEIVPLVQEYMMQTKILLRGIAHPSLFTQLVESRPDASSFIDMLKLYGATP VTASNFFKLLATKSHVLLYPGGAREALHRKGEEYKVIWPDQPEFIRMAAKFGATIVPFGVVGED DIAQLVLDYDDLKSIPILGDRIRSENEEAARRGLAVRADMDGEIANQMLYIPGLLPKIPGRFYF FFGKPIHTKGRQDLVKDREKARELYLQVKSEVQNNMNYLLKKREEDPYRNFIDRTMYRAFSATS GDVPTFDF (SEQ ID NO:14) >PSY1 ATGTCAGTGGCTCTGCTAAGGGTTGTGACACCAGCAGCTAGTGGTACTACAGTCGATAATGCTG CTAGTAAAGCTTTGAACAAGTCAAATTATTATAAACTCCACAAAGGAAAGAAAATCGGTAGCAA GCTGAGCCACCGGAATAGAAGAACTAGTTTTGCTTCAATAAATGCAGCAGCAGCCGCAGGAGGA GAAATTGCTGCTACAGTGGGCTCGTCAGAAGAGAAGGTTTACAACGTTGTGTTGAAGCAAGCAG CTTTGGTCAAAAAACAACTGAGTATTGGTCTTGATGATGATGTCAAGCCTGACATGGTAGTTCC TGGGACTCTAAGTTTGTTGAATGAAGCTTATGATCGGTGTCGAGAGGTTTGTGCAGAGTATGCC AAGACTTTTTACTTAGGTACCTTGCTCATGACCCAGGAAAGGCGAAAAGCTATTTGGGCTATAT ACGTATGGTGCAGGAGGACAGATGAGCTTGTAGATGGGCCGAATGCTTGTCACATAACACCAAT GGCTTTGGATAGGTGGGAATCGAGGTTAGAGGATCTCTTCCGAGGTCGCCCGTATGACATGCTC GATGCAGCTCTCTCTGACACTGTTTCCAAGTTCCCTGTTGACATACAACCATTTAAAGACATGA TAGAAGGAATGCGACTGGACCTTAAGAAATCGAGATACAACAACTTCGATGAGTTATATCTTTA CTGTTATTACGTAGCGGGAACTGTTGGATTGATGAGTGTGCCAGTGATGGGTATCGCACCAGAA TCTCAGGCATCCACTGAAAGTGTCTATAACGCTGCTTTAGCCTTGGGGATCGCTAACCAGCTCA CTAACATCCTTAGAGATGTTGGAGAAGACGCAAGAAGAGGAAGAGTATATCTTCCTCAAGATGA ACTAGCACAGGCAGGGCTTTCAGATGAAGATATATTCGCTGGGAAGGTAACTGACAAGTGGAGG CTCTTCATGAAGAAGCAAATCAAGAGAGCCAGGATGTTCTTCGACCAAGCAGAAAAGGGTATCA CACAGCTCAGTTCAGCTAGTAGATGGCCGGTTTGGGCGTCATTGCTATTGTATCGACAAATTTT GGACGAGATTGAAGCCAACGATTATAACAACTTCACAAAACGAGCATACGTTAGCAAATCAAAG Attorney Ref No: 24742-0149WO1 AAAATAACGGCACTGCCCGCTGCTTATGCAAGATCTCTTATTAGTCCTTCTACAAAATTACCTA GCATCGTAAAAGTCTGA (SEQ ID NO:15) MSVALLRVVTPAASGTTVDNAASKALNKSNYYKLHKGKKIGSKLSHRNRRTSFASINAAAAAGG EIAATVGSSEEKVYNVVLKQAALVKKQLSIGLDDDVKPDMVVPGTLSLLNEAYDRCREVCAEYA KTFYLGTLLMTQERRKAIWAIYVWCRRTDELVDGPNACHITPMALDRWESRLEDLFRGRPYDML DAALSDTVSKFPVDIQPFKDMIEGMRLDLKKSRYNNFDELYLYCYYVAGTVGLMSVPVMGIAPE SQASTESVYNAALALGIANQLTNILRDVGEDARRGRVYLPQDELAQAGLSDEDIFAGKVTDKWR LFMKKQIKRARMFFDQAEKGITQLSSASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKSK KITALPAAYARSLISPSTKLPSIVKV (SEQ ID NO:16) >PSY2 ATGTCAGTAGCTCTGTTTAGGGTTGTGACACCAGCAGCTAGTGGTACTACAGTCGATAATGCTG CTAGTAAAGTTTTGAACAAATCAAATTATTACAAACTCCACAAAGGAAAGAAAATCGGCAGCAA GCTGGGTCACCGGAATAGAAGAACTAGTTTTGGTACAATAAATGCAGCAGCAGCGGCAGGAGGA GAAATTGCTGCTACAGTGGGCTCGTCAGAAGAGATGGTTTACAACGTTGTGTTGAAGCAAGCAG CCTTGGTAGAAAAACAACTGAGTATTGGTCTTGATGATGATGTCAAGCCTGACATGATGGTTCC TGGGACTCTAAGTTTGATGAATGAAGCTTATGATCGGTGTCGAGAGGTTTGTGCAGAGTATGCC AAGACTTTTTACTTAGGTACCTTGCTCATGACCCAGGAAAGGCGAAAAGCTATTTGGGCTATAT ACGTGTGGTGCAGGAGGACCGATGAGCTTGTAGATGGGCCGAATGCTTGTCACATAACACCGAT GGCTTTGGATAGGTGGGAATCGAGGTTAGAGGATCTGTTTCGAGGTCGCCCATATGACATGCTC GATGCAGCTCTCTCTGACACTGTTGCCAAGTTCCCTGTTGACATACAACCATTTAAAGACATGA TAGAAGGAATGCGGCTGGACCTTAAGAAGTCGAGATACAACAACTTCGATGAGTTATATCTTTA CTGTTATTATGTAGCGGGAACTGTTGGATTGATGAGTGTGCCAGTGATGGGTATCGCACCAGAA TCACAGGCATCCACTGAAAGTGTCTATAACGCTGCTTTAGCCTTGGGGATCGCTAACCAGCTCA CTAACATCCTTAGAGATGTTGGAGAAGACGCAAGAAGAGGAAGAGTGTATCTTCCTCAAGATGA ACTAGCACAGGAAGGGCTTTCAGATGAAGATATATTCGCTGGCAAGGTAACTGACAAATGGAGG CTCTTCATGAAAAAGCAAATCAAGAGAGCCAGAATGTTCTTCGACCAAGCAGAAAAGGGTATCA CACAGCTCAGCTCAGCTAGTAGATGGCCGGTTTGGGCGTCATTGCTATTGTATCGACAAATCTT GGACGAGATTGAAGCCAACGATTATAACAACTTTACAAAACGAGCATACGTTAGCAAATCAAAG AAAATAACGGCACTGCCCGCTGCTTATGCAAGAGCTCTTATTGGTCCTTCTACAAAATTACCTA GCATTATAAAAGTCTGA (SEQ ID NO:17) MSVALFRVVTPAASGTTVDNAASKVLNKSNYYKLHKGKKIGSKLGHRNRRTSFGTINAAAAAGG EIAATVGSSEEMVYNVVLKQAALVEKQLSIGLDDDVKPDMMVPGTLSLMNEAYDRCREVCAEYA KTFYLGTLLMTQERRKAIWAIYVWCRRTDELVDGPNACHITPMALDRWESRLEDLFRGRPYDML DAALSDTVAKFPVDIQPFKDMIEGMRLDLKKSRYNNFDELYLYCYYVAGTVGLMSVPVMGIAPE SQASTESVYNAALALGIANQLTNILRDVGEDARRGRVYLPQDELAQEGLSDEDIFAGKVTDKWR LFMKKQIKRARMFFDQAEKGITQLSSASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKSK KITALPAAYARALIGPSTKLPSIIKV (SEQ ID NO:18) >PDS1 ATGTCAGCAGTTGGGTCCATCTCTGCTGCTTATTTGAGTGGGAAAGGTGACTTGAGAAATCCAT CCAATTCATATTCCGGACAACGGTGTTGTTTCTCGAGTGATCACAAACATAAAAATGTGTTGGC ATTTGGAGGTAGTGAGGCCATGGGTCATCGATTGAATTGTCTGGGCGCACTTGATGGTAGAATA ATACCTAGAAAGGATGTAGGAACTCCAAAGATAGTTTGTGTTGACTATCCGAGGCCAGAACTTG ACAACACCGCTAATTTTTTAGAAGCTGCTTATTTATCTTCAACATTTCGTGCTTCTCCCCGTCC Attorney Ref No: 24742-0149WO1 ACAGAAACCATTAAAAGTTGTAATTGCTGGGGCAGGTTTGGCGGGACTATCTACTGCAAAATAT CTAGCAGATGCAGGTCATCAACCCATATTGTTGGAAGCCAGAGATGTTTTGGGTGGAAAGGTGG CTGCATGGAAAGATGATGATGGAGACTGGTATGAGACAGGATTACATATATTTTTTGGAGCATA CCCAAATGTACAAAATTTGTTTGGAGAACTTGGTATTAACGATCGGTTGCAGTGGAAAGAACAC TCCATGATTTTTGCGATGCCTAGCAAGCCAGGAGAGTTCAGCCGATTTGATTTCCTAGATGTTC TTCCTGCACCCTTAAATGGGATCTGGGCAATCTTAAAGAACAATGAGATGTTGACTTGGCCAGA GAAAGTGCGGTTTGCAATCGGACTATTGCCAGCAATGGCTGGCGGCCAGGCTTATGTTGAGGCT CAAGATGGTTTAAGTGTCAAACAGTGGATGAAGAAGCAGGGTGTACCTGAACGAGTAACTGATG AGGTGTTCATCGCAATGTCAAAAGCCCTAAACTTCATAAACCCAGATGAACTTTCAATGCAGTG TATTTTGATCGCTTTAAACAGATTTCTTCAGGAAAAGCATGGGTCCAAGATGGCCTTTTTAGAT GGTAGTCCTCCTGAGAGATTATGCCAGCCAATTGTTGATCATATACAGTCACTGGGTGGTGAAG TCCGACTCAATTCTCGGATTCAAAAGATAAATCTTAAGAACGATGGGACTGTGAAGTCTTTGAC ATTAAGTAATGGCAATGTGATAGAAGGTGATGCCTACGTAATTGCCGCGCCAGTTGATATCTTG AAACTTCTTCTGCCTGAGGAGTGGAAAGAGATTCCGTACTTCAAGAAATTGGACAAACTAGTTG