Process for the production of 2,5-furandicarboxylic acid

Abstract

Process for the production of 5-hydroxymethyl-2-furancarboxylic acid (HMFA), wherein 5-hydroxymethylfurfural (HMF), which is present in an aqueous solution, is oxidized to obtain 5-hydroxymethyl-2-furancarboxylic acid (HMFA) by treatment with an NAD(P)+-dependent aldehyde dehydrogenase in vitro with NAD(P)H being formed; after said oxidation step the NAD(P)H formed during the oxidation is enzymatically regenerated with an oxidoreductase back to NAD(P)+, and a keto compound is used as a cosubstrate of the oxidoreductase.

Description

[0001] Method for the production of 2,5-furandicarboxylic acid

[0002] The invention relates to a process for the production of 2,5-furandicarboxylic acid (FDCA) from 5-(hydroxymethyl)furfural (HMF). Furthermore, the invention relates to a process for the production of 5-hydroxymethyl-2-furancarboxylic acid (HMFA) from 5-(hydroxymethyl)furfural (HMF).

[0003] Background of the invention

[0004] In 2018, approximately 90% of the plastics produced worldwide (400 Mt) were based on fossil raw materials, with the remaining shares consisting of recycled (9%), bio-based (1%), and CO₂-based plastics (<1%) (Carus et al., 2020). At the same time, global demand for plastics is also growing. In 2019, the annual CO₂ emissions for the entire life cycle of plastics amounted to 0.86 Gt, equivalent to the CO₂ emissions of 189 coal-fired power plants operating at full capacity (500 MW). An increase to 2.8 Gt (equivalent to 615 coal-fired power plants) is projected for 2050 (Hamilton et al., 2019).

[0005] One of the plastics based on fossil raw materials is polyethylene terephthalate (PET), which is primarily used in beverage packaging. It is a condensation polymer produced from terephthalic acid (1,4-benzenedicarboxylic acid) and ethylene glycol (ethane-1,2-diol) through the elimination of water.

[0006] Terephthalic acid is produced on an industrial scale by oxidation of p-xylene (1,4-dimethylbenzene) with atmospheric oxygen at approximately 200 °C in the presence of cobalt acetate, manganese acetate and HBr in acetic acid in the so-called AMOCO process (Tomäs et al., 2013).

[0007] Ethylene glycol is produced by the hydrolysis of ethylene oxide (at 200 °C), which in turn is obtained by the oxidation of ethene (derived from fossil raw materials) (Berger, 2016). Due to the fossil sources of the starting materials (p-xylene and ethene), PET cannot generally be considered sustainable.

[0008] To achieve the 1.5-degree target of the Paris Climate Agreement and thus limit the negative consequences of climate change, sustainable alternatives to petrochemical-based plastics must be found. For ethylene glycol, for example, there are processes that rely on renewable resources. Ethene can also be produced by the dehydration of bioethanol obtained fermentatively from glucose or starch (e.g., Fan et al., 2013). Fermentative conversions of xylose and / or glucose to ethylene glycol using metabolically engineered microorganisms (Escherichia coli or Saccharomyces cerevisiae) are also known (Salusjärvi et al., 2019). The second building block of PET, the aromatic compound terephthalic acid, is difficult to produce from sustainable raw materials and therefore must be replaced.An excellent substitute for terephthalic acid is 2,5-furandicarboxylic acid (FDCA), which is predominantly obtained from the catalytic upgrading of biomass. Polymerization of FDCA with ethylene glycol produces PEF (polyethylene furanoate), which, in its structure, features a heteroaromatic furan ring instead of a benzene ring. Like PET, PEF is a thermoplastic, but compared to PET, it is characterized by significantly higher biodegradability and better thermal (higher glass transition temperature, lower melting point) as well as mechanical properties (higher stiffness). However, the most important property of PEF is its reduced permeability to gases such as O₂ and CO₂. This is particularly important for beverages, as it can extend their shelf life (preventing outgassing of carbonated beverages; preventing oxidation processes by diffused oxygen) (de Jong et al., 2022).

[0009] The most important starting material for FDCA by far is 5-(hydroxymethyl)furfural (HMF), which can be obtained, for example, from cellulose (and thus from renewable resources). Enzymatic or chemical hydrolysis of cellulose produces D-glucose, which is subsequently isomerized (enzymatically or chemically) to D-fructose. Dehydration (removal of three H₂O molecules) yields HMF from D-fructose. Common systems for the dehydration of fructose include mineral acids such as H₂SO₄ or HCl, and solid-state (Brpnsted or Lewis) acid catalysts (Cong et al., 2021; US ​​9617234 Bl).

[0010] HMF possesses an alcohol and an aldehyde functional group, which must be oxidized to carboxylic acid groups to obtain FDCA. The three necessary oxidation steps can be carried out in various ways: chemically with heterogeneous or homogeneous catalysts, electrochemically, and biocatalytically (enzymatically or with whole cells).

[0011] An overview of various chemical syntheses can be found in the article by Cong et al. (2021).

[0012] Biocatalytic processes offer several advantages over classical chemical methods. For example, the use of enzymes or cells allows for highly selective chemical reactions under mild reaction conditions (aqueous environment, room temperature, ambient pressure), and the catalysts used are also biodegradable (Cong et al., 2021).

[0013] An intermediate in the oxidation of HMF to FDCA is 5-hydroxymethyl-2-furancarboxylic acid (HMFA), which is used, for example, as a building block for polymers such as oligoesters with e-caprolactone as a comonomer (Todea et al., 2019). Furthermore, HMFA exhibits cytotoxic and antitumor properties (Munekata & Tamura, 1981) and acts as a nematicide against nematodes.

[0014] Bursaphelenchus xylophilus and Caenorhabditis elegans (Kimura et al., 2007).

[0015] The oxidation of HMF to HMFA can be achieved biocatalytically. For example, resting cells of the bacterium Deinococcus wulumugiensis R12 are able to produce 511 mM HMFA with a yield of 85% and a productivity of 44 g / (ld) in 20 h using a fed-batch process (addition of 0.75 mmol HMF every 5 h). 2,5-Bis(hydroxymethyl)furan (BHMF) was formed as the only byproduct in trace amounts (< 1%) (Cang et al., 2019).

[0016] Aldehyde dehydrogenases (ALDH) are enzymes that catalyze the oxidation of aldehyde groups to carboxylic acid groups. For example, an ALDH has been described for the organism Raoultella ornithinolytica BF60 that can oxidize HMF to HMFA (Hossain et al., 2017).

[0017] The combination of ALDH and NAD(P)H oxidase is also described in US 10344307 B2 to oxidize 10 mM HMF with 20 mol% cofactor (NAD + or NADP + ) to be completely oxidized to HMFA in 30 minutes.

[0018] Qin et al. (2015) used a xanthine oxidase (XO) from Escherichia coli, a molybdenum-dependent enzyme, to oxidize 26 mM HMF with oxygen to HMFA (94% yield in 7 h).

[0019] Another representative of the xanthine oxidase family, which catalyzes the oxidation of HMF to HMFA, is the periplasmic aldehyde oxidase (PaoABC) from E. coli (McKenna et al., 2015; McKenna et al., 2017; US 10344307 B2).

[0020] Carro et al. (2015) described a non-specific peroxygenase (UPO, EC 1.11.2.1; requires H2O2 as an oxidizing agent) from the fungus Agrocybe aegerita, which oxidized 3 mM HMF to HMFA to 97% in 24 h.

[0021] HMFA itself can be enzymatically oxidized to either 5-formyl-2-furan carboxylic acid (FFA) or FDCA, generally requiring two different enzymes for the individual oxidation steps (HMFA and FFA FDCA).

[0022] Mathieu et al. (2020) described the oxidation of 10 mM HMFA to FFA (46% conversion after 16 h) with an aryl alcohol oxidase (AAO) from the fungus Colletotrichum graminicola in the presence of catalase and HRP (horseradish peroxidase).

[0023] In a study by Cleveland et al. (2021), two aryl alcohol oxidases from the fungi Fusarium graminearum (Fgr AO) and Fusarium oxysporum (FoxAAO) were characterized. These oxidases were able to convert 10 mM HMFA (also in the presence of catalase and HRP) to FFA in 16.5 h (conversion for FgrAAO: 84%, FoxAAO: 96%). No activity on FFA was detected for either aryl alcohol oxidase. Cajnko et al. (2020) tested a range of commercially available enzymes (alcohol oxidase (AO) from Pichia pastoris; galactose oxidase from Dactylium dendroides; catalase from Aspergillus niger; laccase from Trametes versicolor; a fungal lignin peroxidase (LPO); and HRP) on 10 mM FFA and observed the formation of significant amounts of FDCA (11.6% for AO, 1.1% for laccase, and 3.2% for LPO) after 72 h only for AO, laccase, and LPO. HMFA was found as a byproduct (up to 18.2% for AO).HMFA (10 mM) was converted in 72 h by the HRP or LPO with a maximum turnover of 4.0% to FDCA (and a maximum turnover of 0.6% to FFA).

[0024] Lappe et al. (2021) described a UPO from Moesziomyces antarcticus that completely oxidized 2 mM HMFA to FFA (99.2%) and FDCA (0.8%) in 144 h. Conversely, 2 mM FFA could be converted to 40% FDCA in 144 h.

[0025] The UPO from A. aegerita used by Carro et al. (2015) also catalyzes the oxidation of FFA (3 mM) to FDCA (90% conversion after 120 h).

[0026] Jia et al. (2017) used an enzyme system consisting of equine alcohol dehydrogenase (HLADH) and human hemoglobin (oxidizes NADH to NAD using H2O2). + ), to oxidize 96% of the substrate (10 mM FFA) to FDCA in 60 h.

[0027] US 8183020 B2 describes the enzymatic oxidation of FFA to FDCA using a commercially available chlorine peroxidase from Caldariomyces fumago (EC 1.11.1.10) with H2O2 as the oxidizing agent.

[0028] McKenna et al. (2017) used a combination of PaoABC and galactose oxidase M3-5 (GOase M3-5) in combination with catalase and HRP for the oxidation of HMF to FDCA. The oxidation of HMF to 2,5-diformylfuran (DFF) and of HMFA to FFA is catalyzed by GOase Ms-s, and the remaining steps are catalyzed by PaoABC. The addition of HRP as an activator for GOase M3-5 is essential because otherwise the oxidation of HMFA to FFA proceeds very slowly, thus representing a bottleneck in the cascade.

[0029] The methods presented here for the production of HMFA and FDCA generally have disadvantages such as low substrate concentrations, long reaction times or uneconomically high amounts of added cofactor.

[0030] This is where the object of the present invention comes in, aiming to provide improved processes for the production of HMFA and FDCA characterized by high substrate concentrations and / or high conversion rates. Detailed description of the invention

[0031] The object of producing 5-hydroxymethyl-2-furancarboxylic acid (HMFA) is solved according to the invention by treating 5-hydroxymethylfurfural (HMF), which is present in an aqueous solution, with an NAD(P) + -dependent aldehyde dehydrogenase is oxidized in vitro to form NAD(P)H to 5-hydroxymethyl-2-furancarboxylic acid (HMFA), after which the NAD(P)H produced during the oxidation is enzymatically reduced back to NAD(P) by an oxidoreductase. + regenerates and a keto compound is used as a co-substrate for the oxidoreductase.

[0032] The keto compound preferably used is a ketose, in particular preferably D-fructose, an aldose, in particular preferably D-glucose or D-xylose, or a ketone, more preferably an aliphatic ketone and in particular preferably acetone.

