Antibodies that specifically bind CLDN6 or CD3 and bispecific antibodies that specifically bind CLDN6 and CD3
Bispecific antibodies with defined antigen-binding domains for CLDN6 and CD3 address the specificity challenge in cancer therapy, inducing T-cell cytotoxicity and activation against CLDN6-expressing tumors with minimal cross-reactivity, effectively treating cancers like ovarian and gastric.
Patent Information
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- THIRD ARC BIO INC
- Filing Date
- 2025-10-15
- Publication Date
- 2026-04-23
AI Technical Summary
Existing antibody therapies lack specificity for Claudin-6 (CLDN6) expression in tumors while minimizing binding to other CLDN family members, necessitating a need for targeted therapies to treat CLDN6-expressing cancers.
Development of bispecific antibodies with specific antigen-binding domains that target Claudin-6 (CLDN6) and CD3, comprising defined amino acid sequences for high specificity and reduced cross-reactivity, inducing T-cell mediated cytotoxicity and activation.
The bispecific antibodies effectively induce T-cell mediated cytotoxicity and activation, specifically targeting CLDN6-expressing cancer cells, including ovarian, endometrial, testicular, liver, lung, and gastric cancers, with minimal cross-reactivity to other CLDN family members.
Smart Images

Figure US2025051001_23042026_PF_FP_ABST
Abstract
Description
[0001] ANTIBODIES THAT SPECIFICALLY BIND CLDN6 OR CD3 AND BISPECIFIC ANTIBODIES THAT SPECIFICALLY BIND CLDN6 AND CD3 CROSS-REFERENCE TO RELATED APPLICATIONS This application claims priority to and benefit of U.S. Provisional Application No. 63 / 707,294, filed October 15, 2024, and U.S. Provisional Application No.63 / 791,908, filed April 21, 2025, the contents of each of which are hereby incorporated by reference in their entireties. REFERENCE TO A SEQUENCE LISTING SUBMITTED AS AN XML FILE The present application hereby incorporates by reference the entire contents of the Sequence Listing File titled “206570-0001-00WO_SequenceListing.xml” in XML format, with a creation date of September 2, 2025, and a size of 31,491 bytes. TECHNICAL FIELD Provided herein are antibodies and antigen-binding fragments thereof that specifically bind CLDN6 or CD3 and bispecific antibodies that specifically bind CLDN6 and CD3, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies. Methods of making the antibodies, and methods of using the antibodies to treat diseases including cancer, are also provided. BACKGROUND In the United States in 2020, approximately 1.6 million new cancer cases were reported and approximately 602,000 people died of cancer. For every 100,000 people, 403 new cancer cases were reported and 144 people died of cancer. (https: / / www .cdc .gov / cancer / dcpc / data / index .htm). Worldwide, cancer is among the leading causes of death. In 2018, there were 18.1 million new cases and 9.5 million cancer-related deaths worldwide. The most common cancers (listed in descending order according to estimated new cases in 2020) are breast cancer, lung and bronchus cancer, prostate cancer, colon and rectum cancer, melanoma of the skin, bladder cancer, non-Hodgkin lymphoma, kidney and renal pelvis cancer, endometrial cancer, leukemia, pancreatic cancer, thyroid cancer, and liver cancer. (https: / / www .cancer .gov / about -cancer / understanding / statistics). The majority of the most common cancers are solid tumors. Ovarian cancer accounts for 2.5% of cancers in women in the United States and ranks fifth 1
[0002] in cancer deaths, accounting for more deaths than any other cancer of the female reproductive system. Worldwide, ovarian cancer is the 8th most commonly occurring cancer in women and the 18th most common cancer overall worldwide. (https: / / www .medicalnewstoday .com / articles / 323798 #how -common -is -it). Claudin 6 (CLDN6) is a four transmembrane tight junction protein involved in fetal development but having minimal to no expression in normal adult tissues and is one of 27 members of the Claudin (CLDN) family. CLDN6 is widely expressed in various tumors such as ovarian, endometrial, testicular, liver, lung and gastric cancers but rarely expressed in healthy adult tissues (Du et al., Mol. Med. Rep.2021;24(3):677). The extracellular region of CLDN6 closely resembles other claudins including CLDN3, CLDN4, and CLDN9 that are normally expressed in critical organs. For example, the extracellular loops of CLDN6 and CLDN9 differ by only three amino acids. Exclusive expression of CLDN6 on certain tumor cells designates it as a target for antibody therapeutics