GTGTTCCTGTCATTAACGTACACATATGGTTTGACAGGAAACTCAAGAATACATATGATCATCT ACTATTCAGCAGAAGTCCCCTTTTGAGTGTATACGCCGACATGTCTGTAACTTGTAAGGAATAC TATGATCCAAACAAATCCATGCTGGAATTAGTTTTCGCTCCTGCAGAAGAATGGATATCACGCA GCGACGCTGAAATTATTGAAGCTACAATGCAAGAACTTGCCAAACTCTTCCCTGATGAAATTTC CGCAGATCAGAGCAAAGCGAAAATCTTGAAGTACCATGTCGTTAAAACACCGAGGTCTGTATAT AAAACAATTCCTGGTTGTGAACCGTGTCGTCCTTTACAAAGATCACCTCTTGAAGGCTTTTATT TGGCTGGAGATTACACAAAGCAGAAGTACTTGGCTTCCATGGAAGGTGCAGTTTTATCTGGCAA GTTTTGTGCTCAGGCTATTGTGCAGGATTATGAGATACTCAGTTCCAAGGTTGAAGAAAGTGTG AAAACTGAGGCAACTGTTGCATAA (SEQ ID NO:19) MSAVGSISAAYLSGKGDLRNPSNSYSGQRCCFSSDHKHKNVLAFGGSEAMGHRLNCLGALDGRI IPRKDVGTPKIVCVDYPRPELDNTANFLEAAYLSSTFRASPRPQKPLKVVIAGAGLAGLSTAKY LADAGHQPILLEARDVLGGKVAAWKDDDGDWYETGLHIFFGAYPNVQNLFGELGINDRLQWKEH SMIFAMPSKPGEFSRFDFLDVLPAPLNGIWAILKNNEMLTWPEKVRFAIGLLPAMAGGQAYVEA QDGLSVKQWMKKQGVPERVTDEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLD GSPPERLCQPIVDHIQSLGGEVRLNSRIQKINLKNDGTVKSLTLSNGNVIEGDAYVIAAPVDIL KLLLPEEWKEIPYFKKLDKLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSVTCKEY YDPNKSMLELVFAPAEEWISRSDAEIIEATMQELAKLFPDEISADQSKAKILKYHVVKTPRSVY KTIPGCEPCRPLQRSPLEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQDYEILSSKVEESV KTEATVA (SEQ ID NO:20) >PDS2 ATGTCAGCAGTTGGGTCCGTCTCTGCTGCTTATTTGAGTGGGAAAGGTGACTTAAGAAACACAT CCTATTCATATTCTGGCCAACGGTGTTGTTTCTCGAGTAATCACAAACATAAAAATGTGCTGGC ATTTGGAGGTAGTGAGGCCATGGGTCATCGATTGAATTGTCTGGGCACACTTGATGGTAGAATA ATACCTAGAAAGGATGTAGGAACTCCAAAGATAGTTTGTGTTGATTACCCGAGGCCAGAACTTG ACAATACTGCTAATTTTTTAGAAGCTGCTTATTTATCTTCAACATTTCGTGCTTCTCCCCGTCC ACAGAAACCATTACAAATTGTAATTGCTGGGGCAGGTTTGGCCGGACTATCTACTGCAAAGTAT CTAGCAGATGCAGGTCATAAACCCATATTGTTGGAAGCCAGAGATGTTTTGGGTGGAAAGGTGG CTGCATGGAAAGATGATGATGGAGACTGGTATGAGACTGGATTACATATATTTTTTGGAGCATA CCCAAATGTACAAAATTTGTTTGGAGAACTTGGTATTAACGATCGGTTGCAGTGGAAAGAGCAC TCCATGATCTTCGCGATGCCTAGCAAGCCAGGAGAGTTCAGCCGATTTGATTTCCTAGATGTTC TTCCAGCACCCTTAAATGGGATCTGGGCAATCTTAAAGAACAATGAGATGTTGACTTGGCCGGA Attorney Ref No: 24742-0149WO1 GAAAGTGCGGTTCGCGATCGGACTATTGCCAGCAATGGCTGGCGGCCAGGCTTATGTTGAGGCT CAAGATGGTTTAAGTGTCAAACAGTGGATGAAGAAGCAGGGTGTACCTGAACGAGTAACTGATG AGGTTTTCATCGCAATGTCAAAAGCCCTAAACTTCATAAACCCAGATGAACTTTCAATGCAGTG TATTTTGATCGCTTTAAACAGATTTCTTCAGGAAAAGCATGGGTCCAAGATGGCGTTTTTAGAT GGTAGTCCTCCTGAGAGATTGTGCCAGCCAATTGTTGATCATATACAATCACTGGGTGGTGAAG TTCGACTTAATTCTCGGATTCAAAAGATAAATCTTAAGAACGATGGGACTGTGAAGTCTTTAAC ATTAAGTAATGGCAATGTGATAGAGGGTGATGCCTACGTGATTGCCGCTCCAGTTGATATCTTG AAACTTCTTCTGCCTGAGGAGTGGAAAGAGATTCCATATTTCAAGAAATTGGACAAACTAGTTG GTGTTCCTGTCATTAACGTACACATATGGTTTGACAGGAAACTCAAGAATACATATGATCATCT ACTTTTCAGCAGAAGTCCCCTTTTGAGTGTATACGCCGACATGTCTGTAACTTGTAAGGAATAC TATGATCCAAACAAATCCATGCTGGAATTGGTTTTCGCTCCGGCAGAAGAATGGATATCACGCA GTGACTCTGAAATAATTGAAGCTACAATGCAAGAACTTGCGAAACTCTTCCCTGATGAAATTTC TGCAGATCAAAGCAAAGCCAAAATCTTGAAGTACCATGTTGTGAAAACACCAAGGTCTGTATAC AAAACAATTCCTGGTTGTGAACCGTGTCGTCCTTTACAAAGATCACCTCTTGAAGGCTTTTATT TGGCTGGAGACTACACAAAGCAGAAGTACTTAGCTTCCATGGAAGGTGCAGTTTTATCTGGCAA GTTTTGTGCTCAGGCTATTGTGCAGGATTATGAGATACTCAGTGCCAAGGTTGAACAAAGTCTG AAAACTGAGGCAACTGTTGCATAA (SEQ ID NO:21) MSAVGSVSAAYLSGKGDLRNTSYSYSGQRCCFSSNHKHKNVLAFGGSEAMGHRLNCLGTLDGRI IPRKDVGTPKIVCVDYPRPELDNTANFLEAAYLSSTFRASPRPQKPLQIVIAGAGLAGLSTAKY LADAGHKPILLEARDVLGGKVAAWKDDDGDWYETGLHIFFGAYPNVQNLFGELGINDRLQWKEH SMIFAMPSKPGEFSRFDFLDVLPAPLNGIWAILKNNEMLTWPEKVRFAIGLLPAMAGGQAYVEA QDGLSVKQWMKKQGVPERVTDEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLD GSPPERLCQPIVDHIQSLGGEVRLNSRIQKINLKNDGTVKSLTLSNGNVIEGDAYVIAAPVDIL KLLLPEEWKEIPYFKKLDKLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSVTCKEY YDPNKSMLELVFAPAEEWISRSDSEIIEATMQELAKLFPDEISADQSKAKILKYHVVKTPRSVY KTIPGCEPCRPLQRSPLEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQDYEILSAKVEQSL KTEATVA (SEQ ID NO:22) >Z-ISO1 ATGGCTTCTCAACTGCTCCTAACAACCCCAATTCTCGCTTTCTCTACTCGTTCCAACCATACTA GATTCATAGCTTTTCATAAACCATCAAGAAATCCCATTCTGAAATCAGTTCCAACTCGAATTTC AGGCAACCCCTCTAGAATTCAGCAAATTATTCGTGTTAGAACCTCAGTTAAAGAAAGAGAGGGA ACTACTTCTGTGATTTTAGACGAGAATCAAGTTGGTGAAGATGCTGCTACTTTTAATCTTTTTG AGCAAAAGATTTCATCTTGGGTTTATTTTACTGGAATTCTAGGAGTTGTTCTGTTTGCTTTGGA TGTATTGTGGATTGATTCTTCATTTGGTTTCGGTTATGGAAAGGCGTTTATTGATTATGTCTCA AGCCTTTCAGAAAGCCATGAGATTGTAATGTTGCTCCTTATATTCATCTTTGCCGCCGTTCACA GTGGAATGGCTACACTTCGAGATCCAAGCGAAAAGCTGATAGGTCCAAGAGCATACAGAGTTCT CTTTGCCGGAATTTCTCTTCCATTAGCAGTCAGCACTGTTGCATACTTCATCAACCACCGATAC GACGGAGTCCAACTATGGCAGCTCCAGAGTATCCCCTGGCTTCACCATCTTCTCTGGGTCTCAA ACTTCATATCCTTCTTATTCCTCTACCCTTCAACATTCAATCTATTAGAAGTCGCCGCAGTTGA TAAACCCAAAATGCATCTATGGGAGACCGGGATCATGAGGATCACCCGGCATCCTCAGATGGTT GGTCAGGTGATTTGGTGTTTGGCTCATGCGATATGGATTGGGAACTCTGTGGCCGTAGCAGCCT CAGTTGGGTTGGTTGCACACCACCTGTTTGGTGTTTGGAATGGTGATAGGAGGTTAGCGATAAG GTATGGGGAAGCGTTTGAGGTGGTGAAGAGTCGAACTAGTGTTGTTCCTTTTGCTGCTATACTT GATGGACGTCAAAAGTTGCCTAAAGATTATTACAAGGAGTTTCTAAGGTTGCCGTATCTTACAG Attorney Ref No: 24742-0149WO1 TCACGGCTGTGACTCTAGGTGCTTATTTCGCCCATCCGCTTATGCAGGCAGCGAGTTATCGACT TCACTGGTGA (SEQ ID NO:23) MASQLLLTTPILAFSTRSNHTRFIAFHKPSRNPILKSVPTRISGNPSRIQQIIRVRTSVKEREG TTSVILDENQVGEDAATFNLFEQKISSWVYFTGILGVVLFALDVLWIDSSFGFGYGKAFIDYVS SLSESHEIVMLLLIFIFAAVHSGMATLRDPSEKLIGPRAYRVLFAGISLPLAVSTVAYFINHRY