[0033] The problem of producing 2,5-furandicarboxylic acid (FDCA) is solved according to the invention by adding a 5-hydroxymethylfurfural oxidase (HMFO) to the aqueous solution after the formation of 5-hydroxymethyl-2-furancarboxylic acid (HMFA).

[0034] It has been shown that the addition of HMFO does not stop the oxidation of HMF at HMFA, but rather the oxidation continues to the corresponding dicarboxylic acid (FDCA), since the NAD(P) + - dependent aldehyde dehydrogenase also catalyzes the final oxidation step of 5-formyl-2-furan carboxylic acid (FFA) to FDCA.

[0035] In another variant of the process according to the invention, a catalase is also added to the aqueous solution.

[0036] In a further preferred embodiment of the process according to the invention, the NAD(P)H produced during oxidation is partially reacted with an NAD(P)H oxidase to form NAD(P) + regenerated.

[0037] Preferably alcohol dehydrogenases, xylitol dehydrogenases, sorbitol dehydrogenases, xylose reductases or SDR family oxidoreductases are used as oxidoreductases.

[0038] Preferred embodiments of the process according to the invention are schematically illustrated in the accompanying Figure 1. Here, A stands for 5-(hydroxymethyl)furfural (HMF), B for 5-hydroxymethyl-2-furancarboxylic acid (HMFA), C for 5-formyl-2-furancarboxylic acid (FFA), D for 2,5-furandicarboxylic acid (FDCA), E for a keto compound, F for the alcohol obtained from the keto compound by reduction, 1 for aldehyde dehydrogenase, 2 for oxidoreductase (for cofactor regeneration), and 3 for HMF oxidase. 33820-WQ 6

[0039] The NAD(P) + -dependent aldehyde dehydrogenase comprises or preferably consists of a

[0040] Amino acid sequence selected from the group consisting of: i) an amino acid sequence exhibiting at least 80% identity with SEQ ID No. 2, SEQ ID No. 4, SEQ ID No. 6, SEQ ID No. 8, SEQ ID No. 10 or SEQ ID No. 12, ii) an amino acid sequence encoded by a nucleic acid exhibiting at least 80% identity with SEQ ID No. 1, SEQ ID No. 3, SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9 or SEQ ID No. 11, and iii) an amino acid sequence encoded by a nucleic acid that binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 1, SEQ ID No. 3, SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9 or SEQ ID No. 11.

[0041] SEQ ID No. 1:

[0042] ATGTCACGCTATGAACTGCTGATCGATGGTCGCCTGCAGGCGGCCGAGCACTACGACCGGGTGATCGA CCCGGCCAGCGAAGAAATCGTTGGCGAAGCCGCCCGCGCCAGCCTGGAGCAGGTCGACGCGGCGGTG GATGCCGCACACCGCGCCTTCCCGGCCTGGGCCACCGATCTCGACGTCCGCCGCCAGAGCCTGGCCCG AGCCGCCGAACGAGTACGCGAGAATGCCCAGGCGCTGGCCGAGCTGATCACCCGCGAACAGGGTCGC CCACTGCGCTCGACCCTGGAGGAAGTGGCTGGCGTCGCCGCCACTTTCGAGCACCACGCGCAGCTGGA GCTACCCGCCGACACCCAGTTGCGCGACGACGGCGAGCGCCTGGTGCGCATCACCCGCAAACCGCTGG GGGTGGTCGCCGCGATCACCCCGTGGAACGTCCCGCTGATCCTGCTGGTATTGAAGATCGCGCCTGCC CTGCACGCCGGCAACACCGTGGTGGCCAAGCCCTCGGAGCACACGCCGCTGTCTACCCTGCTGCTGGC GCGACTGCTGGGCGATGTGTTCCCCGCTGGCGTGTTCAACGTGGTTGCCGGTGCGGGCGAGGTTGGC GAACACCTGGTACGTCATCCGCGGGTGCGCCACGTGACCTTCACCGGCAGCGTCGCCACCGGCAAGCG CCTGTATGCCGGCGCGGGGGACGACCTCAAGCGTCTTACCCTGGAACTGGGCGGCAACGACGCCGCG CTGGTACTGGAAGACGCCGACCTCGACGCCATCGTCGAACCGCTGTTCTGGGGCGCCTTCTGGAACAG CGGCCAGGTGTGCTTTGCGATCAAGCGCCTGTACGTGCATGACAGCCTGTTCGAACCGTTACTGGCGA AACTCGCCGAGCGCGCCCAGCGCACCCGCCTCGGTCATGGGCTCGACCCGCAGACGGAACTGGGGCCGCTGACCAACGCACAGCAACTGGAACGGGTCATCGCCCTGGTGGAAGACGCCAAGGCTCACGGAGCA CGCATCCGCAGCGGCGGCGTACGGCCCGACGGTCCCGGCTACTTCTACCCGCCGACCCTGGTCAGCGG CGTGGCGGCCGGCGTCGCGCTGGTGGACGAGGAACAGTTCGGCCCGGTGTTGCCGGTGATCTCCTTCC GCAACGAAGAGGACGCCATTACCCAGGCCAACGCCAGCCACTACGGCCTCGGCGCCTCGGTGTGGACC CGCGACCTGGCGCGCGGCGAAGCCATCGCCAGGCGGCTGGAGGCGGGCCTGGCCTGGGTCAACCAGC ACGGCCACATCCAGCCCGGCGCGCCCAAGGGCGGGCACAAGTGGAGCGGGCTCGGCTACGAAGGCG GGCAGCGCGGCTATGAGGCCTTCAGCGAGCTGCAGGTGCTGAACATTTCGCGGCGCTAA

[0043] SEQ. ID Nr. 2: MSRYELLIDGRLQAAEHYDRVIDPASEEIVGEAARASLEQVDAAVDAAHRAFPAWATDLDVRRQSLARAAE

[0044] RVRENAQALAELITREQGRPLRSTLEEVAGVAATFEHHAQLELPADTQLRDDGERLVRITRKPLGVVAAITP

[0045] WNVPLILLVLKIAPALHAGNTVVAKPSEHTPLSTLLLARLLGDVFPAGVFNVVAGAGEVGEHLVRHPRVRHV

[0046] TFTGSVATGKRLYAGAGDDLKRLTLELGGNDAALVLEDADLDAIVEPLFWGAFWNSGQVCFAIKRLYVHDS

[0047] LFEPLLAKLAERAQRTRLGHGLDPQTELGPLTNAQQLERVIALVEDAKAHGARIRSGGVRPDGPGYFYPPTL

[0048] VSGVAAGVALVDEEQFGPVLPVISFRNEEDAITQANASHYGLGASVWTRDLARGEAIARRLEAGLAWVNQ

[0049] HGHIQPGAPKGGHKWSGLGYEGGQRGYEAFSELQVLNISRR

[0050] SEQ ID Nr. 3:

[0051] ATGTCGACATTTCATTTACTTATTGATGGCCATCTGCAAGCCAGTGACCAATCCGATGTGGTGATCAACC

[0052] CCGCGACCGAGCTGGAAGTCGGGCGTGCCCCACGTGCCAGCGCCACCCAGGTCGACCAGGCAGTGGA

[0053] AGCCGCACATCAGGCATTTCATCGCTGGGCATCACAGCCTGAGGTGCGCCAGCAGGCACTGCTGGGCG

[0054] CGGCCGCCGCCATTCGCCAGCATGCCGATGCCCTGGCACGCCTGATCACGCAAGAGCAGGGGCGGCCA

[0055] TTGCACTTTACCCAGGGCGAGGTGGCCGGGGCTGCTGCTACCTTTGAACACTATGCCGGGTTTGCCGCG

[0056] CCATCGGATGTGGTGCTGCAGCAGGACGAACAAAAGCGGGTCAGCATTGAGCGCAGGCCGTTTGGCG

[0057] TAGTGGCTGCCATTACGCCCTGGAATGTGCCCATCATCCTGCTGGTACTGAAAATCGCCCCGGCCTTGA

[0058] AGGCTGGCAATACCGTGGTCGCCAAGCCATCGGAATACACCCCGCTTTCTACCTTGTACCTGGGTGAAA

[0059] TTCTGAAAGATGTATTTCCGCCGGCGTGCTGAACGTGATAGCCGGTGACGGTCAGGTGGGGGCCGGC

[0060] CTGGCATCGCATCCGCTGGTGCAGAAGGTGACGTTCACCGGCAGCGTGGCAACCGGAAAAAAACTCTA

[0061] TGCCAGCGCCGCGCAGGATGTAAAACGCCTGACGCTGGAACTGGGCGGTAACGATGCGGCCATCGTG

[0062] CTGGACGATGCCAATGTCGATGCCATTGCCGAGAAGATTTTCTGGGGCGCCTTCTGGAATAGCGGTCA

[0063] GGTGTGCTTTGCCATCAAGCGCCTCTATGTGCACGAGCGTGTTTTCCAGCCCTTGCTCGATGCCCTGGT

[0064] GAAACGCGCGCAAAAACCCGCGTGGGCGATGGCCAGCTGCCGGGTACCGAGCTGGGGCCGCTTACC

[0065] AACAAAGCCCAGTTTGAGCGCGTGATATCGCTGGTGGAAGACGCCAGACGCCATGGCGCCACCATTCA

[0066] TTCAGGCGGTGCTGCATTGCCTGGCCCCGGCTATTTCTATCCGCCCACCCTGGTCACGGCATAGGCGC

[0067] AGGTGTCGCGCTGGTGGATGAAGAGCAGTTCGGACCAGTATTGCCGCTGATTCCTTTCCGTGATGAGC

[0068] AAGAGGCGGTGCGTCAGGCCAACGACAGTCCGTTTGGTCTGGGCGTTCGGTTTGGACCGCCAATCCC

[0069] GAACGCGGCCTGGCGCTGGTACGCCAGCTCCAGGCCGGGCTCGCCTGGGTCAACCAGCATGGCGATAT

[0070] CCATCCCGGTGCGCCCAAGGGCGGCTACAAATCCAGTGGCCTTGGCTACGAGGGCGGGCTGCGTGGCT

[0071] ATGACGAGTTCAGCGAGCTGCAAGTCGTCAATGCGGCGCTGGTTTAA

[0072] SEQ ID No. 4:

[0073] MSTFHLLIDGHLQASDQSDVVINPATELEVGRAPRASATQVDQAVEAAHQAFHRWASQPEVRQQALLGA

[0074] AAAIRQHADALARLITQEQGRPLHFTQGEVAGAAATFEHYAGFAAPSDVVLQQDEQKRVSIERRPFGVVAA ITPWNVPIILLVLKIAPALKAGNTVVAKPSEYTPLSTLYLGEILKDVFPPGVLNVIAGDGQVGARLASHPLVQK

[0075] VTFTGSVATGKKLYAAQDVKRLTLELGGNDAAIVLDDANVDAIAEKIFWGAFWNSGQVCFAIKRLYVHE

[0076] RVFQPLLDALVKRAQKTRVGDGQLPGTELGPLTNKAQFERVISLVEDARRHGATIHSGGAALPGPGYFYPPT

[0077] LVTGIGAGVALVDEEQFGPVLPLIPFRDEQEAVRQANDSPFGLGASVWTANPERGLALVRQLQAGLAWVN

[0078] QHGDIHPGAPKGGYKSSGLGYEGGLRGYDEFSELQVVNAALV

[0079] SE ID Nr. 5:

[0080] ATGTCGCGCTATGAACTGCTGATCGATGGTCGCCTCCAGGCGGCCGAGCACTACGACCGGGTTATAGA

[0081] CCCGGCCAGCGAAGAACTCGTCGGCGAAGCCGCCCGCGCCAGCCTGGAGCAGGTCGACGCGGCGGTG

[0082] GACGCCGCGCACCGCGCCTTCCCAACCTGGGCCACCGATCTCGACGGCCGCCGCCAGAGCCTGGCCCG

[0083] AGCCGCCGAACGAGTACGCGAGAACGCCCAGGCGCTGGCCGAGCTGATCACCCGCGAACAGGGTCGC

[0084] CCGCTGCGCTCGACACTGGAGGAAGTGGCGGGCGTCGCCGCCACTTTCGAGCACCACGCACATCTGGA

[0085] GCTTCCCGCCGATACCCAGTTGCGCGACGACGGCGAACGCCTGGTGCGCATCACCCGCAAACCCCTGG

[0086] GGGTGGTCGCCGCAATCACCCCGTGGAACGTCCCGCTGATCCTGCTGGTGCTGAAGATCGCGCCCGCC

[0087] CTGCATGCCGGCAACACCGTGGTGGCCAAGCCCTCGGAACACACGCCGCTGTCCACCCTGCTGCTGGC

[0088] GCGACTGCTGGGCGATGTGTTCCCTGCTGGCGTGTTCAACGTGATTGCCGGTGCAGGCGAGGTCGGCG

[0089] AACACCTGGTGCGCCATCCCCGAGTGCGCCACGTGACCTTCACCGGCAGCGTCGCCACCGGCAAGCGC

[0090] CTGTATGCCGGCGCAGCGGACGACCTCAAGCGCCTGACCCTGGAACTGGGCGGCAACGATGCCGCGCT

[0091] GGTGCTGGAAGATGCCGACCTCGAAGCCATCGTCGAACCGCTGTTCTGGGGCGCCTTCTGGAACAGCG

[0092] GCCAGGTGTGCTTCGCGATCAAGCGCCTGTACGTGCATGAAAGCCTGTTCGAACCGCTGCTGGCCAAA

[0093] CTCGCCGAACGCGCCGAGCGCACCCGCCTCGGCCATGGGCTCGACCCGCAGACGGAACTGGGGCCGC

[0094] TGACCAACGCGCAGCAACTGGAACGGGTCATCACCCTGGTGGAAGACGCCAAGGCTCACGGAGCGCG

[0095] CATCCACAGCGGTGGCACGCGGCCCGACGGCCCCGGTTACTTCTACCCGCCGACCCTGGTCAGCGGCG

[0096] TGGCGGCCGGTGTCGCGCTGGTGGATGAGGAACAGTTCGGCCCGGTGCTGCCGGTGATCCCGTTCCGC

[0097] GACGAAGAGGACGCCATCGCCCAGGCCAACGCCAGCCCCTACGGCCTCGGCGCCTCGGTGTGGACCC

[0098] GCGACCTGGCGCGCGGCGAAGCCATCGCCGAACGGTTGGAGGCGGGCCTGGCCTGGGTCAACCAGCA

[0099] CGGCCACATCCAGCCCGGCGCGCCCAAGGGCGGGCACAAGTGGAGCGGGCTCGGCTACGAAGGCGG

[0100] GCAACGCGGTTACGAGGCCTTCAGCGAGCTGCAGGTGCTCAACATTTCGCGGCGCTGA

[0101] SEQ ID Nr. 6:

[0102] MSRYELLIDGRLQAAEHYDRVIDPASEELVGEAARASLEQVDAAVDAAHRAFPTWATDLDGRRQSLARAAE

[0103] RVRENAQALAELITREQGRPLRSTLEEVAGVAATFEHHAHLELPADTQLRDDGERLVRITRKPLGVVAAITP

[0104] WNVPLILLVLKIAPALHAGNTVVAKPSEHTPLSTLLLARLLGDVFPAGVFNVIAGAGEVGEHLVRHPRVRHVT

[0105] FTGSVATGKRLYAGAADDLKRLTLELGGNDAALVLEDADLEAIVEPLFWGAFWNSGQVCFAIKRLYVHESLF EPLLAKLAERAERTRLGHGLDPQTELGPLTNAQQLERVITLVEDAKAHGARIHSGGTRPDGPGYFYPPTLVSG

[0106] VAAGVALVDEEQFGPVLPVIPFRDEEDAIAQANASPYGLGASVWTRDLARGEAIAERLEAGLAWVNQHGH

[0107] IQPGAPKGGHKWSGLGYEGGQRGYEAFSELQVLNISRR

[0108] SE ID Nr. 7:

[0109] ATGCGTTATGCACATCCTGGCACCCCGGGCGCCTTAGTTTCATTCAAGTCCGCATACGGTAACTATATTG

[0110] ACGGTCAATTTGTCGAACCGCTCGGCGGCGAATACTTTATGAATACCTCCCCCGTGGACGGGAGTGAC

[0111] ATTGCACAATTTCCCCGCTCCGATGCCAAAGATATCGATTTTGCTCTTGATGCCGCACACCGCGCCGCGG

[0112] AAGCCTGGGGGAAAACATCGGTACAGCATCGTTCCAACCTGCTGCTTCAGGTCGCCGATCGGATTCAG

[0113] GAGAACCTGGAATATCTGGCGATTGCTGAAAGCTGGGACAATGGTAAACCGGTGCGCGAAACGCTGA

[0114] ATGCCGATCTGCCGTTGGCGGTCGATCACTTCCGCTATTTTGCCGGCTGTCTGCGGGCACAGGAGGGG

[0115] AGTACTGCGGAAATTGATGAAACCACCGTGGCCTATCACTTCCATGAACCGCTGGGCGTAGTCGGGCA

[0116] AATTATTCCGTGGAACTTTCCGCTGCTGATGGCGGCCTGGAAGCTGGCGCCGGCGCTGGCGGCCGGGA

[0117] ACTGTGTGGTGCTCAAGCCGGCAGAGCAGACGCCGCTGAGCATCACGCTGCTGCTGGAAATTATTGGC

[0118] GACCTCTTCCCGCCGGGCGTCCTGAACGTGGTGCAGGGCTTCGGTAAAGAGGCCGGTGAAGCGCTGG

[0119] CAACCAGCAAGCGTATTGCCAAAATTGCCTTTACCGGCTCAACGCCCGTCGGACGGCATATTCTGGCCT

[0120] GCGCGGCGGAGAACATTATTCCCGCCACCGTTGAGCTGGGCGGCAAGTCGCCAAATATCTATTTTGCC

[0121] GATGTGATGGACGGAGAAGAAGAGTTTATCGAGAAGGCGGTGGAGGGGCTGGTGCTGGGCTTCTTCA

[0122] ACCAGGGCGAAGTATGTACCTGCCCATCGCGCGCCCTGATCCATGAATCCATCTACGAGCCGTTTATGG

[0123] AGCGAGTGATGGCGAAGGTGGCCCAGATTCGCCGCGGCGATCCCTTTGATACCGACACCATGATCGGG

[0124] GCACAGGCATCACGCCAGCAGTTCGATAAGATCCTGTCGTACATTAAGATTGCCCGCGAAGAGGGGGG

[0125] GCAGATCCTGACCGGCGGAGAACGCGCCAGTATTACGGCTGAACTGGATAATGGTTACTACATTCAGC

[0126] CAACTCTGATTAAGGGGCGCAATGATATGCGCAGCTTCCAGGAAGAGATTTTTGGCCCGGTCATCGGC

[0127] GTCACGACCTTCAAAGATGAGGCAGAAGCGCTGGAAATAGCCAACCAGACTCAGTTTGGGCTCGGCGC

[0128] CGGCGTCTGGACCCGCGACAGCAATCTGGCGTACCGAATGGGGCGTGGGATTAAAGCCGGTCGTGTCT

[0129] GGACCAACTGTTATCACGTCTACCCGGCCCATGCCGCGTTTGGCGGCTATAAACAGTCAGGCGTCGGTC

[0130] GTGAAACTCATAAAATGGCCCTTGATGCCTATCAACAGACGAAAAACCTGCTGGTGAGCTACGGTACC

[0131] GCGCCGTTAGGACTGTTTTAA

[0132] SEQ ID Nr. 8:

[0133] M RYAHPGTPGALVSFKSAYGNYIDGQFVEPLGGEYFM NTSPVDGSDIAQFPRSDAKDIDFALDAAHRAAEA

[0134] WGKTSVQHRSNLLLQVADRIQENLEYLAIAESWDNGKPVRETLNADLPLAVDHFRYFAGCLRAQEGSTAEI

[0135] DETTVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGNCVVLKPAEQTPLSITLLLEIIGDLFPPGVLNV

[0136] VQGFGKEAGEALATSKRIAKIAFTGSTPVGRHILACAAENIIPATVELGGKSPNIYFADVMDGEEEFIEKAVEG LVLGFFNQGEVCTCPSRALIHESIYEPFMERVMAKVAQIRRGDPFDTDTMIGAQASRQQFDKILSYIKIAREE

[0137] GGQILTGGERASITAELDNGYYIQPTLIKGRNDMRSFQEEIFGPVIGVTTFKDEAEALEIANQTQFGLGAGVW

[0138] TRDSNLAYRMGRGIKAGRVWTNCYHVYPAHAAFGGYKQSGVGRETHKMALDAYQQTKNLLVSYGTAPLG LF

[0139] SEQ ID Nr. 9:

[0140] ATGATCGAACAAAAAATGCTGATCGCCGGCCAGGAATGTGCAGCCGGCAATGGCGCAACGTTTGAGC

[0141] GCAAGAATCCGCTGGATGGATCCGTCGCCACACGCGCCCCGGCAGCCACGACCGAGGATGCGATTCGC

[0142] GCCTGCGACGCTGCTGCAGCCGCCTTCCCCGCCTGGTCGCAACTGGGGCCGAACGCCCGCCGCGCCAT

[0143] GCTGATGAAGGCCTCGCAGGCACTGGAAGCCAAGGGCGAAGCGATTGCTGCGGCCATGGCTGCCGAG

[0144] ACCGGCGCCTCGGGCATCTGGGCCGGCTTCAACGTGCATCTGGCCGCCAGCATGCTGCTGGAGGCGGC

[0145] TTCGCTGACCACGCAGATCAATGGCGAGATCATTCCCTCCGACGTACCCGGCAGCGTGGCCATGGCCGT

[0146] GCGCCAGCCCGCCGGCGTGGTACTCGGTATCGCGCCCTGGAATGCTCCCGTGATCCTGGCCGTGCGCA

[0147] GCATCTCCACGGCCCTGGCCTGCGGCAACACCGTGATTCTCAAGGGCTCGGAACTCTGCCCCGCCACCC

[0148] ACGGCCTGATCATCGAGGCACTGCAGGACGCAGGCCTGCCCGCCGGCGTGGTGAACTTTGTGACCAAT

[0149] GCGCCCGCCGATGCGGGCAGCGTGGTCGAAGCCATCGTGGCCCACCCGGCCGTGCGCCGCGTGAGCT

[0150] TTACCGGCTCCACCAAGGTGGGCCGCATCATCGGCCAGACCTGCGCCAGGCACTTGAAGCCTGCGCTG

[0151] CTGGAGCTTGGCGGCAAGGCCCCCTTCCTGGTGCTCGACGATGCCGATATCGATGCGGCCGTGAACGC

[0152] CGCCACCTTTGGCGCGTTTGCCAACTCGGGCCAGATCTGCATGTCTACCGAGCGCTTTGTGGTGGATAA

[0153] CAAGGTGGCCGACGAGTTCATCGCCAAGTTTGCCGCCAAGGCCAGCAGCCTGCCGCTGGGCGACCGCGC

[0154] GCAAGGGCCCCGTGGTGCTGGGCTCGGTCGTCGATCTGGCTACGGTGGAGCGCTGCAATGCCATGATC

[0155] GACGACGCGCTGGCCAAGGGCGCAAAAATCGCTGCGGCGGCAAGGCCGAGAGCACGCTGATGCCCG

[0156] CCACGCTGATCGACCATGTGACGCCGGCGATGCGCATATTCCACGAGGAGACCTTTTGGCCCGGTCAAA

[0157] GGCATCGTGCGCGTGAACGGCGAGGAAGAAGCCATTGCCACGGCCAATGACAACGAGTTCGGTCTGT

[0158] CCTCCGCAGTCTTCACCCGGGACACGGCCCGCGGCTGGCGTGTGGCGGCACGCATCGAGGCCGGCATC

[0159] TGCCACATCAACGGCCCCACGGTGCATGACGAAGCCCAGATGCCGTTTGGTGGCGTCAAGGCCTCGGG

[0160] CTATGGCCATTTCGGGGGCCAGCAGGGCATCAATGCCTTTACCGAAACCCGCTGGGTGACCATGCAGA CCGCAGAACGCCACTATCCGTTCTAA

[0161] SEQ ID No. 10:

[0162] M IEQKMLIAGQECAAGNGATFERKNPLDGSVATRAPAATTEDAIRACDAAAAAPPAWSQLGPNARRAML

[0163] M KASQALEAKGEAIAAMAAETGASGIWAGFNVHLAASMLLEAASLTTQINGEIPSDVPGSVAMAVRQP

[0164] AGVVLGIAPWNAPVILAVRSISTALACGNTVILKGSELCPATHGLIIEALQDAGLPAGVVNFVTNAPADAGSV

[0165] VEAIVAHPAVRRVSFTGSTKVGRIIGQ.TCARHLKPALLELGGKAPFLVLDDADIDAAVNAATFGAFANSGQIC MSTERFVVDNKVADEFIAKFAAKASSLPLGDPRKGPVVLGSVVDLATVERCNAM IDDALAKGAKIVCGGKA

[0166] ESTLM PATLIDHVTPAM RIFHEETFGPVKGIVRVNGEEEAIATANDNEFGLSSAVFTRDTARGWRVAARIEA GICHINGPTVHDEAQM PFGGVKASGYGHFGGQQGINAFTETRWVTMQTAERHYPF

[0167] SE ID Nr. 11:

[0168] ATGACTGTCTACGCAAATCCAGGAACCGAAGGCTCGATCGTTAACTATGAAAAGCGCTACGAGAACTA

[0169] CATTGGTGGCAAGTGGGTTCCACCGGTAGAGGGCCAGTACCTTGAGAACATTTCACCTGTCACTGGTG

[0170] AAGTTTTCTGTGAGGTCGCACGTGGCACCGCAGCGGACGTGGAGCTTGCACTGGATGCTGCACATGCA

[0171] GCCGCTGATGCGTGGGGCAAGACTTCTGTCGCTGAACGTGCTCTGATCCTGCACCGCATTGCGGACCG

[0172] CATGGAAGAGCACCTGGAAGAAATCGCAGTTGCAGAAACCTGGGAGAACGGCAAGGCAGTCCGTGAG

[0173] ACTCTTGCTGCAGATATCCCACTGGCAATCGACCACTTCCGCTACTTTGCTGGCGCGATCCGTGCTCAGG

[0174] AAGATCGTTCCTCACAGATCGACCACAACACTGTTGCTTACCACTTCAACGAGCCAATCGGTGTTGTTG

[0175] GTCAGATCATTCCTTGGAACTTCCCAATCCTCATGGCTACCTGGAAGCTCGCACCGGCACTTGCTGCAG

[0176] GTAACGCGATCGTCATGAAGCCAGCTGAGCAGACCCCAGCATCCATTTTGTATCTGATTAACATCATCG

[0177] GCGATCTCATCCCAGAGGGCGTCCTCAACATCGTCAACGGACTCGGCGGTGAAGCAGGCGCTGCACTG

[0178] TCCGGCTCTAATCGGATTGGCAAGATTGCTTTCACCGGTTCCACCGAGGTCGGCAAGCTGATCAACCGC

[0179] GCTGCATCCGACAAGATCATTCCTGTCACCCTGGAGCTCGGCGGTAAGTCCCCATCCATCTTCTTCTCCG

[0180] ATGTTCTGTCACAGGATGACGCCTTCGCAGAGAAGGCAGTTGAAGGCTTCGCGATGTTCGCCCTCAATC

[0181] AGGGTGAAGTTTGTACCTGTCCTTCCCGTGCACTTGTTCATGAGTCCATCGCTGATGAATTCCTCGAGCT

[0182] TGGCGTGAAGCGAGTTCAGAACATCAAGCTGGGTAACCCACTTGATACTGAAACCATGATGGGTGCTC

[0183] AGGCGTCCCAGGAGCAGATGGACAAGATCTCCTCCTACCTGAAGATCGGCCCAGAAGAAGGCGCTCAA

[0184] ACCCTCACTGGTGGCAAGGTCAACAAGGTTGATGGCATGGAGAACGGTTACTACATTGAGCCAACCGT

[0185] TTTCCGCGGCACCAACGACATGAGGATCTTCCGCGAGGAAATCTTCGGACCAGTCCTTTCTGTTGCTAC

[0186] CTTCAGCGACTTCGATGAGGCCATCCGTATTGCAAACGACACCAACTACGGCCTCGGCGCTGGTGTCTG

[0187] GAGCCGTGACCAAAACACCATTTATCGTGCAGGTCGCGCAATCCAGGCTGGTCGAGTTTGGGTCAACC

[0188] AGTACCACAACTACCCAGCGCACTCCGCTTTCGGTGGATACAAGGAGTCCGGCATCGGCCGTGAGAAC

[0189] CACCTCATGATGCTGAACCACTACCAGCAGACCAAGAACCTGTTGGTCTCCTACGATCCAAACCCAACC GGACTGTTCTAA

[0190] SEQ ID Nr. 12:

[0191] MTVYANPGTEGSIVNYEKRYENYIGGKWVPPVEGQYLENISPVTGEVFCEVARGTAADVELALDAAHAAAD

[0192] AWGKTSVAERALILHRIADRM EEHLEEIAVAETWENGKAVRETLAADIPLAIDHFRYFAGAIRAQEDRSSQID

[0193] HNTVAYHFNEPIGVVGQIIPWNFPILMATWKLAPALAAGNAIVM KPAEQTPASILYLINIIGDLIPEGVLNIVN

[0194] GLGGEAGAALSGSNRIGKIAFTGSTEVGKLINRAASDKIIPVTLELGGKSPSIFFSDVLSQDDAFAEKAVEGFA 33820-WQ 12

[0195] M FALNQGEVCTCPSRALVHESIADEFLELGVKRVQNIKLGNPLDTETMIVIGAQASQEQIVI DKISSYLKIGPEE GAQTLTGGKVNKVDGMENGYYIEPTVFRGTNDM RIFREEIFGPVLSVATFSDFDEAIRIANDTNYGLGAGV WSRDQNTIYRAGRAIQAGRVWVNQYHNYPAHSAFGGYKESGIGRENHLMIVILNHYQQTKNLLVSYDPNP TGLF

[0196] The NAD(P) listed here + -dependent aldehyde dehydrogenases preferably comprise an amino acid sequence having an identity to SEQ ID No. 2, SEQ ID No. 4, SEQ ID No. 6, SEQ ID No. 8, SEQ ID No. 10 or SEQ ID No. 12 of at least 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98%, more preferably 99%, and in particular 100%.

[0197] Alternatively, the NAD(P) include +-dependent aldehyde dehydrogenases preferably comprise an amino acid sequence encoded by a nucleic acid exhibiting at least 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98%, more preferably 99%, and particularly 100%, identity to SEQ ID No. 1, SEQ ID No. 3, SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9, or SEQ ID No. 11, more preferably 90%, more preferably 95%, more preferably 98%, more preferably 99%, and in particular 100%. The nucleic acid comprising the NAD(P) according to the invention is particularly preferably + -dependent aldehyde dehydrogenase encodes the nucleic acid sequence SEQ ID No. 1, SEQ ID No. 3, SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9 or SEQ ID No. 11 or consists of this.

[0198] The term "identity," as used here, refers to the percentage of identical nucleotide or amino acid matches between at least two nucleotide or amino acid sequences aligned using a standardized algorithm. Such an algorithm can, in a standardized and reproducible manner, introduce gaps into the compared sequences to optimize the alignment between two sequences and thus achieve a more meaningful comparison of the two sequences.

[0199] The percentage identity between sequences can be determined using one or more computer algorithms or programs known in the prior art or described herein. According to the invention, the Basic Local Alignment Search Tool (BLAST) (Altschul et al., 1990), provided by the National Center for Biotechnology Information (NCBI), is used to determine the identity. The BLAST software suite includes various programs, including a tool called "BLAST 2 Sequences," which is used for the direct pairwise comparison of two nucleotide or amino acid sequences. "BLAST 2 Sequences" can also be accessed and used interactively via the NCBI World Wide Web. The blastn program (for nucleotide sequences) uses a word length (W) of 11 and an expectation (E) of 33820-WQ 13 as parameters.

[0200] 10, M = 5, N = -4 and a comparison of both strands. For amino acid sequences, the blastp program uses as specifications a word length of 3 and an expectation (E) of 10 and the BLOSUM62 scoring matrix (Henikoff & Henikoff, 1989), alignments (B) of 50, expectation (E) of 10, M = 5, N = -4.

[0201] Alternatively, the NAD(P) include +-dependent aldehyde dehydrogenases preferably bind an amino acid sequence encoded by a nucleic acid that, under stringent conditions, binds to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 1, SEQ ID No. 3, SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9, or SEQ ID No. 11. As used herein, the stringent conditions refer to conditions under which so-called specific hybrids, but not non-specific hybrids, are formed. For example, the stringent conditions include hybridization in 6xSSC (sodium chloride / sodium citrate) at 45 °C and then washing with 0.2 to 1xSSC, 0.1% SDS at 50 to 65 °C; or such conditions may include hybridization in 1xSSC at 65 to 70 °C and then washing with 0.3xSSC at 65 to 70 °C. Hybridization can be carried out using conventionally known methods, such as those described by J. Sambrook et al. in Molecular Cloning, A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory (1989), are described, are carried out.

[0202] Furthermore, the use of a NAD(P) is revealed. + -dependent aldehyde dehydrogenase, whereby the NAD(P) + The α-dependent aldehyde dehydrogenase comprises an amino acid sequence selected from the group consisting of: i) an amino acid sequence exhibiting at least 80% identity with SEQ ID No. 2, SEQ ID No. 4, SEQ ID No. 6, SEQ ID No. 8, SEQ ID No. 10, or SEQ ID No. 12; ii) an amino acid sequence encoded by a nucleic acid exhibiting at least 80% identity with SEQ ID No. 1, SEQ ID No. 3, SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9, or SEQ ID No. 11; and iii) an amino acid sequence encoded by a nucleic acid that, under stringent conditions, is attached to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 1, SEQ ID No. 3, SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9, or SEQ ID No. 11 binds.

[0203] When a ketone is used as a co-substrate, the enzymatic oxidation of NAD(P)H to NAD(P) + preferably accomplished by means of an NAD(P)H-dependent alcohol dehydrogenase (EC 1.1.1.1 or EC 1.1.1.2).