directed against those tumors. However, developing therapeutic antibodies specifically targeting CLDN6 requires high specificity for the target and no measurable binding to other CLDN family members. Accordingly, there is a critical unmet need for antibody therapies selectively targeting CLDN6 to treat CLDN6 expressing cancers. SUMMARY In one aspect, the present invention provides a bispecific antibody comprising a first antigen-binding domain that specifically binds Claudin-6 (CLDN6) and a second antigen-binding domain that specifically binds cluster of differentiation 3 (CD3), wherein the first antigen-binding domain comprises: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. In some embodiments, the first antigen-binding domain comprises: a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:9. In some embodiments, the second antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. 2
[0003] In some embodiments, the first antigen-binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. In some embodiments, the first antigen-binding domain comprises: a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO:10; and b) a light chain (LC) comprising the amino acid sequence of SEQ ID NO:11. In some embodiments, the second antigen-binding domain comprises a single chain variable chain (scFv) comprising the amino acid sequence of SEQ ID NO:18. In some embodiments, the second antigen-binding domain comprises a HC comprising the amino acid sequence of SEQ ID NO:20. In some embodiments, the first antigen-binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a scFv comprising the amino acid sequence of SEQ ID NO:18. In some embodiments, the first antigen-binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a HC comprising the amino acid sequence of SEQ ID NO:20. In some embodiments, the bispecific antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence of SEQ ID NO:11; and c) a scFv comprising an amino acid sequence of SEQ ID NO:18. In some embodiments, the bispecific antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence of SEQ ID NO:11; and c) a second heavy chain (HC2) comprising an amino acid sequence of SEQ ID NO:20. In some embodiments, the first antigen-binding domain does not have cross-reactivity to human CLDN3, CLDN4 or CLDN9. In some embodiments, the first antigen-binding domain specifically binds an epitope of CLDN6 (SEQ ID NO:1) comprising glutamine 156 (Q156). In some embodiments, the second antigen-binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid in at least one of amino acid sequence selected from SEQ ID NOs:27-31 and an epitope of CD3δ (SEQ ID NO:22) comprising at least one amino acid in SEQ ID NO:32. In some embodiments, the second antigen-binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid sequence 3
[0004] selected from SEQ ID NOs:27-31 and an epitope of CD3δ (SEQ ID NO:22) comprising SEQ ID NO:32. In some embodiments, the second antigen-binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising SEQ ID NOs:27-31 and an epitope of CD3δ (SEQ ID NO:22) comprising SEQ ID NO:32. In some embodiments, the first antigen-binding domain binds CLDN6 with a KD of about 23 nM on CHO-CLDN6 overexpressing cells as measured by flow cytometry. In some embodiments, the second antigen-binding domain does not bind cynomolgus monkey cells expressing cynomolgus CD3. In some embodiments, the second antigen-binding domain binds CD3 with a KD of 10-100 nM as measured in a surface plasmon resonance assay at 25 °C. In some embodiments, the second antigen-binding domain comprises a single-chain antibody. In some embodiments, the single-chain antibody comprises a single-chain variable fragment (scFv) comprising the amino acid sequence of SEQ ID NO:18. In some embodiments, the bispecific antibody is an IgG1 subtype. In some embodiments, the bispecific antibody comprises an Fc domain, comprising one or more substitutions in the Fc domain that reduces Fc domain-mediated effector function, reduces binding to protein A, or improves bispecific antibody production. In some embodiments, the one or more substitutions in the Fc domain, using residue numbering according to EU numbering, comprises H435R, Y436F, T366S / L368A / Y407V, T366W, S354C, Y349C, L234A, or L235A. In some embodiments, the bispecific antibody binds both human T-cells and CLDN6 expressing cells. In some embodiments, the bispecific antibody induces T-cell mediated cytotoxicity of CLDN6+ovarian cancer cell lines. In some embodiments, the bispecific antibody induces T-cell mediated cytotoxicity of OVCAR3 cancer cell lines. In some embodiments, the bispecific