DGVQLWQLQSIPWLHHLLWVSNFISFLFLYPSTFNLLEVAAVDKPKMHLWETGIMRITRHPQMV GQVIWCLAHAIWIGNSVAVAASVGLVAHHLFGVWNGDRRLAIRYGEAFEVVKSRTSVVPFAAIL DGRQKLPKDYYKEFLRLPYLTVTAVTLGAYFAHPLMQAASYRLHW (SEQ ID NO:24) >Z-ISO2 ATGGCTTCTCAACTGCTCCTCACAAGCCCAATTCTCGCCTTCTCTACCCGTTCTAACCATACTA GATTCATTGCTTTTCATAAACCATCAAGGAATCCCATTTTCAAATCACTTCCAACTCAAAGACC AAAGAACCCCTTCAAATTTAAGCAAATTATTCGTGCTAGAACTTCAATTGAAGAAAGAGATGGA ACTACTTCTGTGATATCAGACGAGAATCAAGTTGGTGAAGATGCTGCTACTTTTAATCTTTTTG AGCAAAAGATTTCATCTTGGGTTTATTTTACCGGAATTCTAGGAGTTGTTCTCTTTGCTCTGGA TGTATTGTGGATTGATTCTTCATTTGGTTTTGGTTACGGAAAGGCGTTTATTGATTATGTCTCA AGCCTTTCAGAAAGCCATGAGATTGTAATGTTGCTCCTTATATTCATCTTTGCCGCCGTTCACA GTGGAATGGCCACTCTTCGAGATCCAAGCGAAAAGCTAATTGGTCCAAGAGCATACCGAGTTCT CTTCGCCGGAATTTCTCTTCCATTAGCAGTCAGCACAGTTGCATACTTCATCAACCATCGATAC GACGGCATCCAATTATGGCAGCTCCAGAACATCCCATGGCTTCACCATCTTCTCTGGATCTCAA ACTTCATATCGTTCTTATTCCTCTACCCTTCAACATTCAATCTATTAGAAGTCGCTGCAGTTGA TAAACCCAAAATGCATCTATGGGAGACCGGGATCATGAGAATCACCCGACATCCTCAAATGGTT GGGCAGGTGATTTGGTGTTTGGCTCATGCGATATGGATTGGGAACTCTGTGGCGGTGGCGGCCT CAGTTGGGTTGGTTGCACACCACCTGTTTGGTGTTTGGAATGGTGATAGGAGGTTAGCGATAAG GTATGGGGAGGCGTTTGAGGTGGTGAAGAGTCGAACTAGTGTTGTTCCTTTTGCTGCGATACTT GATGGACGTCAAAAGTTGCCTAAAGATTATTATAAAGAGTTTCTTCGGTTGCCGTATCTTACAG TCACGGTTGTGACTCTAGGTGCTTATTTTGCTCATCCACTTATGCAGGCAGCGAGTTATCGGCT TCATTGGTAA (SEQ ID NO:25) MASQLLLTSPILAFSTRSNHTRFIAFHKPSRNPIFKSLPTQRPKNPFKFKQIIRARTSIEERDG TTSVISDENQVGEDAATFNLFEQKISSWVYFTGILGVVLFALDVLWIDSSFGFGYGKAFIDYVS SLSESHEIVMLLLIFIFAAVHSGMATLRDPSEKLIGPRAYRVLFAGISLPLAVSTVAYFINHRY DGIQLWQLQNIPWLHHLLWISNFISFLFLYPSTFNLLEVAAVDKPKMHLWETGIMRITRHPQMV GQVIWCLAHAIWIGNSVAVAASVGLVAHHLFGVWNGDRRLAIRYGEAFEVVKSRTSVVPFAAIL DGRQKLPKDYYKEFLRLPYLTVTVVTLGAYFAHPLMQAASYRLHW (SEQ ID NO:26) >ZDS ATGGCTTCTTCTTCTTCGACTTGTTTCCCAACCAGTGGTACTTCAATCGGAACCCGTTTCCGGA AAGAGATTCTGGGATGTAATTTTCGCCGTGGTTCTCTTCATGGTGGTGGGAGAGTTCAGATGAC TATGCAAGCTAACCCAGATGTATTGACTTCTTTGGACTTAAACGTATCCGACATGAGAGTTAAT GCTCCAAAAGGTTTATATCCACCAGAACCTGAACATTATAGAGGACCAAAACTGAAAGTGGCCA TTATTGGCGCCGGGCTTGCAGGAATGTCAACAGCAGTGGAGCTTTTGGATCAAGGCCATGAGGT CGATATATACGAATCACGACCTTTTATTGGTGGAAAAGTGGGTTCTTTCGTTGACAAGCGTGGA AACCATATAGAAATGGGACTTCACGTTTTCTTCGGTTGCTATAATAACCTTTTCCGTTTGCTCA GAAAGGTAGATGCATCAAAAAATTTGCTAGTGAAGGATCATGTTCACACATTCATAAATAAAGG GGGAGAAATTGGTGAACTGGATTTTCGTTTTCCAGTGGGCGCACCATTACATGGAATCAGCGCT Attorney Ref No: 24742-0149WO1 TTTCTAACTACAAATCAGCTTAAGCCTTATGATAAAGCAAGAAATGCTGTGGCTCTAGCCCTAA GCCCAGTTGTACGAGCCCTTATTGATCCTGATGGCGCAATGCGTGACATACGCAACTTGGATAG TATTAGCTTCTCTAATTGGTTCATGTCAAAAGGCGGTACACGCAAAAGTATCCAGAGAATGTGG GATCCTGTTGCTTATGCTTTAGGATTTATTGACTGTGACAATATCAGTGCCCGTTGTATGCTCA CTATATTCTCATTATTTGCCACTAAGACAGAAGCTTCGCTACTGCGGATGCTTAAAGGTTCTCC TGATGTTTACTTGAGTGGCCCTATCAGAAAATATATCACAGACAAGGGTGGCAGATTTCATCTC AGGTGGGGATGCAGAGAGATACTATATGATAAATCAATCAATGGAGACACTTATGTTACAGGAC TTGCCATGTCTAAGGCCACAGAAAAGAAAACGTTGAAAGCTGATGTGTATGTTGCAGCGTGTGA TGTTCCTGGAATCAAAAGATTGCTTCCTTCCCAGTGGAGGGAATCGGAGTTTTTCGACAACATT TATGAGCTAGTCGGAGTTCCAGTTGTCACAGTGCAACTGAGATATAACGGATGGGTTACAGAGG TACAAGATTTGGGAGTGTCAAGGCAATTGAAGCAAGCTTCAGGAATGGATAATCTCCTCTATAC CCCAGATGCTGATTTTTCCTGCTTTGCAGATCTTGCTCTTACTTCTCCAGAAGATTATTACATC GAGGGACAGGGTTCATTACTACAATGTGTACTGACTCCTGGGGATCCCTACATGCCACTAACAA ATGATAAAATCATAGAACGCGTTACAAAGCAGGTATATGAATTGTTTCCATCTTCCCAAGGCTT AGAAGTTACTTGGTCCTCAGTTGTGAAATTTGGGCAATCCCTATATCGTGAAGGCCCGGGAAAA GATCCTTTCAGACCTGATCAAAAGACACCAGTGAAGAACTTCTTCCTGGCTGGCTCCTACACAA AACAGGATTATATTGATAGTATGGAAGGAGCAACTTTGTCAGGAAGGCAAGCAGCAGCTTATAT CTGTGAAGCTGGGGAAGAATTAGCAGCGTTGAGAAAGAAGCTCGCTGCTGAACAAGTCACAGCA TCAGAAAGTATTGCTAGTAACATGAGTCTTGTATAA (SEQ ID NO:27) MASSSSTCFPTSGTSIGTRFRKEILGCNFRRGSLHGGGRVQMTMQANPDVLTSLDLNVSDMRVN APKGLYPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRPFIGGKVGSFVDKRG NHIEMGLHVFFGCYNNLFRLLRKVDASKNLLVKDHVHTFINKGGEIGELDFRFPVGAPLHGISA FLTTNQLKPYDKARNAVALALSPVVRALIDPDGAMRDIRNLDSISFSNWFMSKGGTRKSIQRMW DPVAYALGFIDCDNISARCMLTIFSLFATKTEASLLRMLKGSPDVYLSGPIRKYITDKGGRFHL RWGCREILYDKSINGDTYVTGLAMSKATEKKTLKADVYVAACDVPGIKRLLPSQWRESEFFDNI YELVGVPVVTVQLRYNGWVTEVQDLGVSRQLKQASGMDNLLYTPDADFSCFADLALTSPEDYYI EGQGSLLQCVLTPGDPYMPLTNDKIIERVTKQVYELFPSSQGLEVTWSSVVKFGQSLYREGPGK DPFRPDQKTPVKNFFLAGSYTKQDYIDSMEGATLSGRQAAAYICEAGEELAALRKKLAAEQVTA SESIASNMSLV (SEQ ID NO:28) >ZDS2 ATGGCTTCTTCTTCTTCGACTTGTTTCCCAACCAGTGGTACTTCAATCGGGACCCGTTTCCGGA AAGAGATTCTGGGATGTAATTTTCGCCGTGGTTCTCTTCATGGTTGTAGGAGAGTTCAGATGAC TATGCAAGCTAACCCAGATGTATTGACTTCTTTGGACTTAAACGTATCCGACATGAGAGTTAAT GCTCCAAAAGGTTTATATCCACCAGAACCTGAACATTATAGAGGACCAAAACTGAAAGTGGCCA TTATTGGGGCCGGGCTTGCAGGAATGTCAACCGCAGTGGAGCTTTTGGATCAAGGACATGAGGT TGATATATACGAATCACGACCTTTTATTGGTGGAAAAGTGGGTTCTTTCGTTGACAAGCGTGGA AACCATATAGAAATGGGACTTCACGTTTTCTTCGGTTGCTATAATAACCTTTTTCGTTTGCTCA GAAAGGTAGATGCATCAAAAAATTTACTAGTGAAGGATCATGTTCACACATTCATAAATAAAGG GGGAGAAATTGGTGAACTGGATTTTCGTTTTCCAGTGGGCGCACCATTACATGGAATCAGCGCT TTTCTAACTACAAATCAGCTTAAGCCTTATGATAAAGCAAGAAATGCTGTGGCTCTTGCCCTAA GCCCAGTTGTGCGTGCCCTTATTGATCCTGATGGCGCAATGCGTGACATACGCAACTTGGATAG TATTAGCTTCTCTAATTGGTTCATGTCAAAAGGCGGTACACGCAAAAGTATCCAGAGAATGTGG GATCCTGTTGCTTACGCTTTAGGATTTATTGACTGTGACAATATCAGTGCCCGTTGTATGCTCA