[0204] The NAD(P)H-dependent alcohol dehydrogenase for the enzymatic oxidation of NAD(P)H by

[0205] Formation of an alcohol from a ketone or aldehyde comprises or preferably consists of an amino acid sequence selected from the group consisting of: 33820-WQ 14 i) an amino acid sequence having an identity to SEQ ID No. 14 of at least 80%, ii) an amino acid sequence encoded by a nucleic acid having an identity to SEQ ID No. 13 of at least 80%, and iii) an amino acid sequence encoded by a nucleic acid which binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 13.

[0206] SEQ ID No. 13:

[0207] ATGAAAGCTGCAGTTGTGGAACAATTTAAAAAGCCGTTACAAGTGAAAGAAGTGGAAAAACCTAAGAT CTCAT ACGGGGAAGTATTAGTGCGCATCAAAGCGTGTGGGGTATGCCATACAGACTTGCATGCCGCAC ATGGCGACTGGCCTGTAAAGCCTAAACTGCCTCTCATTCCTGGCCATGAAGGCGTCGGTGTAATTGAAG AAGTAGGTCCTGGGGTAACACATTTAAAAGTTGGAGATCGCGTAGGTATCCCTTGGCTTTATTCGGCGT GCGGTCATTGTGACTATTGCTTAAGCGGACAAGAAACATTATGCGAACGTCAACAAAACGCTGGCTATT CCGTCGATGGTGGTTATGCTGAATATTGCCGTGCTGCAGCCGATTATGTCGTAAAAATTCCTGATAACTT ATCGTTTGAAGAAGCCGCTCCAATCTTTTGCGCTGGTGTAACAACATATAAAGCGCTCAAAGTAACAGG CGCAAAACCAGGTGAATGGGTAGCCATTTACGGTATCGGCGGGCTTGGACATGTCGCAGTCCAATACG CAAAGGCGATGGGGTTAAACGTCGTTGCTGTCGATTTAGGTGATGAAAAACTTGAGCTTGCTAAACAA CTTGGTGCAGATCTTGTCGTCAATCCGAAACATGATGATGCAGCACAATGGATAAAAGAAAAAGTGGG CGGTGTGCATGCGACTGTCGTCACAGCTGTTTCAAAAGCCGCGTTCGAATCAGCCTACAAATCCATTCG TCGCGGTGGTGCTTGCGTACTCGTCGGATTACCGCCGGAAGAAATACCTATTCCAATTTTCGATACAGT ATTAAATGGAGTAAAAATTATTGGTTCTATCGTTGGTACGCGCAAAGACTTACAAGAGGCACTTCAATT TGCAGCAGAAGGAAAAGTAAAAACAATTGTCGAAGTGCAACCGCTTGAAAACATTAACGACGTATTCGATCGTATGTTAAAAGGGCAAATTAACGGCCGCGTCGTGTTAAAAGTAGATTAA

[0208] SEQ ID No. 14:

[0209] M KAAVVEQFKKPLQVKEVEKPKISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPGHEGVGVIEEVG PGVTHLKVGDRVGIPWLYSACGHCDYCLSGQETLCERQQNAGYSVDGGYAEYCRAAADYWKIPDNLSFEE AAPIFCAGVTTYKALKVTGAKPGEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDLGDEKLELAKQLGADLV VNPKHDDAAQWIKEKVGGVHATVVTAVSKAAFESAYKSIRRGGACVLVGLPPEEIPIPIFDTVLNGVKIIGSIV GTRKDLQEALQFAAEGKVKTIVEVQPLENINDVFDRMLKGQINGRVVLKVD

[0210] The alcohol dehydrogenase mentioned here preferably comprises an amino acid sequence having an identity to SEQ ID No. 14 of at least 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98%, more preferably 99%, and in particular 100%.

[0211] Alternatively, alcohol dehydrogenase preferably comprises an amino acid sequence encoded by a nucleic acid exhibiting at least 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98%, more preferably 99%, and particularly 100% identity with SEQ ID No. 13. Most preferably, the nucleic acid encoding the alcohol dehydrogenase according to the invention comprises or consists of the nucleic acid sequence SEQ ID No. 13.

[0212] Alternatively, the alcohol dehydrogenase preferably comprises an amino acid sequence encoded by a nucleic acid that binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 13. As used herein, the stringent conditions refer to conditions under which so-called specific hybrids, but not non-specific hybrids, are formed. For example, the stringent conditions include hybridization in 6xSSC (sodium chloride / sodium citrate) at 45 °C and then washing with 0.2 to 1xSSC, 0.1% SDS at 50 to 65 °C; or such conditions may include hybridization in 1xSSC at 65 to 70 °C and then washing with 0.3xSSC at 65 to 70 °C. The hybridization may be carried out by conventionally known methods, such as those described by J. Sambrook et al. The procedures described in Molecular Cloning, A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory (1989) are carried out.

[0213] Disclosed is the use of an NAD(P)H-dependent alcohol dehydrogenase for the enzymatic oxidation of NAD(P)H by formation of an alcohol from a ketone or aldehyde, wherein the alcohol dehydrogenase comprises an amino acid sequence selected from the group consisting of: i) an amino acid sequence having an identity to SEQ ID No. 14 of at least 80%, ii) an amino acid sequence encoded by a nucleic acid having an identity to SEQ ID No. 13 of at least 80%, and iii) an amino acid sequence encoded by a nucleic acid which binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 13.

[0214] 2-propanol, which is produced from acetone during cofactor regeneration, can be found, for example, in a

[0215] Thin-film evaporators are separated and acetone is separated by distillation. This is based on 33820-WQ 16

[0216] The 2-propanol obtained in this way can subsequently be used as a co-substrate for cofactor regeneration in enzymatic reductions, and acetone can be returned to the reaction vessel for further cofactor regeneration.

[0217] When D-fructose is used as a co-substrate, the enzymatic oxidation of NAD(P)H to NAD(P) + preferably accomplished by means of xylitol dehydrogenase (XDH; EC 1.1.1.9) or a sorbitol dehydrogenase (EC 1.1.1.14, EC 1.1.1.15), the former being particularly preferred.

[0218] The xylitol dehydrogenase for the enzymatic oxidation of NAD(P)H by formation of D-sorbitol from D-fructose comprises or consists of an amino acid sequence selected from the group consisting of: i) an amino acid sequence having at least 80% identity with SEQ ID No. 16, ii) an amino acid sequence encoded by a nucleic acid having at least 80% identity with SEQ ID No. 15, and iii) an amino acid sequence encoded by a nucleic acid that binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 15.

[0219] SEQ ID No. 15:

[0220] ATGAGCACACCGGAAAATCTGAGCTTTGTGCTGCAGAAACCGTTTGATGTGAAATTTGAAGATCGTCCGA TTCCGAAACTGAGCGATCCGTATAGCGTTAAAATTCAGGTGAAAAAAACCGGCATTTGCGGTAGTGATGT TCACTATTTCACCCATGGTGCAATTGGTGATTTTGTTGTTAAAGCACCGATGGTTCTGGGTCATGAAAGCA GCGGTGTTGTTCTGGAAGTTGGTAGCGAAGTTAAAAGCCTGAAAGTTGGTGATCGTGTTGCAATGGAAC CGGGTGTTCCGAGCCGTCATAGTGATGAGTATAAAAGCGGTCGTTATAATCTGTGTCCGCACATGGCATT TGCAGCAACCCCTCCGTATGATGGCACCCTGTGTAAATACTATATTCTGCCGGAAGATTTCTGCGTTAAAC TGCCGGAACATGTTAGCCTGGAAGAAGGTGCACTGGTTGAACCGCTGAGCGTTGCAGTTCATAGCAGCA AACTGGGTAACATTAAACCGGGTAGCCATGTTGCAATTTATGGTGCAGGTCCGGTTGGTCTGCTGGTTGC AGCAGTTGCAAGCGCATTTGGTGCAGAAAGCGTTACCATTATTGATCTGGTTGAAAGCCGTCTGAATCTG GCAAAAGAACTGGGTGCAACCGCAACCGTTCAGGTTGATTTTAAAGATACCCCGAAAGAAAGCGCAGCA AAAGTTGTTGCAGCAAATAATGGCATTGCACCGGATGTTGTTATTGATGCAAGCGGTGCAGAAGCAAGC ATTAATTCAGCCATTAATGCAATTCGTCCGGGTGGCACCTATGTTCAGGTGGGTATGGGTAAACCGGATG TGAGCTTTCCGATTGCAACCCTGATTGGTAAAGAACTGACCGTTAAAGGTAGCTTTCGTTATGGTTATGGT GATTATCCGCTGGCAGTTAGCCTGCTGGCAAGCGGTAAAGTTAATGTGAAAAAACTGATCACCCATGAA 33820-WQ17

[0221] GTGAAATTCGAGGATGCAGCAGAAGCATTTCAGCTGGTTCGTGATGGTAAAGCCATTAAATGTATTATCA ACGGTCCGGAATAA

[0222] SEQ ID No. 16:

[0223] MSTPENLSFVLQKPFDVKFEDRPIPKLSDPYSVKIQVKKTGICGSDVHYFTHGAIGDFVVKAPMVLGHESSGVV LEVGSEVKSLKVGDRVAMEPGVPSRHSDEYKSGRYNLCPHMAFAATPPYDGTLCKYYILPEDFCVKLPEHVSLE EGALVEPLSVAVHSSKLGNIKPGSHVAIYGAGPVGLLV AAVASAFGAESVTIIDLVESRLNLAKELGATATVQVD FKDTPKESAAKVVAANNGIAPDVVIDASGAEASINSAINAIRPGGTYVQVGMGKPDVSFPIATLIGKELTVKGS FRYGYGDYPLAVSLLASGKVNVKKLITHEVKFEDAAEAFQLVRDGKAIKCIINGPE

[0224] The xylitol dehydrogenase mentioned here preferably comprises an amino acid sequence having an identity to SEQ ID No. 16 of at least 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98%, more preferably 99%, and in particular 100%.

[0225] Alternatively, the xylitol dehydrogenase preferably comprises an amino acid sequence encoded by a nucleic acid exhibiting at least 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98%, more preferably 99%, and particularly 100% identity with SEQ ID No. 15. Most preferably, the nucleic acid encoding the xylitol dehydrogenase according to the invention comprises or consists of the nucleic acid sequence SEQ ID No. 15.

[0226] Alternatively, the xylitol dehydrogenase preferably comprises an amino acid sequence encoded by a nucleic acid that binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 15. As used herein, the stringent conditions refer to conditions under which so-called specific hybrids, but not non-specific hybrids, are formed. For example, the stringent conditions include hybridization in 6xSSC (sodium chloride / sodium citrate) at 45 °C and then washing with 0.2 to 1xSSC, 0.1% SDS at 50 to 65 °C; or such conditions may include hybridization in 1xSSC at 65 to 70 °C and then washing with 0.3xSSC at 65 to 70 °C. The hybridization may be carried out by conventionally known methods, such as those described by J. Sambrook et al. The procedures described in Molecular Cloning, A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory (1989), are performed. 33820-WQ 18

[0227] Disclosed is the use of a xylitol dehydrogenase for the enzymatic oxidation of NAD(P)H by formation of D-sorbitol from D-fructose, wherein the xylitol dehydrogenase comprises an amino acid sequence selected from the group consisting of: i) an amino acid sequence having an identity to SEQ ID No. 16 of at least 80%, ii) an amino acid sequence encoded by a nucleic acid having an identity to SEQ ID No. 15 of at least 80%, and iii) an amino acid sequence encoded by a nucleic acid which binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 15.

[0228] In a further preferred embodiment of the method according to the invention, the concentration of HMF in the aqueous solution is 15 - 130 g / l.