CTATATTCTCATTATTTGCCACTAAGACAGAAGCTTCGCTATTGCGGATGCTTAAAGGTTCTCC TGATGTTTACTTGAGTGGCCCTATCAGAAAATATATAACAGACAAGGGTGGCAGATTTCATCTC Attorney Ref No: 24742-0149WO1 AGGTGGGGATGCAGAGAGATACTATATGATAAGTCAATCAATGGAGACACTTATATTACAGGAC TTGCCATGTCTAAGGCCACAGAAAAGAAAACGTTGAAAGCTGATGTGTATGTTGCAGCGTGTGA TGTTCCTGGAATCAAAAGATTGCTTCCTTCCCAGTGGAGGGAATCGGAATTTTTTGACAATATA TATGAGCTAGTCGGAGTTCCAGTTGTCACAGTGCAACTGAGATATAACGGATGGGTTACAGAGG TACAAGATTTGGGTGTGTCAAGGCAATTGAAGCAAGCTTCAGGAATGGATAATCTCCTTTATAC CCCAGATGCTGATTTTTCCTGCTTCGCAGACCTTGCTCTTACTTCTCCAGAAGATTATTACATC GAGGGACAGGGTTCATTACTACAATGTGTACTTACTCCTGGGGATCCCTACATGCCACTAACAA ATGATAAAATCATAGAACGCGTTACAAAGCAGGTATATGAATTGTTTCCATCTTCCCAAGGCTT AGAAGTTACTTGGTCCTCAGTTGTGAAATTTGGGCAATCCCTATATCGTGAAGGCCCGGGAAAA GATCCTTTCAGACCTGATCAAAAGACACCAGTGAAGAACTTCTTCCTGGCTGGCTCCTACACAA AACAGGATTATATTGACAGTATGGAAGGAGCAACTTTGTCAGGAAGGCAAGCAGCAGCTTATAT CTGTGAAGCTGGGGAAGAATTAGCAGCATTGAGAAAGAAGCTCGCGGCTGAACAAGTCACAGCA TCAGAAAGTATTGCTAGTAATATGAGTCTTGTATAA (SEQ ID NO:29) MASSSSTCFPTSGTSIGTRFRKEILGCNFRRGSLHGCRRVQMTMQANPDVLTSLDLNVSDMRVN APKGLYPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRPFIGGKVGSFVDKRG NHIEMGLHVFFGCYNNLFRLLRKVDASKNLLVKDHVHTFINKGGEIGELDFRFPVGAPLHGISA FLTTNQLKPYDKARNAVALALSPVVRALIDPDGAMRDIRNLDSISFSNWFMSKGGTRKSIQRMW DPVAYALGFIDCDNISARCMLTIFSLFATKTEASLLRMLKGSPDVYLSGPIRKYITDKGGRFHL RWGCREILYDKSINGDTYITGLAMSKATEKKTLKADVYVAACDVPGIKRLLPSQWRESEFFDNI YELVGVPVVTVQLRYNGWVTEVQDLGVSRQLKQASGMDNLLYTPDADFSCFADLALTSPEDYYI EGQGSLLQCVLTPGDPYMPLTNDKIIERVTKQVYELFPSSQGLEVTWSSVVKFGQSLYREGPGK DPFRPDQKTPVKNFFLAGSYTKQDYIDSMEGATLSGRQAAAYICEAGEELAALRKKLAAEQVTA SESIASNMSLV (SEQ ID NO:30) >CRTISO1 ATGGCTCAATCAGTCTTCTCGTCTCAGTTCCCCTTCACTAAAACCCAAACCTTTTCCTCTTTGC CTAAAACCCCAAAATTTAGTTACAATAAGTACAAAAATTTCCAACCGAGAACTACAAATTTAAG CTATTTCAAGAAATGGGGCAAGCTGAACTGTTCTCTAAAGTTAAATTCTGCTCTAGGTGTGGAG AAAGAAATGCGTATCAGTGAAAATGGAAAAATAGATGATGGGGTCAAGAGCTATGATGCGATTG TGATTGGTTCGGGAATTGGTGGATTAGTAGCTGGAACTCAGTTGGCAGTGAAGGGAGCTAATGT TTTGGTGTTGGAGAAGTATATCATTCCTGGTGGGAGTTCCGGGTTTTATGAGAGAGATGGTTAT ACCTTTGATGTTGGATCATCTGTTATGTTTGGTTTCAGTGATAAGGGAAACCTAAATCTGATAA CTCAAGCGTTGGCAGCAGTTGGGTGTGAGATGCAGGTTATACCAGATCCGACCACTGTTCACTT TCATCTACCAAGTAATCTCTCTGTTCGAGTGCACAGAGAGTATAGTGAATTCATCTCTGAACTA ACCAATAAATTTCCTCATGAAAAGGAGGGGATCATCAAATTTTACAGTGAGTGTTGGAAGATCT TCAACGCATTGAATTCCTTGGAGTTGAAGTCACTTGAGGAGCCACTATACCTTTTTGGACAATT TTTCCAGAAGCCTATCGAATGCTTGACACTTGCATATTATTTGCCACAAAATGCTGGAGATATA GCTCGAAAGTTCATCAAAGATCCACAACTGCTATCTTTTATAGATGCCGAGTGCTTCATTGTGA GCACGGTTAATGCTTTACAAACACCAATGATCAATGCAAGCATGGTTTTGTGCGACAGACATTT TGGTGGTATCAACTACCCTGTTGGTGGTGTTGGTGGCATTGCAAAATCTTTAGCAGAAGGACTT CTTGATCAAGGAAGTAACATACTTTACAAGGCAAATGTTACTAACGTCATAGTTCAGGATGACA AGGCTGTGGGAGTGAGGCTTTCAGATGGAAGAGAGTTCTTCGCCAAGACCATCATTTCGAATGC AACCAGATGGGATACCTTTGGAAAGCTTTTGAAAAAGCAAGATCTACCTCCACAAGAAGAAAAC TTTCAAAGGGTTTATGTGAAGGCTCCTTCCTTTCTTTCTATTCATTTGGGCGTTAAAGCTGATG TTTTACCACCGGACACCGACTGCCATCATTTTGTTCTTGAGAATGGTTGGAGCAGCTTAGAGGA GCCTTATGGAAGCATATTTTTGAGTATTCCAACTGTTCTAGATTCGTCTCTGGCACCAGAAGGG Attorney Ref No: 24742-0149WO1 CGCCATATCCTTCATATATTTACAACATCTAGCATAGAGGATTGGAAGGGACTTCCTCAAAAAG AATATGAAGCAAAAAAGGAACTTGTCGCAGATGAGATTATAGGTAGACTTGAAAAGAAACTTTT TCCAGGGCTTAAAGCATCCATTGTGTTTAAAGAGATTGGGACGCCCAAGACCCACAGGCGTTAT CTTGCTCGAGACAGTGGAACCTATGGACCTATGCCACGAAAAGTCCCTAAGGGTTTGTTGGGGA TGCCATTCAATACAACAGCTATAGATGGTCTCTACTGTGTTGGCGACAGCTGCTTTCCTGGACA AGGTGTTATAGCTGTAGCCTTTTCAGGTGTTATGTGTGCTCACCGAGTAGCTGCTGATATTGGG TTGGAGAAGAAATCACCAATACTGGACTCTGCATTGCTTGGTCTGCTTGGCTGGTTCAGGACCT TGGCATGA (SEQ ID NO:31) MAQSVFSSQFPFTKTQTFSSLPKTPKFSYNKYKNFQPRTTNLSYFKKWGKLNCSLKLNSALGVE KEMRISENGKIDDGVKSYDAIVIGSGIGGLVAGTQLAVKGANVLVLEKYIIPGGSSGFYERDGY TFDVGSSVMFGFSDKGNLNLITQALAAVGCEMQVIPDPTTVHFHLPSNLSVRVHREYSEFISEL TNKFPHEKEGIIKFYSECWKIFNALNSLELKSLEEPLYLFGQFFQKPIECLTLAYYLPQNAGDI ARKFIKDPQLLSFIDAECFIVSTVNALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSLAEGL LDQGSNILYKANVTNVIVQDDKAVGVRLSDGREFFAKTIISNATRWDTFGKLLKKQDLPPQEEN FQRVYVKAPSFLSIHLGVKADVLPPDTDCHHFVLENGWSSLEEPYGSIFLSIPTVLDSSLAPEG RHILHIFTTSSIEDWKGLPQKEYEAKKELVADEIIGRLEKKLFPGLKASIVFKEIGTPKTHRRY LARDSGTYGPMPRKVPKGLLGMPFNTTAIDGLYCVGDSCFPGQGVIAVAFSGVMCAHRVAADIG LEKKSPILDSALLGLLGWFRTLA (SEQ ID NO:32) >CRTISO2 GGTCTACTGTCACCATCCATGGCTCAATCAGTCTTCTCTTCCCAGTTCTCCTTCACTAAAACCC AAACCTTCTCCTCTTTGCCTAAAACGCCGAAATTTAGTTACAATAAGTACAAAAATTTCCAACC AAGAACTACAAATTTAAGCCATTTCAAGAAATGGGGTAAGCTGAACTATTCCCTAAAGTTAAAT TCTGCTCTAGGTGTGGAGAAAGAAATGCGTATCAGTGAAAATGGAAAAATAGATGATGGGGTCA AGAGCTATGATGCGATTGTGATTGGTTCCGGAATTGGTGGATTAGTAGCTGGAACTCAGTTGGC AGTGAAGGGAGCTAATGTTTTGGTGCTGGAGAAATATATCATTCCTGGTGGGAGTTCCGGGTTT TATGAGAGAGATGGTTATACCTTTGATGTTGGATCATCTGTTATGTTTGGTTTCAGTGATAAGG GAAACCTAAATCTGATAACTCAAGCGTTGGCAGCAGTTGGGTGTGAGATGCAGGTGATACCAGA TCCGACCACTGTTCACTTTCATCTACCAAGTAATCTCTCCGTTCGAGTACACAGAGAGTATAGT GAATTCATCTCTGAGCTAACCAGTAAATTTCCTCATGAAAAGGAAGGAATCGTCAAATTTTACA GTGAGTGTTGGAAGATCTTCAACGCGTTGAATTCCTTGGAGTTGAAGTCACTTGAGGAGCCACT ATACCTTTTTGGACAATTTTTCCAGAAGCCTATAGAATGCTTGACACTTGCATATTATTTGCCA CAGAATGCTGGAGATATAGCTCGAAAGTTCATCAAAGATCCACAACTGCTATCTTTTATAGATG CCGAGTGCTTCATTGTGAGTACGGTTAATGCTTTACAAACACCAATGATCAACGCAAGCATGGT TTTGTGCGACAGACATTTTGGTGGGATCAACTACCCTGTTGGTGGTGTTGGTGGGATTGCAAAA TCTTTAGCAAAAGGACTTCTTGATCAAGGAAGTAACATACTTTACAAGGCAAATGTTACTAACA TCATAATTCAGGACGATAAGGCTGTGGGAGTGAGGCTTTCAGATGGAAGAGAGTTCTTCTCTAA GACCATCATTTCGAATGCAACCAGATGGGATACCTTTGGAAAGCTTTTGAAAAAGCAAGATCTA CCTCCACAAGAAGAAAACTTTCAAAGGGTTTATGTGAAGGCTCCTTCCTTCCTTTCTATTCATT TGGGCGTTAAAGCTGATGTTTTACCACCAGATACCGACTGCCATCATTTTGTTCTTGAGAATGG TTGGAGCAGCTTAGAGGAGCCTTATGGAAGCATATTTTTGAGCATTCCAACTGTTCTAGATTCG TCTCTGGCACCAGAAGGGCGCCATATCCTTCATATATTTACAACATCTAGCATAGAGGATTGGA AGGGACTTCCTCAAAAGGAATATGAAGCAAAAAAGGAACTTGTAGCAGATGAGATTATAGGTAG ACTTGAAAAGAAACTTTTTCCAGGGCTTAAAGCATCCATTGTGTTCAAAGAGATTGGGACGCCC AAGACCCACAGACGCTATCTTGCTCGAGACAGTGGAACCTATGGACCAATGCCACGAAAAGTCC CTAAGGGTTTGTTGGGGATGCCATTCAATACAACAGCTATAGATGGTCTCTATTGTGTTGGTGA Attorney Ref No: 24742-0149WO1 CAGCTGCTTTCCAGGACAAGGTGTTATAGCTGTAGCCTTTTCAGGTGTTATGTGTGCTCACCGA GTAGCTGCTGATATTGGGTTGGAGAAGAAATCACCAATACTGGACTCTGCATTGCTTGGGCTGC TTGGCTGGTTCAGGACCTTGGCATGA (SEQ ID NO:33) MAQSVFSSQFSFTKTQTFSSLPKTPKFSYNKYKNFQPRTTNLSHFKKWGKLNYSLKLNSALGVE KEMRISENGKIDDGVKSYDAIVIGSGIGGLVAGTQLAVKGANVLVLEKYIIPGGSSGFYERDGY TFDVGSSVMFGFSDKGNLNLITQALAAVGCEMQVIPDPTTVHFHLPSNLSVRVHREYSEFISEL TSKFPHEKEGIVKFYSECWKIFNALNSLELKSLEEPLYLFGQFFQKPIECLTLAYYLPQNAGDI ARKFIKDPQLLSFIDAECFIVSTVNALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSLAKGL LDQGSNILYKANVTNIIIQDDKAVGVRLSDGREFFSKTIISNATRWDTFGKLLKKQDLPPQEEN FQRVYVKAPSFLSIHLGVKADVLPPDTDCHHFVLENGWSSLEEPYGSIFLSIPTVLDSSLAPEG RHILHIFTTSSIEDWKGLPQKEYEAKKELVADEIIGRLEKKLFPGLKASIVFKEIGTPKTHRRY LARDSGTYGPMPRKVPKGLLGMPFNTTAIDGLYCVGDSCFPGQGVIAVAFSGVMCAHRVAADIG LEKKSPILDSALLGLLGWFRTLA (SEQ ID NO:34) >LYC1 ATGGATACGCTACTTAGAACTCACAATAAGCTAGAATTGCTTCCCACCCTTCATGGTTTTGCTG AGAAACAGCACCTCGTAAGCACTTCAAAGCTTCAAAATCAAGTATTTAGAATTGCTTCTAGAAA CATTCATCCGTGTAGAAATGGGACTGTTAAAGCCAGGGGTAGTGCACTTTTGGAGCTTGTTCCG GAGACCAAAAAGGAGAATCTTGAATTCGATCTCCCAGCGTATGACCCCTCTAGGGGGATTGTCG TGGACTTAGCAGTTGTTGGGGGTGGTCCTGCTGGCCTTGCTATAGCTCAGCAAGTCTCTGAAGC AGGTCTCTTGGTTTGCTCAATTGATCCGTCTCCAAAACTGATCTGGCCTAATAATTATGGTGTT TGGGTAGATGAATTTGAAGCTATGGACTTACTTGATTGTCTTGACACCACCTGGTCTGGCGCAG TTGTGTATACTGATGACAACTCAAAGAAGTATCTCGATCGACCGTATGGAAGGGTTAACCGCAA ACAACTCAAATCTAAGATGCTACAGAAGTGTGTAACGAATGGTGTTAAATTTCATCAGGCCAAA GTCATCAAAGTTATTCATGAGGAATCCAAGTCTCTCTTGATTTGCAATGATGGAATCACAATCA ACGCGACAGTGGTCCTTGATGCCACTGGATTCTCAAGGTGTCTTGTTCAATATGATAAGCCTTA CAACCCAGGGTACCAAGTGGCTTATGGTATTATGGCAGAAGTTGAAGAACACCCCTTTGATTTG GATAAAATGTTATTCATGGATTGGAGAGATTCCCATCTGAATGAAAAACCGGAATTGAAAGATA AGAACAGGAAGATTCCAACATTTCTTTATGCAATGCCCTTTTCATCCACGAAGATTTTTCTTGA AGAGACTTCTTTAGTTGCTAGACCTGGATTACGTTTCGAAGATATTCAGGAAAGGATGGTTGCT AGACTGAAGCACTTAGGTATAAAAGTCAAGAGCATTGAAGAAGATGAACGATGTGTTATTCCAA TGGGTGGCCCCCTTCCGGTGCTCCCTCAAAGAGTCGTAGGAATAGGCGGGACCGCAGGGATGGT TCATCCATCAACTGGATATATGGTAGCAAGGACTCTAGCAGCTGCTCCAGTTGTTGCGAAGTCG ATTGTTCAGTACCTAGGGTCTGACCGAAGCCTTTCGGGAAATGAATTATCTGCTGAAGTTTGGA AAGATTTATGGCCCATAGAGAGGAGAAGGCAGCGTGAGTTCTTCTGTTTTGGTATGGATATTCT GCTTAAACTTGATTTACAAGGAACACGGAGGTTCTTTGATGCATTTTTTGATCTAGAACCACAC TATTGGCATGGGTTCTTGTCATCTCGATTGTTTCTCCCGGAGCTTCTGTTTTTTGGCCTTTCTC TCTTCTCTCATGCCTCTAACGCATCTAGGATAGAAATTATGGCCAAGGGTACTGTTCCCTTGGT TAATATGATGAACAACCTAATACAGGATACTGATTAG (SEQ ID NO:35) MDTLLRTHNKLELLPTLHGFAEKQHLVSTSKLQNQVFRIASRNIHPCRNGTVKARGSALLELVP ETKKENLEFDLPAYDPSRGIVVDLAVVGGGPAGLAIAQQVSEAGLLVCSIDPSPKLIWPNNYGV WVDEFEAMDLLDCLDTTWSGAVVYTDDNSKKYLDRPYGRVNRKQLKSKMLQKCVTNGVKFHQAK VIKVIHEESKSLLICNDGITINATVVLDATGFSRCLVQYDKPYNPGYQVAYGIMAEVEEHPFDL DKMLFMDWRDSHLNEKPELKDKNRKIPTFLYAMPFSSTKIFLEETSLVARPGLRFEDIQERMVA RLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVAKS Attorney Ref No: 24742-0149WO1 IVQYLGSDRSLSGNELSAEVWKDLWPIERRRQREFFCFGMDILLKLDLQGTRRFFDAFFDLEPH YWHGFLSSRLFLPELLFFGLSLFSHASNASRIEIMAKGTVPLVNMMNNLIQDTD (SEQ ID NO:36) >LYC2 ATGGATACGCTACTTAGAACTCACAATAAGCTAGAATTGCTTCCCACCCTTCATGGTTTTGCTG AGAAACAGCACCTTTTAAGCACTTCAAAGCTTCAAAATCAAGTATTTAGAATTGCTTCTAAAAA CATTCATCCCAGATGGTGTAGAAATGGGAGTTTCAAAGCCAGGGGTAGTGCACTTTTGGAGCTT GTTCCGGAGACCAAGAAGGAGAATCTTGAATTCGATCTCCCAGCGTATGATCCCTCTAGAGGGC TTGTCGTGGACTTAGCAGTTGTTGGGGGTGGTCCTGCTGGCCTTGCTGTAGCTCAGCAAGTCTC TGAAGCAGGTCTCTCGGTTTGCTCAATTGATCCGTCTCCAAAACTGATCTGGCCTAATAATTAT GGTGTTTGGGTAGATGAATTTGAAGCTATGGATTTACTTGATTGTCTTGACACCACCTGGTCTG GCGCAGTTGTGTATACTGATGACAACTCAAAGAAGTATCTCGATCGACCGTATGGAAGGGTTAA CCGCAAACAACTCAAATCTAAGATGCTACAAAAGTGTGTAAAGAATGGTGTTAAATTTCATCAG GCCAAAGTCATCAAAGTTATTCATGAGGAATCCAAGTCTCTCTTGATATGCAATGATGGAATCA CAATCGAGGCGACAGTGGTTCTTGATGCCACTGGATTCTCAAGGTGCCTTGTTCAATATGATAA GCCTTATAACCCAGGCTACCAAGTGGCTTATGGTATTATGGCAGAAGTTGAAGAACACCCCTTT GATTTGGATAAAATGTTATTCATGGATTGGAGAGATTCCCATCTGAATGAAAAACCGGAATTGA AAGATAAGAACAGGAAGATTCCAACATTTCTTTATGCAATGCCCTTTTCATCCACGAAGATTTT TCTCGAAGAGACTTCTTTAGTTGCTAGACCTGGATTGCGTTTCGAAGATATTCAGGAAAGGATG GTTGCTAGACTGAAGCACTTAGGTATAAAAGTCAAGAGCATTGAAGAAGATGAACGATGTGTTA TTCCAATGGGTGGCCCCCTTCCGGTGCTCCCTCAAAGAGTCGTAGGAATAGGCGGGACCGCAGG GATGGTTCATCCATCAACTGGATATATGGTAGCAAGGACTCTAGCAGCTGCTCCAGTTGTTGCG AAGTCGATTGTTCAGTACCTAGGGTCTGAGCGAAGCCTTTCGGGAAATGAATTATCTGCTGAAG