[0229] The particularly preferred temperature range is between 18 and 40 °C.

[0230] The particularly preferred pH range for the reaction is between pH 6 and pH 9.

[0231] In a further preferred variant of the process according to the invention, the enzymes are present in a suspension, in the homogenate and / or in the lysate of the corresponding cells producing them, with lysates being particularly preferred.

[0232] In this context, suspension refers to a suspension of resting cells. These are harvested after cultivation (separated from the nutrient medium) and suspended in a suitable buffer system. Unlike fermentative processes, which also utilize whole cells, the resting cells, due to the removal of carbon sources and nutrients, can no longer grow and serve only for substrate conversion (Lin & Tao, 2017). Homogenate, in this context, refers to a physically and / or chemically treated suspension (e.g., treated with pressure, lysozyme, or ultrasound) in which the cell components are released from the cells. A lysate is obtained when the insoluble cell components of the homogenate are removed, for example, by filtration or centrifugation (see Enzyme Production & Lysate Preparation for details).

[0233] In another variant, the enzymes can be modified at the N-terminus with a water-soluble polymer such as polyethylene glycol, immobilized in or on a solid matrix, or be part of a fusion protein. In yet another variant, the enzymes can be in powder form, lyophilized, or spray-dried form.

[0234] The following examples describe preferred embodiments of the invention in more detail.

[0235] materials

[0236] 5-(Hydroxymethyl)furfural (HMF) was developed by Biosynth, 5-formyl-2-furancarboxylic acid (FFA) and 2,5-furandicarboxylic acid (FDCA) were developed by TCI, 2,5-diformylfuran (DFF) and 5-hydroxymethyl-2-furancarboxylic acid (HMFA) were developed by Sigma-Aldrich, acetone, potassium dihydrogen phosphate, dipotassium hydrogen phosphate and sodium dodecyl sulfate (SDS) were developed by Carl Roth, NAD + , NADH disodium salt, NADP +-Disodium salt, NADPH tetrasodium salt and acetonitrile were sourced from PanReac AppliChem (ITW Reagents) and triethanolamine was sourced from Chem-Lab NV.

[0237] Production of enzymes & production of lysates

[0238] General information on the expression of recombinant enzymes in E. coli

[0239] For recombinant enzyme production in an Escherichia co / / strain, the gene to be expressed was first amplified in PCR using genomic DNA or its synthetically adapted equivalent (adapted to the codon usage of E. coli) as a template, along with specific oligonucleotides that additionally carry recognition sequences for restriction endonucleases. The resulting DNA was then isolated from the reaction mixture. After nucleic acid digestion with the restriction enzymes Sphl and Hind II I, the gene fragment encoding the target enzyme was ligated into the Sphl-Hind II I backbone of the expression vector pQE70-Kan. The ligation product was transformed into chemically competent E. co / / cells (ToplOF'), and the resulting colonies were used for plasmid isolation and restriction analysis.

[0240] The result of the cloning step was verified by restriction enzyme digestion and DNA sequencing. The resulting construct carries the target gene under the IPTG-inducible T5 promoter.

[0241] For the overexpression of the enzyme in E. coli, the resulting expression plasmid was transformed into competent expression cells RB791. After 24 h incubation at 37 °C, the resulting colonies were inoculated into LB medium for expression assays.

[0242] The following day, expression cultures with an optical density (OD550) of 0.02 were inoculated and shaken at 37 °C until an OD550 of 0.3 was reached. The temperature was then lowered to 25 °C, and the cultures were induced with 0.1 mM IPTG when an OD550 of 0.5 was reached. After 22 h, the cultures were harvested (separated from the medium by centrifugation into a cell pellet) and analyzed for the expression of the recombinant enzyme using SDS-gel electrophoresis and activity determination (for use in a use test or optical zymatic assay).

[0243] Production of cell lysates using Sonifier digestion

[0244] To prepare a cell suspension, the cell pellet produced according to the above procedure was weighed into a suitable container and mixed with buffer and lysozyme (final concentration 0.5 mg / ml) (e.g., potassium phosphate buffer) and dissolved with stirring. The biomass fraction is typically 20% by mass, the remainder being the buffer.

[0245] A Branson Sonifier 450 was used for cell disruption. The suspension was treated three times with 15 ultrasonic pulses each (device settings: Timer = 15; Duty Cycle = 50; Output Control = 3-5).

[0246] The resulting homogenate was centrifuged for 10 min at 4 °C and 16000 rpm (Eppendorf centrifuge 5417R) to separate the insoluble cell fragments and obtain the lysate.

[0247] Table 1. Enzyme types and donor organisms for the enzymes used in the examples (ALDH = aldehyde dehydrogenase).

[0248] * Note: In the NCBI Protein Database, HMF oxidase from P. nitroreducens is classified as glucose-methanol-choline (GMC) oxidoreductase, which as a superfamily also includes the HMF oxidases (Vihambres et al., 2020).

[0249] Analytical methods

[0250] High Performance Liquid Chromatography (HPLC)

[0251] High-performance liquid chromatography (HPLC) was used to quantify HMF, DFF, HMFA, FFA, and FDCA. Detection was performed using a UV detector. A Phenomenex Rezex ROA organic acid H+ (8%) column with a suitable guard column was used for the measurement and isocratically eluted with 1 mM sulfuric acid.

[0252] Determination of enzyme activities (optical-enzymatic assay)

[0253] Enzyme activities in the lysates were determined using a Shimadzu UV-1900 spectrophotometer. The formation or consumption of NAD(P)H was monitored at a wavelength of 340 nm by measuring changes in absorption. The measurements were performed with 0.2 mM cofactor (NAD(P)H). + or NAD(P)H). For this purpose, 20 µl of a 10 mM stock solution of the cofactor were placed in a cuvette (Greiner bio-one semi-micro cuvette made of polystyrene), and the desired pH was adjusted with 100 mM TEA-HCl buffer (870 µl). 10 µl of lysate (diluted or undiluted) and 100 µl of substrate solution were added to the cuvette, and the measurement was started immediately thereafter. The measurements were carried out at 25 °C as standard. The extinction coefficient of NADH / NADPH at 340 nm (E = 6220 L mol) was used. 1 cm 1The enzyme activity of the lysate can be determined in U / ml (based on the volume of the lysate) or U / g (based on the biomass used for production). 1 U represents 1 pmol of substrate conversion per minute (1 U = 1 pmol / min = 1.67-10⁻¹⁰ m). 8 cat).

[0254] The following examples describe preferred variants of the process according to the invention in more detail. The lysates used in these examples were produced according to the processes described above.

[0255] Example 1

[0256] Oxidation of 5-hydroxymethylfurfural to 5-hydroxymethyl-2-furancarboxylic acid

[0257] The reaction was carried out in a Labfors benchtop bioreactor (Infors AG). A glass reactor (volume 3.4 L) with an attached stirrer, Cc sensor, and pH electrode was used. pH control was achieved by adding 5 M NaOH or 5 M H2SO4.

[0258] The reactor contained 178.7 ml of deionized water and 15 ml of a 10 mM NAD+ solution. + -Solution, 200 ml of a 500 mM potassium phosphate buffer (pH 7), 50 ml ALDH I lysate, 20 ml ADH lysate, and 15 ml acetone were mixed with stirring and heated to 35 °C. To initiate the reaction, 20.5 g of HMF (approx. 80% purity) were added.

[0259] Additionally, an overpressure of 320 mbar was applied and the oxygen supply (via a Sparger) was set to 0.05 l / min.

[0260] For analysis, 50 µl of the reaction mixture was mixed with 200 µl of acetonitrile and incubated in an Eppendorf Thermomixer at 85 °C and 1200 rpm for 15 min. The sample was briefly centrifuged, mixed with 750 µl of deionized water, vortexed, and then centrifuged for 5 min at max. g. 250 µl of the supernatant were diluted in an HPLC vial with 750 µl of an acetonitrile / water mixture (1 / 4 v / v) and analyzed by HPLC (UV detection).

[0261] In this way, >99% of the substrate HMF could be oxidized to HMFA in a total of 3 h.

[0262] Example 2: Oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid via 5-hydroxymethyl-2-furancarboxylic acid

[0263] The reaction was carried out in a Labfors benchtop bioreactor (Infors AG). A glass reactor (volume 3.4 L) with an attached stirrer, oz sensor, and pH electrode was used. pH control was achieved by adding 5 M NaOH or 1 M H₂SO₄.

[0264] The reactor contained 178.7 ml of deionized water and 15 ml of a 10 mM NAD+ solution. + -Solution, 200 ml of a 500 mM potassium phosphate buffer (pH 7), 50 ml ALDH I lysate, 20 ml ADH lysate, and 15 ml acetone were mixed with stirring and heated to 35 °C. To initiate the reaction, 20.5 g of HMF (approx. 80% purity) were added.

[0265] Additionally, an overpressure of 320 mbar was applied and the oxygen supply (via a Sparger) was set to 0.05 l / min.

[0266] For analysis, 50 µl of the reaction mixture was mixed with 200 µl of acetonitrile and incubated in an Eppendorf Thermomixer at 85 °C and 1200 rpm for 15 min. The sample was briefly centrifuged, mixed with 750 µl of deionized water, vortexed, and then centrifuged for 5 min at max. g. 250 µl of the supernatant were diluted in an HPLC vial with 750 µl of an acetonitrile / water mixture (1 / 4 v / v) and analyzed by HPLC (UV detection).

[0267] Within 3 hours, >99% of the substrate HMF was oxidized to HMFA.

[0268] Then 30 ml of HMFO lysate and 10 ml of catalase lysate were added.

[0269] After 6.5 h, 30 ml of HMFO lysate, 30 ml of ALDH I lysate, 10 ml of ADH lysate and 7 ml of acetone were added; after 27 h, 30 ml of HMFO lysate, 10 ml of catalase lysate and 5 ml of acetone were added; and after 28.5 h, 30 ml of ALDH I lysate and 10 ml of ADH lysate were added.

[0270] Within 36 hours, >99% of the substrate HMF was oxidized to FDCA.

[0271] Example 3

[0272] Oxidation of 5-hydroxymethylfurfural to 5-hydroxymethyl-2-furancarboxylic acid (Fed-Batch)

[0273] The reaction was carried out in a Labfors benchtop bioreactor (Infors AG). A glass reactor (volume 3.4 L) with an attached stirrer, O₂ sensor, and pH electrode was used. pH control was achieved by adding 5 M NaOH or 5 M H₂SO₄. The initial mixture consisted of 168.7 mL of deionized water, 200 mL of a 500 mM potassium phosphate buffer (pH 7), and 15 mL of a 10 mM NAD₂ solution. +-Solution, 50 ml ALDH I lysate and 30 ml alcohol dehydrogenase lysate were mixed and brought to 35 °C while stirring. To start the reaction, 20.5 g of HMF (approx. 80% purity) were added.

[0274] Additionally, an overpressure of 320 mbar was applied and the oxygen supply (via a Sparger) was set to 0.05 l / min.

[0275] For analysis, 50 µl of the reaction mixture was mixed with 200 µl of acetonitrile and incubated in an Eppendorf Thermomixer at 85 °C and 1200 rpm for 15 min. The sample was briefly centrifuged, mixed with 750 µl of deionized water, vortexed, and then centrifuged for 5 min at max. g. 200 µl of the supernatant were diluted in an HPLC vial with 800 µl of an acetonitrile / water mixture (1 / 4 v / v) and analyzed by HPLC (UV detection).