TTTGGAAAGATTTATGGCCCATAGAGAGGAGAAGGCAGCGTGAGTTCTTCTGTTTTGGTATGGA TATTCTGCTTAAACTTGATTTACAAGGAACACGGAGGTTCTTTGATGCATTTTTTGATCTAGAA CCACACTATTGGCATGGGTTCTTGTCATCTCGATTGTTTCTCCCCGAGCTTCTGTTTTTTGGCC TGTCTCTCTTCTCTCATGCCTCTAACGCATCTAGGATAGAAATTATGGCCAAGGGTACTGTTCC CTTGGTTAATATGATGAACAACCTAATACAGGATACTGATTAG (SEQ ID NO:37) MDTLLRTHNKLELLPTLHGFAEKQHLLSTSKLQNQVFRIASKNIHPRWCRNGSFKARGSALLEL VPETKKENLEFDLPAYDPSRGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNY GVWVDEFEAMDLLDCLDTTWSGAVVYTDDNSKKYLDRPYGRVNRKQLKSKMLQKCVKNGVKFHQ AKVIKVIHEESKSLLICNDGITIEATVVLDATGFSRCLVQYDKPYNPGYQVAYGIMAEVEEHPF DLDKMLFMDWRDSHLNEKPELKDKNRKIPTFLYAMPFSSTKIFLEETSLVARPGLRFEDIQERM VARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPVVA KSIVQYLGSERSLSGNELSAEVWKDLWPIERRRQREFFCFGMDILLKLDLQGTRRFFDAFFDLE PHYWHGFLSSRLFLPELLFFGLSLFSHASNASRIEIMAKGTVPLVNMMNNLIQDTD (SEQ ID NO:38) >CYP96A3-1 ATGGCTGCCACTGCTTCTATACTTCAACTCCCTTCTCTTCCCACCAAGTCTCTTCAAATCAGTT CTCGTTCAAACAAACTCAAATCCAACTTCATATCATTCCCAAAACTGAATAATGGCACCCCTCC GCGTTCTTTCATCACCTGTGCATCAACTAATGGGCGAGAACCCAATTCCCTCAACGAAGACAAT GTAAAGAGTGCCAAACGCCTTTTAGAAGAGAAAGAACGTGCGGAATTGGCTGCTCGGATTGCTT CTGGTGAATTTACAGTAGAACAGTCTGGGTTTCTGCCACAATTGAGGAGTGTCTTGTCGAAATT GGGCGTGCCTGAGGAGTTTTTAGATTTTCTGTCCGGCAAGGAGTCTCTGAAGATACCCCAAGCA Attorney Ref No: 24742-0149WO1 AGAGGAGCTCTTAGTTCTCTGAGAGGGCAGCCTTTCTTTATTCCTCTGTATGCACTTTATCTCG CATATGGTGGAATATTCAGGTTGACATTTGGTCCAAAGTCTTTTCTGATTGTTTCTGATCCATC CATTGCCAAGCATATCTTGAAGGATAATTCCAAGGCTTATTCCAAGGGTATCCTCGCAGAGGTT TTAGATTTTGTTATGGGTAAGGGTCTGATCCCAGCCGATGGAGAAATCTGGCGTGTTAGACGGA GGGCGGTTGTTCCAGCATTGCATCAAAAGTATGTAGCAGCTATGATTGGCCTCTTTGGGGAAGC TACTGATAGACTGTTAAAGAAGTTGGATACTGCAGCATCCGATGGAGAGGATGTTGAAATGGAG TCCTTGTTTTCGCGGTTGACATTGGATATTATTGGGAAGGCTTTGTTCAATTATGATTTCGATT CATTAACGAATGATACAGGGATTGTTGCGGCTGTTTACACTGTCTTGCGTGAAGCAGAAGATCG AAGTGTTTCACCAATTCCAGTTTGGGATATTCCGGTATGGAAAGATATTTCACCAAGGCAAAGA AAGGTCACAACATCTCTCAAGTTGATCAATGAGACACTTGACGATCTTATTGCAATATGCAAGA GAATGGTAGAAGAAGAAGAACTGCAGTTTCATGAGGAATACATGAATGAGCAAGATCCCAGTAT TCTTCACTTCCTTTTGGCATCAGGGGATGACGTTTCAAGCAAGCAGTTACGTGATGACCTGATG ACCATGCTCATAGCTGGGCATGAGACATCTGCTGCAGTCTTAACATGGACCTTTTATCTTCTTT CCAAGGAGCCCAGTGTAATGGCCAAGCTACAAAATGAGGTTGATTCTGTGTTAGGAGATCGTTT CCCATCCATTGAAGACATGAAGAAGCTCAAGTATACAACGCGTGTAATCAATGAATCCTTAAGA CTCTACCCGCAACCACCTGTCTTGATTCGCCGATCTTTGGAGAATGACATGCTTGGAAAGTATC CAATAAAGAGGGGTGAAGACATTTTCATCTCAGTCTGGAACCTACATCATTGTCCTAATCATTG GGTCGACGCAGAGAAATTCAACCCAGAGAGGTGGCCTCTAGATGGACCAAATCCAAATGAGGTC AACCAAAACTTCAGTTACCTCCCCTTTGGTGGCGGACCACGAAAATGCATTGGAGACATGTTTG CTACTTTTGAGAATATTACCGCAATCACAATGCTTGTCCGGCGGTTCAATTTCCAGTTGGCCCT TGGTGCTCCTCCGGTGGAAATGACAACAGGGGCAACTATACACACAACAAAAGGATTAAAGATG ACAGTTACAAGAAGGATGAGAAGTCCAATTATACCAAACTTGGAGAAAAAAGTGTTGGACAAAG GTGGTGATAAACCTCTTAAGAAAGATCAAGTTTCACCTGCTCTCTCCTAA (SEQ ID NO:39) MAATASILQLPSLPTKSLQISSRSNKLKSNFISFPKLNNGTPPRSFITCASTNGREPNSLNEDN VKSAKRLLEEKERAELAARIASGEFTVEQSGFLPQLRSVLSKLGVPEEFLDFLSGKESLKIPQA RGALSSLRGQPFFIPLYALYLAYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAYSKGILAEV LDFVMGKGLIPADGEIWRVRRRAVVPALHQKYVAAMIGLFGEATDRLLKKLDTAASDGEDVEME SLFSRLTLDIIGKALFNYDFDSLTNDTGIVAAVYTVLREAEDRSVSPIPVWDIPVWKDISPRQR KVTTSLKLINETLDDLIAICKRMVEEEELQFHEEYMNEQDPSILHFLLASGDDVSSKQLRDDLM TMLIAGHETSAAVLTWTFYLLSKEPSVMAKLQNEVDSVLGDRFPSIEDMKKLKYTTRVINESLR LYPQPPVLIRRSLENDMLGKYPIKRGEDIFISVWNLHHCPNHWVDAEKFNPERWPLDGPNPNEV NQNFSYLPFGGGPRKCIGDMFATFENITAITMLVRRFNFQLALGAPPVEMTTGATIHTTKGLKM TVTRRMRSPIIPNLEKKVLDKGGDKPLKKDQVSPALS (SEQ ID NO:40) >CYP96A3-2 ATGGCTGCCACTGCTTCTATACTTCAACTCCCTTCTCTTCCCACCCAGTCTCTTCAAATCAGTT CTCGTTCAAACAAATTCAAATCCAACTTCATATCATTCCCAAAACTGAATAATAGCACCCCTCG GCGTTCTTTTGTCACCTGTGCATCAACTAATGGGCGAAAACCCAATTCTCTCAACGAAGACAAT GTGAAGAGTGCCAAACGCCTTTTAGAAGAGAAAGAACGTGCGGAATTGGCTGCTCGGATTGCTT CTGGTGAATTTACAGTAGAACAGTCTGGGTTTCTGCCACAATTGAAGAGTGTCTTGTCGAAATT GGGCGTGCCTGAGGAGTTTTTAGATTCTCTGTCCGGCAAAGAGTCTCTGAAGATTCCCCAAGCA AGAGGAGCTCTTAGCTCTCTGAGAGGCCAGCCTTTCTTTATTCCTTTGTATGCACTTTATCTCG CCTATGGTGGAATATTCAGGCTGACATTTGGTCCAAAGTCTTTTCTGATTGTTTCTGATCCATC CATTGCTAAGCATATCTTGAAGGATAATTCCAAGGCTTATTCCAAGGGTATCCTCGCAGAAGTT TTAGATTTTGTTATGGGGAAGGGTCTGATCCCAGCGGATGGAGAAATCTGGCGTGTTAGACGGA Attorney Ref No: 24742-0149WO1 GGGCGGTTGTTCCAGCATTGCATCAAAAGTATGTAGCAGCTATGATTGGCCTCTTTGGGGAAGC TACTGATAGACTGTTGAAGAAGTTGGATACTGCAGCATCTGATGGGGAGGATGTTGAAATGGAG TCCTTGTTTTCGCGGTTGACATTGGATATTATCGGGAAGGCTTTGTTCAATTATGATTTTGATT CATTAACAAATGATACCGGGATAGTTGCGGCTGTTTACACTGTCTTGCGTGAAGCGGAAGATCG AAGTGTTTCACCGATTCCAGTTTGGGATATTCCAGTATGGAAAGATATTTCACCACGGCAAAGA AAGGTGACAACATCTCTCAAGTTGATCAATGAGACACTTGACGATCTTATTGCGATATGCAAGA GAATGGTAGAAGAAGAAGAACTGCAGTTTCACGAGGAATACATGAATGAGCAAGATCCCAGTAT TCTTCACTTCCTTTTGGCATCAGGGGATGACGTTTCGAGCAAGCAGTTACGTGATGACCTGATG ACCATGCTCATAGCTGGGCATGAGACATCTGCTGCAGTCTTAACATGGACCTTTTATCTTCTTT CCAAGGAACCCAGTGTAATGGCCAAGCTGCAAAATGAGGTTGATTCTGTGTTAGGAGATCGTTT CCCATCCATTGAAGACATGAAGAAGCTCAAGTATACAACGCGTGTAATCAATGAATCCTTAAGA CTCTACCCGCAACCACCTGTCTTGATTCGCCGATCTTTGGAGAATGACATGCTTGGAAAGTATC CAATTAAGAGGGGTGAAGATATTTTCATTTCCGTCTGGAACCTGCATCACTGTCCTAACCACTG GATCGACGCAGAGAAATTCAACCCAGAGAGATGGCCTCTAGATGGACCAAATCCAAATGAGGTC