[0276] Within 2 hours, 98% of the substrate HMF was oxidized to HMFA. Therefore, after 2 hours, 20.5 g of HMF, 30 ml of alcohol dehydrogenase lysate, and 50 ml of ALDH I lysate were added. After 3 hours, 7 ml of acetone were added, and after 5 hours, another 20.5 g of HMF was added. After 6.5 hours, 15 ml of acetone was added, and after 7 hours, 50 ml of ALDH I lysate and 30 ml of alcohol dehydrogenase lysate were added.

[0277] Within 22 hours, > 99% of the substrate HMF (a total of 61.5 g) was oxidized to HMFA.

[0278] Example 4

[0279] Oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid via 5-hydroxymethyl-2-furancarboxylic acid (Fed-Batch)

[0280] The reaction was carried out in a Labfors benchtop bioreactor (Infors AG). A glass reactor (volume 3.4 L) with an attached stirrer, Cc sensor, and pH electrode was used. pH control was achieved by adding 5 M NaOH or 5 M H2SO4.

[0281] Initially, 168.7 ml of deionized water, 200 ml of a 500 mM potassium phosphate buffer (pH 7), and 15 ml of a 10 mM NAD were used. + -Solution, 50 ml ALDH I lysate and 30 ml alcohol dehydrogenase lysate were mixed and brought to 35 °C while stirring. To start the reaction, 20.5 g of HMF (approx. 80% purity) were added.

[0282] Additionally, an overpressure of 320 mbar was applied and the oxygen supply (via a sparger) was set to 0.05 l / min. For analysis, 50 pl of the reaction mixture was mixed with 200 pl of acetonitrile and incubated in an Eppendorf Thermomixer at 85 °C and 1200 rpm for 15 min. The sample was briefly centrifuged, mixed with 750 pl of deionized water, vortexed, and then centrifuged for 5 min at max. g. 200 pl of the supernatant were diluted in an HPLC vial with 800 pl of an acetonitrile / water mixture (1 / 4 v / v) and measured by HPLC (UV detection).

[0283] Within 2 hours, 98% of the substrate HMF was oxidized to HMFA. Therefore, after 2 hours, 20.5 g of HMF, 30 ml of alcohol dehydrogenase lysate, and 50 ml of ALDH I lysate were added. After 3 hours, 7 ml of acetone were added, and after 5 hours, another 20.5 g of HMF was added. After 6.5 hours, 15 ml of acetone was added, and after 7 hours, 50 ml of ALDH I lysate and 30 ml of alcohol dehydrogenase lysate were added.

[0284] Within 22 hours, > 99% of the substrate HMF (a total of 61.5 g) was oxidized to HMFA.

[0285] For further oxidation, 100 ml of HMFO lysate and 10 ml of catalase lysate were added. After 0.5 h, 15 ml of acetone were added; after 1.5 h, 50 ml of ALDH I lysate and 30 ml of alcohol dehydrogenase lysate were added; after 6 h, 15 ml of acetone were added; after 24 h, 20 ml of HMFO lysate and 7 ml of acetone were added; after 25 h, 30 ml of ALDH I lysate and 10 ml of alcohol dehydrogenase lysate were added; and after 28 h, 50 ml of HMFO lysate and 10 ml of catalase lysate were added.

[0286] Within 52 hours, >99% of the HMFA was oxidized to FDCA.

[0287] In this way, >99% of the substrate HMF (a total of 61.5 g) could be oxidized to FDCA in a total of 74 h.

[0288] The reactor contents were then heated to 70 °C for 60 minutes. The resulting precipitate was removed by centrifugation and decantation. Activated carbon (5% w / v) was added to the solution and stirred at 50 °C for 30 minutes. The activated carbon was then filtered off through Celite in a P4 glass frit. The filtrate was acidified with concentrated H₂SO₄ (pH < 2) and cooled to 4 °C. The resulting precipitate (FDCA) was filtered off.

[0289] In this way, 61 g of FDCA were obtained as a colorless solid.

[0290] Example 5

[0291] Oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid via 5-hydroxymethyl-2-furancarboxylic acid – cofactor regeneration with alcohol dehydrogenase and NADH oxidase. The reaction was carried out in a Labfors benchtop bioreactor (Infors AG). A glass reactor (volume 3.4 L) with an attached stirrer, Cmax sensor, and pH electrode was used. pH control was achieved by adding 5 M NaOH or 5 M H2SO4.

[0292] Initially, 168.7 ml of deionized water, 200 ml of a 500 mM potassium phosphate buffer (pH 7), and 15 ml of a 10 mM NAD were used. + -Solution, 50 ml ALDH I lysate and 30 ml alcohol dehydrogenase lysate were mixed and brought to 35 °C while stirring. To start the reaction, 20.5 g of HMF (approx. 80% purity) were added.

[0293] Additionally, an overpressure of 320 mbar was applied and the oxygen supply (via a Sparger) was set to 0.05 l / min.

[0294] For analysis, 50 µl of the reaction mixture was mixed with 200 µl of acetonitrile and incubated in an Eppendorf Thermomixer at 85 °C and 1200 rpm for 15 min. The sample was briefly centrifuged, mixed with 750 µl of deionized water, vortexed, and then centrifuged for 5 min at max. g. 200 µl of the supernatant were diluted in an HPLC vial with 800 µl of an acetonitrile / water mixture (1 / 4 v / v) and analyzed by HPLC (UV detection).

[0295] Within 2.5 hours, > 99% of the substrate HMF was oxidized to HMFA.

[0296] For further oxidation, 30 ml of HMFO lysate and 10 ml of catalase lysate were added. After 3.75 h, 50 ml of ALDH I lysate and 21 kU of NADH oxidase lysate were added.

[0297] Within 18 hours, 91% of the HMFA was oxidized to FDCA.

[0298] In this way, 91% of the substrate HMF could be oxidized to FDCA in a total of 20.5 h.

[0299] Example 6

[0300] Oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid via 5-hydroxymethyl-2-furancarboxylic acid - cofactor regeneration with xylitol dehydrogenase

[0301] The reaction was carried out in a Labfors benchtop bioreactor (Infors AG). A glass reactor (volume 3.4 L) with an attached stirrer, O₂ sensor, and pH electrode was used. pH control was achieved by adding 5 M NaOH or 5 M H₂SO₄.

[0302] Initially, 133.7 ml of deionized water and 200 ml of a 500 mM potassium phosphate buffer (pH 7) were used.

[0303] 15 ml of a 10 mM NAD + -Solution, 50 ml ALDH I lysate, and 30 ml xylitol dehydrogenase lysate were mixed and brought to 30 °C while stirring. To start the reaction, 20.5 g of HMF (approx. 80% purity) and 50 g of D-fructose were added.

[0304] Additionally, an overpressure of 320 mbar was applied and the oxygen supply (via a Sparger) was set to 0.05 l / min.

[0305] For analysis, 50 µl of the reaction mixture was mixed with 200 µl of acetonitrile and incubated in an Eppendorf Thermomixer at 85 °C and 1200 rpm for 15 min. The sample was briefly centrifuged, mixed with 750 µl of deionized water, vortexed, and then centrifuged for 5 min at max. g. 200 µl of the supernatant were diluted in an HPLC vial with 800 µl of an acetonitrile / water mixture (1 / 4 v / v) and analyzed by HPLC (UV detection).

[0306] Within 2.5 hours, > 99% of the substrate HMF was oxidized to HMFA.

[0307] Then, 30 ml of HMFO lysate and 10 ml of catalase lysate were added. After 4.5 hours, 25 g of D-fructose were added, and after 5.5 hours, 25 ml of ALDH I lysate and 15 ml of xylitol dehydrogenase lysate were added.

[0308] In this way, > 99% of the substrate HMF could be oxidized to FDCA in a total of 20.5 h.

[0309] literature

[0310] Carus, M., Dammer, L., Raschka, A., Skoczinski, P., & vom Berg, C. (2020). Renewable Carbon—Key to a Sustainable and Future-Oriented Chemical and Plastic Industry. https: / / renewable-carbon-initiative.com / wp-content / uploads / 2020 / 09 / 20-09-21_Paper_12-on-Renewable-Carbon. pdf

[0311] Hamilton, LA, Feit, S., Muffett, C., Kelso, M., Rubright, SM, Bernhardt, C., Schaeffer, E., Moon, D., Morris, J., & Labbe-Bellas, R. (2019). Plastic & Climate: The Hidden Costs of a Plastic Planet. https: / / www.ciel.org / wp-content / uploads / 2019 / 05 / Plastic-and-Climate-FINAL-2019.pdf

[0312] Tomäs, R. A. F., Bordado, J. C. M., & Gomes, J. F. P. (2013). p-Xylene Oxidation to Terephthalic Acid: A Literature Review Oriented toward Process Optimization and Development. Chemical Reviews, 113(10), 7421-7469. https: / / doi.org / 10.1021 / cr300298j

[0313] Berger, A. (2016). Ethylenglycol, RD-05-01999 in Böckler, F., Dill, B., Eisenbrand, G., Faupel, F., Fugmann, B., Gämse, T., Matissek, R., Pohnert, G., Rühling, A., Schmidt, S., Sprenger, G. (Ed.), RÖMPP [Online], Stuttgart, Georg Thieme Verlag. https: / / roempp.thieme.de / lexicon / RD-05-01999

[0314] Fan, D., Dai, D.-J., & Wu, H.-S. (2013). Ethylene Formation by Catalytic Dehydration of Ethanol with Industrial Considerations. Materials 6(1), 101-115. https: / / doi.org / 10.3390 / ma6010101

[0315] Salusjärvi, L., Havukainen, S., Koivistoinen, O., & Toivari, M. (2019). Biotechnological production of glycolic acid and ethylene glycol: current state and perspectives. Applied Microbiology and Biotechnology, 103, 2525-2535. https: / / doi.org / 10.1007 / s00253-019-09640-2 de Jong, E., Visser, H. A., Dias, A. S., Harvey, C., & Gruter, G.-J. M. (2022). The Road to Bring FDCA and PEF to the Market. Polymers, 14(5), 943. https: / / doi.org / 10.3390 / polyml4050943

[0316] Cong, H., Yuan, H., Tao, Z., Bao, H., Zhang, Z., Jiang, Y., Huang, D., Liu, H., & Wang, T. (2021). Recent Advances in Catalytic Conversion of Biomass to 2,5-Furandicarboxylic Acid. Catalysts, 11(9), 1113. https: / / doi.org / 10.3390 / catalll091113

[0317] Todea, A., Bftcan, I., Aparaschivei, D., Päusescu, I., Badea, V., Peter, F., Gherman, V. D., Rusu, G., Nagy, L., & Keki, S. (2019). Biodegradable Oligoesters of e-Caprolactone and 5-Hydroxymethyl-2- Furancarboxylic Acid Synthesized by Immobilized Lipases. Polymers, 11(9), 1402. https: / / doi.org / 10.3390 / polymll091402

[0318] Munekata, M., & Tamura, G. (1981). Antitumor Activity of 5-Hydroxymethyl-2-furoic Acid. Agricultural and Biological Chemistry, 45(B), 2149-2150. https: / / doi.org / 10.1080 / 00021369.1981.10864851 Kimura, Y., Tani, S., Hayashi, A., Ohtani, K., Fujioka, S., Kawano, T., & Shimada, A. (2007). Nematicidal Activity of 5-Hydroxymethyl-2-furoic Acid against Plant-Parasitic Nematodes. Zeitschrift für Naturforschung C, 62(3-4), 234-238. https: / / doi.org / 10.1515 / znc-2007-3-413

[0319] Cang, R., Shen, L.-Q., Yang, G., Zhang, Z.-D., Huang, H., & Zhang, Z.-G. (2019). Highly Selective Oxidation of 5-Hydroxymethylfurfural to 5-Hydroxymethyl-2-Furancarboxylic Acid by a Robust Whole-Cell Biocatalyst. Catalysts, 9(6), 526. https: / / doi.org / 10.3390 / catal9060526

[0320] Hossain, G. S., Yuan, H., Li, J., Shin, H., Wang, M., Du, G., Chen, J., & Liu, L. (2017). Metabolic Engineering of Raoultella ornithinolytica BF60 for Production of 2,5-Furandicarboxylic Acid from 5-Hydroxymethylfurfural. Applied and Environmental Microbiology, 83(1), e02312-16. https: / / doi.org / 10.1128 / AEM.02312-16

[0321] Qin, Y.-Z., Li, Y.-M., Zong, M.-H., Wu, H., & Li, N. (2015). Enzyme-catalyzed selective oxidation of 5-hydroxymethylfurfural (HMF) and separation of HMF and 2,5-diformylfuran using deep eutectic solvents. Green Chemistry, 17(7), 3718-3722. https: / / doi.org / 10.1039 / C5GC00788G

[0322] McKenna, S. M., Leimkühler, S., Herter, S., Turner, N. J., & Carnell, A. J. (2015). Enzyme cascade reactions: Synthesis of furandicarboxylic acid (FDCA) and carboxylic acids using oxidases in tandem. Green Chemistry, 17(6), 3271-3275. https: / / doi.org / 10.1039 / C5GC00707K

[0323] McKenna, S. M., Mines, P., Law, P., Kovacs-Schreiner, K., Birmingham, W. R., Turner, N. J., Leimkühler, S., & Carnell, A. J. (2017). The continuous oxidation of HMF to FDCA and the stabilization of periplasmic aldehyde oxidase (PaoABC). Green Chemistry, 19(19), 4660-4665. https: / / doi.org / 10.1039 / C7GC01696D

[0324] Carro, J., Ferreira, P., Rodn'guez, L., Prieto, A., Serrano, A., Balcells, B., Ardä, A., Jimenez-Barbero, J., Gutierrez, A., Ullrich, R., Hofrichter, M., & Martinez, A. T. (2015). 5-hydroxymethylfurfural conversion by fungal aryl-alcohol oxidase and unspecific peroxygenase. FEBS Journal, 282(16), 3218-3229. https: / / doi.org / 10.llll / febs.13177

[0325] Mathieu, Y., Offen, W. A., Forget, S. M., Ciano, L., Viborg, A. H., Blagova, E., Henrissat, B., Walton, P. H., Davies, G. J., & Brumer, H. (2020). Discovery of a Fungal Copper Radical Oxidase with High Catalytic Efficiency toward 5-Hydroxymethylfurfural and Benzyl Alcohols for Bioprocessing. ACS Catalysis, 10(5), 3042-3058. https: / / doi.org / 10.1021 / acscatal.9b04727

[0326] Cleveland, M., Lafond, M., Xia, F. R., Chung, R., Mulyk, P., Hein, J. E., & Brumer, H. (2021). Two Fusarium copper radical oxidases with high activity on aryl alcohols. Biotechnology for Biofuels, 14, 138. https: / / doi.org / 10.1186 / sl3068-021-01984-0 Cajnko, M. M., Novak, U., Grilc, M., & Likozar, B. (2020). Enzymatic conversion reactions of 5-hydroxymethylfurfural (HMF) to bio-based 2,5-diformylfuran (DFF) and 2,5-furandicarboxylic acid (FDCA) with air: mechanisms, pathways and synthesis selectivity. Biotechnology for Biofuels, 13, 66. https: / / doi.org / 10.1186 / sl3068-020-01705-z

[0327] Lappe, A., Jankowski, N., Albrecht, A., Koschorreck, K. (2021). Characterization of a thermotolerant aryl-alcohol oxidase from Moesziomyces antarcticus oxidizing 5-hydroxymethyl-2-furancarboxylic acid. Applied Microbiology and Biotechnology, 105, 8313-8327. https: / / doi.org / 10.1007 / s00253-021-11557- 8

[0328] Jia, H.-Y., Zong, M.-H., Yu, H.-L., & Li, N. (2017). Dehydrogenase-Catalyzed Oxidation of Furanics: Exploitation of Hemoglobin Catalytic Promiscuity. ChemSusChem, 10(18), 3524-3528. https: / / doi.org / 10.1002 / cssc.201701288

[0329] Altschul, S. F., Gish, W., Miller, W., Myers, E. W., & Lipman, D. J. (1990). Basic local alignment search tool. Journal of Molecular Biology, 215(3), 403-410. https: / / doi.org / 10.1016 / S0022-2836(05)80360-2

[0330] Henikoff, S., & Henikoff, J. G. (1992). Amino acid substitution matrices from protein blocks. Proceedings of the National Academy of Sciences of the United States of America, 89(22), 10915-10919. https: / / doi.org / 10.1073 / pnas.89.22.10915

[0331] Sambrook, J., Fritsch, E. R., & Maniatis, T. (1989). Molecular Cloning: A Laboratory Manual (2nd ed.). Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press.

[0332] Lin, B., & Tao, Y. (2017). Whole-cell biocatalysts by design. Microbial Cell Factories, 16, 106. https: / / doi.org / 10.1186 / sl2934-017-0724-7

[0333] Protein [Internet], Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information. Accession No. WP_024766379.1, aldehyde dehydrogenase family protein [Pseudomonas nitroreducens]. Verfügbar unter: https: / / www.ncbi.nlm.nih.gOv / protein / WP_024766379.l /

[0334] Protein [Internet], Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information. Accession No. WP_015829138.1, aldehyde dehydrogenase family protein [Methylovorus glucosotrophus]. Verfügbar unter: https: / / www.ncbi.nlm.nih.gOv / protein / WP_015829138.l /

[0335] Protein [Internet], Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information. Accession No. WP_169935101.1, aldehyde dehydrogenase family protein [Pseudomonas multiresinivorans]. Verfügbar unter: https: / / www.ncbi.nlm.nih.gOv / protein / WP_169935101.l Protein [Internet], Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information. Accession No. WP_004866732.1, MULTISPECIES: aldehyde dehydrogenase family protein [Raoultella], Verfügbar unter: https: / / www.ncbi.nlm.nih.gOv / protein / WP_004866732.l

[0336] Protein [Internet], Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information. Accession No. WP_003076354.1, MULTISPECIES: aldehyde dehydrogenase [Comamonas], Verfügbar unter: https: / / www.ncbi.nlm.nih.gOv / protein / WP_003076354.l

[0337] Protein [Internet], Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information. Accession No. WP_011015386.1, aldehyde dehydrogenase family protein [Corynebacterium glutamicum]. Verfügbar unter: https: / / www.ncbi.nlm.nih.gOv / protein / WP_011015386.l

[0338] Protein [Internet], Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information. Accession No. WP_024766380.1, GMC oxidoreductase [Pseudomonas nitroreducens]. Verfügbar unter: https: / / www.ncbi.nlm.nih.gOv / protein / WP_024766380.l

[0339] Sakoda, H., & Imanaka, T. (1992). Cloning and sequencing of the gene coding for alcohol dehydrogenase of Bacillus stearothermophilus and rational shift of the optimum pH. Journal of Bacteriology, 174(4), 1397-1402. https: / / doi.Org / 10.1128 / jb.174.4.1397-1402.1992

[0340] Habenicht, A., Motejadded, H., Kiess, M., Wegerer, A., & Mattes, R. (1999). Xylose Utilisation: Cloning and Characterisation of the Xylitol Dehydrogenase from Galactocandida mastotermitis. Biological Chemistry, 380(12), 1405-1411. https: / / doi.org / 10.1515 / BC.1999.180

[0341] Matsumoto, J., Higuchi, M., Shimada, M., Yamamoto, Y., & Kamio, Y. (1996). Molecular Cloning and Sequence Analysis of the Gene Encoding the HjO-forming NADH Oxidase from Streptococcus mutans.

[0342] Bioscience, Biotechnology, and Biochemistry, 60(1), 39-43. https: / / doi.org / 10.1271 / bbb.60.39

[0343] Vinambres, M., Espada, M., Martinez, A. T., & Serrano, A. (2020). Screening and Evaluation of New Hydroxymethylfurfural Oxidases for Furandicarboxylic Acid Production. Applied and Environmental Microbiology, 86(16), e00842-20. https: / / doi.org / 10.1128 / AEM.00842-20

Claims

Patent claims 1. Process for the preparation of 5-hydroxymethyl-2-furancarboxylic acid (HMFA) by treating 5-hydroxymethylfurfural (HMF), which is present in an aqueous solution, with an NAD(P) + -dependent aldehyde dehydrogenase is oxidized in vitro to form NAD(P)H to 5-hydroxymethyl-2-furancarboxylic acid (HMFA), after which the NAD(P)H produced during the oxidation is enzymatically reduced back to NAD(P) by an oxidoreductase. + regenerates and a keto compound is used as a co-substrate for the oxidoreductase.

2. The method according to claim 1, characterized in that a ketose, an aldose, or a ketone is used as the keto compound.

3. Method according to claim 2, characterized in that D-fructose, D-glucose or D-xylose is used as the ketose or aldose.

4. Method according to claim 2, characterized in that an aliphatic ketone is used as the ketone.

5. Method according to claim 4, characterized in that acetone is used as the aliphatic ketone.

6. Process for the production of 2,5-furandicarboxylic acid, characterized in that in the process according to claims 1 to 5, a 5-hydroxymethylfurfural oxidase is added to the aqueous solution after formation of 5-hydroxymethyl-2-furancarboxylic acid (HMFA).

7. Method according to claim 6, characterized in that a catalase is also added to the aqueous solution.

8. Method according to any one of claims 1 to 7, characterized in that the NAD(P)H produced during oxidation is at least partially reacted with an NAD(P)H oxidase to form NAD(P) + is being regenerated.

9. Method according to any one of claims 1 to 8, characterized in that the NAD(P) + - dependent aldehyde dehydrogenase has an amino acid sequence which is selected from the group consisting of: 33820-WQ 33 i) an amino acid sequence that has an identity to SEQ ID No. 2, SEQ ID No. 4, SEQ ID No. 6, SEQ ID No. 8, SEQ ID No. 10 or SEQ ID No. 12 of at least 80%, ii) an amino acid sequence encoded by a nucleic acid that has at least 80% identity to SEQ ID No. 1, SEQ ID No. 3, SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9 or SEQ ID No. 11, and iii) an amino acid sequence encoded by a nucleic acid that binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 1, SEQ ID No. 3, SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9 or SEQ ID No.

11.

10. Method according to any one of claims 1 to 9, characterized in that the oxidoreductase is used for the enzymatic regeneration of NAD(P) +a NAD(P)H-dependent alcohol dehydrogenase which has an amino acid sequence selected from the group consisting of: i) an amino acid sequence having at least 80% identity with SEQ ID No. 14, ii) an amino acid sequence encoded by a nucleic acid having at least 80% identity with SEQ ID No. 13, and iii) an amino acid sequence encoded by a nucleic acid which binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No.

13.

11. Method according to any one of claims 1 to 9, characterized in that the oxidoreductase is used for the enzymatic regeneration of NAD(P) +a xylitol dehydrogenase which has an amino acid sequence selected from the group consisting of: i) an amino acid sequence having at least 80% identity with SEQ ID No. 16, ii) an amino acid sequence encoded by a nucleic acid having at least 80% identity with SEQ ID No. 15, and iii) an amino acid sequence encoded by a nucleic acid which binds under stringent conditions to a nucleic acid molecule with the nucleic acid sequence SEQ ID No. 15.

Images