AATCAAAACTTCAGTTATCTTCCCTTTGGTGGCGGACCACGAAAATGCATTGGAGACATGTTTG CTACTTTTGAGAATATTACCGCAATCACAATGCTTGTCCGCCGGTTCAATTTCCAGTTGGCCCT CGGTGCTCCTCCGGTGGAAATGACAACAGGGGCAACTATACACACAACAAAAGGATTAAAGATG ACAGTTACAAGAAGGATGAGAAGTCCTATTATACCAAATTTGGAGAAAAAAGTGTTGGACAAAG ATGGTGATAAACCTCTTAAGCAAGATCAAGTTTCACCTGCTCTCTCCTAA (SEQ ID NO:41) MAATASILQLPSLPTQSLQISSRSNKFKSNFISFPKLNNSTPRRSFVTCASTNGRKPNSLNEDN VKSAKRLLEEKERAELAARIASGEFTVEQSGFLPQLKSVLSKLGVPEEFLDSLSGKESLKIPQA RGALSSLRGQPFFIPLYALYLAYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAYSKGILAEV LDFVMGKGLIPADGEIWRVRRRAVVPALHQKYVAAMIGLFGEATDRLLKKLDTAASDGEDVEME SLFSRLTLDIIGKALFNYDFDSLTNDTGIVAAVYTVLREAEDRSVSPIPVWDIPVWKDISPRQR KVTTSLKLINETLDDLIAICKRMVEEEELQFHEEYMNEQDPSILHFLLASGDDVSSKQLRDDLM TMLIAGHETSAAVLTWTFYLLSKEPSVMAKLQNEVDSVLGDRFPSIEDMKKLKYTTRVINESLR LYPQPPVLIRRSLENDMLGKYPIKRGEDIFISVWNLHHCPNHWIDAEKFNPERWPLDGPNPNEV NQNFSYLPFGGGPRKCIGDMFATFENITAITMLVRRFNFQLALGAPPVEMTTGATIHTTKGLKM TVTRRMRSPIIPNLEKKVLDKDGDKPLKQDQVSPALS (SEQ ID NO:42) >BCH1 ATGCTAGCTTCAATGGCAGCGGCAACCTCAATCACTTCAAGCTCCAGAGCATTTCGTTTCCACA GAAGTCTGTTCTTAAACACAAAACCCAACATTCGTAATCCCCCTTGTTTGCTATTTTCTCCACT TCTGATGAGAAACAGAAACGGTGCTGGTGCTTTGACTATCTGCTTTGTTGCAGAGAGAACAAGG GGGCGTGAGATTCCCCAGATTGAAGAGGACGAAAAAAACATGGATGAAGTGTTTGAGCAGATGA ATTCAGCTTCAGTACGAGTTGCCGAGAAGTTAGCTAGAAAGAAATCAGAAAGGTTTACTTATCT CATTGCTGCTCTCATGTCTAGTATGGGCATCACTTCTATGGCTATTCTTTCTGTTTATTACAGA TTTTCTTGGCAAATGGAGGGGGGAGATATTCCTGTTACAGAAATGTTGGGCACATTTGCTCTAT CTGTTGGTGCTGCTGTAGGAATGGAGTTTTGGGCAAGATGGGCTCACAGAGCACTCTGGCATGC TTCTCTATGGCACATGCACGAGTCCCACCATAAGCCAAGAGAAGGCCCTTTCGAGCTAAATGAC GTCTTCGCCATTATTAACGCGGTTCCAGCTATTGCTCTTCTCAATTTTGGCTTCTTCCACAAAG GCCTCATTCCTGGTCTATGCTTTGGTGCTGGTCTTGGAATTACAGTATTTGGCATGGCTTATAT GTTTGTCCACGACGGCCTAGTTCATCGAAGATTCCCAGTGGGACCAATTGCAAATGTTCCTTAT TTCCGCAAAGTGGCTGCTGCTCACCAAATTCATCACACAGACAAATTCCAAGGTGTACCATATG Attorney Ref No: 24742-0149WO1 GATTGTTTCTTGGACCAAAGGAATTAGAAGAGGTAGGAGGAAATGAAGAGTTGGAGAAGGAGAT AGAGCGAAGAATAAAGCGTATGAATGCCTTATAG (SEQ ID NO:43) MLASMAAATSITSSSRAFRFHRSLFLNTKPNIRNPPCLLFSPLLMRNRNGAGALTICFVAERTR GREIPQIEEDEKNMDEVFEQMNSASVRVAEKLARKKSERFTYLIAALMSSMGITSMAILSVYYR FSWQMEGGDIPVTEMLGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESHHKPREGPFELND VFAIINAVPAIALLNFGFFHKGLIPGLCFGAGLGITVFGMAYMFVHDGLVHRRFPVGPIANVPY FRKVAAAHQIHHTDKFQGVPYGLFLGPKELEEVGGNEELEKEIERRIKRMNAL (SEQ ID NO:44) >BCH2 ATGCCAGCTTCAATGGCAGCGGCAATCTCAATCACTTCAAGCTCCAGAGCATTTCGTTTCCACG GAAGTCTGTTCTTAAACACAAAAACCAACATTCTTAATCCTCCTTGTTTGCTCTTTTCTCCACT TAAAATGAGAAACAGAAACGGTGCTGGGGCTTTGACTATCTGCTTTGTTGCAGAGAGAACAAGG GGGCGTGAGATTCCCCAGATTGAAGAGGACGAACAAAACACAGATGAAGTGTTTGAGCAGATGA ATTCAGCTTCAGTACGAGTTGCTGAGAAGTTAGCTAGAAAGAAATCAGAAAGGTTCACTTATCT CATTGCTGCTCTCATGTCTAGTATGGGCATCACTTCTATGGCTATTCTTTCTGTTTATTACAGA TTTTCTTGGCAAATGGAGGGTGGAGATATTCCTGTTACAGAAATGTTGGGCACATTTGCTCTAT CTGTTGGTGCTGCTGTCGGAATGGAGTTTTGGGCAAGATGGGCTCACAGAGCCCTCTGGCATGC TTCTCTATGGCACATGCACGAGTCCCACCATAAGCCAAGAGAAGGACCTTTCGAGCTAAACGAC GTCTTCGCCATTATTAACGCGGTTCCAGCTATTGCTCTTCTCAATTTCGGCTTCTTCCACAAAG GCCTCATTCCTGGTCTTTGCTTTGGTGCTGGTCTTGGAATTACAGTATTTGGCATGGCTTATAT GTTTGTCCACGACGGCCTAGTCCATCGAAGATTCCCAGTGGGACCAATCGCAAATGTTCCTTAT TTCCGCAAAGTGGCCGCTGCACATCAAATTCATCACACAGACAAATTCCAAGGTGTACCATATG GGTTGTTCCTAGGACCGAAGGAATTAGAAGAGGTAGGAGGAAATGAAGAGTTGGAGAAGGAGAT AGAGCGAAGAATAAAGCGTATGAATGCCTTATAA (SEQ ID NO:45) MPASMAAAISITSSSRAFRFHGSLFLNTKTNILNPPCLLFSPLKMRNRNGAGALTICFVAERTR GREIPQIEEDEQNTDEVFEQMNSASVRVAEKLARKKSERFTYLIAALMSSMGITSMAILSVYYR FSWQMEGGDIPVTEMLGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESHHKPREGPFELND VFAIINAVPAIALLNFGFFHKGLIPGLCFGAGLGITVFGMAYMFVHDGLVHRRFPVGPIANVPY FRKVAAAHQIHHTDKFQGVPYGLFLGPKELEEVGGNEELEKEIERRIKRMNAL (SEQ ID NO:46) It is to be understood that, while the methods and compositions of matter have been described herein in conjunction with a number of different aspects, the foregoing description of the various aspects is intended to illustrate and not limit the scope of the methods and compositions of matter. Other aspects, advantages, and modifications are within the scope of the following claims. Disclosed are methods and compositions that can be used for, can be used in conjunction with, can be used in preparation for, or are products of the disclosed methods and compositions. These and other materials are disclosed herein, and it is understood that combinations, subsets, Attorney Ref No: 24742-0149WO1 interactions, groups, etc. of these methods and compositions are disclosed. That is, while specific reference to each various individual and collective combinations and permutations of these compositions and methods may not be explicitly disclosed, each is specifically contemplated and described herein. For example, if a particular composition of matter or a particular method is disclosed and discussed and a number of compositions or methods are discussed, each and every combination and permutation of the compositions and the methods are specifically contemplated unless specifically indicated to the contrary. Likewise, any subset or combination of these is also specifically contemplated and disclosed.
Claims
Attorney Ref No: 24742-0149WO1 WHAT IS CLAIMED IS:
1. A nucleic acid construct comprising: a nucleic acid molecule that encodes at least one carotenoid beta-ring 4- dehydrogenase (CBFD), a nucleic acid molecule that encodes at least one carotenoid 4-hydroxy-beta-ring 4- dehydrogenase (HBFD), optionally, a nucleic acid molecule that encodes at least one phytoene synthase (PSY), and at least one promoter driving expression of the at least one CBFD, the at least one HBFD, and the optionally at least one PSY.
2. The nucleic acid construct of claim 1, wherein the at least one nucleic acid molecule that encodes the at least one CBFD is an Adonis aestivalis nucleic acid molecule.
3. The nucleic acid construct of claim 1 or claim 2, wherein the at least one nucleic acid molecule that encodes the at least one CBFD has the nucleic acid sequence shown in SEQ ID NO:1 or SEQ ID NO:
3.
4. The nucleic acid construct of any one of claims 1-3, wherein the at least one CBFD has the amino acid sequence shown in SEQ ID NO:2 or SEQ ID NO:4, respectively.
5. The nucleic acid construct of any of the preceding claims, wherein the at least one nucleic acid molecule that encodes the at least one HBFD is an Adonis aestivalis nucleic acid molecule.
6. The nucleic acid construct of any of the preceding claims, wherein the at least one nucleic acid molecule that encodes the at least one HBFD has the nucleic acid sequence shown in SEQ ID NO:5 or SEQ ID NO:7.Attorney Ref No: 24742-0149WO1 7. The nucleic acid construct of any of the preceding claims, wherein the at least one HBFD has the amino acid sequence shown in SEQ ID NO:6 or SEQ ID NO:8, respectively.
8. The nucleic acid construct of any of the preceding claims, wherein the at least one nucleic acid molecule that encodes the at least one PSY is a maize nucleic acid molecule.
9. The nucleic acid construct of any of the preceding claims, wherein the at least one nucleic acid molecule that encodes the at least one PSY has the nucleic acid sequence shown in SEQ ID NO:15 or SEQ ID NO:
17.
10. The nucleic acid construct of any of the preceding claims, wherein the at least one PSY has the amino acid sequence shown in SEQ ID NO:16 or SEQ ID NO:18, respectively.
11. The nucleic acid construct of any of the preceding claims, wherein the transgenic plant further comprises at least one nucleic acid molecule that encodes at least one phytyl ester synthase under control of the at least one promoter.
12. The nucleic acid construct of any of the preceding claims, wherein the at least one phytyl ester synthese is an astaxanthin ester synthase (AES) or xanthophyll esterase (XES).
13. The nucleic acid construct of any of the preceding claims, wherein the at least one nucleic acid molecule that encodes the at least one AES is an Adonis aestivalis nucleic acid molecule.
14. The nucleic acid construct of any of the preceding claims, wherein the at least one nucleic acid molecule encoding the at least one AES has the nucleic acid sequence shown in SEQ ID NO:9 or SEQ ID NO:
11.
15. The nucleic acid construct of any of the preceding claims, wherein the at least one AES has the amino acid sequence shown in SEQ ID NO:10 or SEQ ID NO:12, respectively.Attorney Ref No: 24742-0149WO1 16. The nucleic acid construct of any of the preceding claims, wherein the at least one nucleic acid molecule that encodes the at least one XES is a tomato nucleic acid molecule.
17. The nucleic acid construct of any of the preceding claims, wherein the at least one nucleic acid molecule that encodes the at least one XES has the nucleic acid sequence shown in SEQ ID NO:
13.
18. The nucleic acid construct of any of the preceding claims, wherein the at least one XES has the amino acid sequence shown in SEQ ID NO:
14.
19. The nucleic acid construct of any of the preceding claims, wherein the at least one promoter is a constitutive promoter, a tissue-specific promoter, or an inducible promoter.
20. The nucleic acid construct of any of the preceding claims, wherein the constitutive promoter is selected from a mosaic virus promoter (e.g., cauliflower mosaic virus promoter) or a ubiquitin promoter.
21. The nucleic acid construct of any of the preceding claims, wherein the tissue- specific promoter is a promoter from a seed storage protein gene.
22. The nucleic acid construct of any of the preceding claims, wherein the inducible promoter is selected from a promoter for dexamethasone or a promoter for methoxyfenoside.
23. A transgenic plant, comprising at least one nucleic acid molecule that encodes at least one carotenoid beta-ring 4-dehydrogenase (CBFD), at least one carotenoid 4-hydroxy-beta- ring 4-dehydrogenase (HBFD), and, optionally, at least one phytoene synthase (PSY) under control of at least one promoter.
24. The transgenic plant of claim 23, wherein the transgenic plant further comprises at least one nucleic acid molecule that encodes at least one phytyl ester synthase under control of the at least one promoter.Attorney Ref No: 24742-0149WO1 25. The transgenic plant of claim 23 or 24, wherein the transgenic plants are soybean plants.
26. The transgenic plant of claim 23 or 24, wherein the transgenic plants are camelina plants.
27. The transgenic plant of claim 23 or 24, wherein the transgenic plants are selected from canola, rapeseed, Ethiopian mustard, black mustard, pennycress, sunflower, peanut, and safflower plants.
28. Seed produced from the transgenic plant of any one of claims 23-27.
29. Vegetative tissue from the transgenic plant of any one of claims 23-27.
30. The vegetative tissue of claim 29, wherein the vegetative tissue is selected from fruits, roots, tubers, and other vegetative tissues.
31. A method of making astaxanthin and / or astaxanthin-esters, comprising: providing tissue from the transgenic plant of any of claims 23-27; and collecting the astaxanthin and / or astaxanthin-esters contained in the tissue.
32. The method of claim 31, wherein the tissue from the transgenic plant is vegetative.
33. The method of claim 31, wherein the tissue from the transgenic plant is seed.
34. A method of making astaxanthin and / or astaxanthin-esters, comprising: providing the seed of claim 28; growing the seed into a transgenic plant under conditions where the nucleic acid molecules are expressed; andAttorney Ref No: 24742-0149WO1 collecting the transgenic plant or plant tissue from the transgenic plant that comprises the astaxanthin and / or astaxanthin-esters.
35. The method of claim 34, wherein the transgenic plant or plant tissue from the transgenic plant comprises greater than about 100 ^g of astaxanthin and / or astaxanthin-esters per g of dry weight of the transgenic plant tissue.
36. The method of claim 34, wherein the transgenic plant or plant tissue from the transgenic plant comprises about 100 to about 150 ^g of astaxanthin and / or astaxanthin-esters per g of dry weight of the transgenic plant tissue.
37. A genetically-engineered microbe, comprising at least one nucleic acid molecule that encodes at least one carotenoid beta-ring 4-dehydrogenase (CBFD), at least one carotenoid 4-hydroxy-beta-ring 4-dehydrogenase (HBFD), and, optionally, at least one phytoene synthase (PSY) under control of at least one promoter.
38. The genetically-engineered microbe of claim 37, wherein the genetically- engineered microbe further comprises at least one nucleic acid molecule that encodes at least one phytyl ester synthase under control of the at least one promoter.
39. A method of making astaxanthin and / or astaxanthin-esters, comprising: providing the genetically-engineered microbe of claim 37 or 38; culturing the genetically-engineered microbe under conditions where the nucleic acid molecules are expressed; and collecting the astaxanthin and / or astaxanthin-esters produced by the genetically- engineered microbe.
40. Astaxanthin and / or astaxanthin-esters made by the method of any one of claims 34- 36 or 39.