antibody induces T-cell mediated cytotoxicity of PA-1 cancer cell lines. In some embodiments, the bispecific antibody induces T-cell mediated cytotoxicity of OV-90 cancer cell lines. In some embodiments, the bispecific antibody induces T-cell activation and proliferation. In some embodiments, the bispecific antibody activates cytokine release. In some embodiments, the present invention provides a pharmaceutical composition comprising a bispecific antibody of the present invention and a pharmaceutically acceptable carrier. In some embodiments, the present invention provides an isolated nucleic acid encoding a bispecific antibody of the present invention. In some embodiments, the present invention provides a vector comprising an isolated nucleic acid of the present invention. In some embodiments, the present invention provides a host cell comprising a vector of the present invention. In some embodiments, the present invention provides a method of producing a bispecific antibody of the 4
[0005] present invention, comprising culturing a host cell of the present invention under conditions to produce the bispecific antibody, and purifying the bispecific antibody. In one aspect, the present invention provides an isolated antibody or antigen-binding fragment thereof that specifically binds CLDN6 comprising: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises: a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:9. In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises: a) a heavy chain comprising the amino acid sequence of SEQ ID NO:10; and b) a light chain comprising the amino acid sequence of SEQ ID NO:11. In some embodiments, the isolated antibody or antigen-binding fragment specifically binds human CLDN6 and does not bind human CLDN3, CLDN4 or CLDN9. In some embodiments, the antibody or antigen-binding fragment thereof specifically binds an epitope of CLDN6 comprising glutamine 156 (Q156) of wildtype CLDN6 (SEQ ID NO:1). In some embodiments, the isolated antibody or antigen-binding fragment binds human CLDN6 with a KDof about 23 nM on CHO-CLDN6 overexpressing cells as measured by flow cytometry. In some embodiments, the present invention provides an isolated nucleic acid encoding the antibody or antigen-binding fragment thereof of the present invention. In some embodiments, the present invention provides a vector comprising an isolated nucleic acid of the present invention. In some embodiments, the present invention provides a host cell comprising a vector according to the present invention. In one aspect, the present invention provides a method of treating a CLDN6 expressing cancer in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of an antibody or pharmaceutical composition of the present invention. In some embodiments, the CLDN6 expressing cancer is a solid tumor. In some embodiments, the CLDN6 expressing cancer is ovarian, endometrial, testicular, liver, lung, or gastric cancer. 5
[0006] BRIEF DESCRIPTION OF THE DRAWINGS The foregoing summary, as well as the following detailed description of the embodiments of the present application, will be better understood when read in conjunction with the appended drawings. It should be understood, however, that the application is not limited to the precise embodiments shown in the drawings. Figure 1 shows a schematic representation of a bispecific antibody described herein that specifically binds CLDN6 and CD3. Figure 2 depicts a representative diagram of CLDN6 in a membrane, with the two extracellular domain (ECD) loops (ECD-1 and ECD-2), the four transmembrane domains, and three intracellular domains. The amino acid residues that differ between CLDN6 and CLDN9 are indicated by arrows. Figure 3 depicts representative binding of CLDN6 binders 51H102 and 112H105 to CLDN6 / CLDN9 hybrid mutants and wildtype CLDN6 and CLDN9 expressed in skov3 cells. Binding was assessed by flow cytometry, and mean fluorescence intensity of antibody binding was compared to that of wildtype CLDN6. Figure 4 depicts a schematic representation of the CD3-TCR complex indicating the binding epitopes that Ab897 binds to as determined by hydrogen-deuterium exchange (HDX)-mass spectrometry (HDX-MS) mapped onto the structure of CD3. Figure 5A-5B shows Ab897 specificity for T-cells and CLDN6 overexpressing cell lines. Figure 2A. Binding to human T cells. Figure 2B. Binding to CHO cells stable expressing CLDN6 or CLDN9. Figure 6 shows representative flow cytometry histograms of Ab897 binding to ovarian cancer cell lines OVCAR3, PA-1, and OV-90, which express CLDN6 compared to a lack of binding observed with SKOV3 cells. Shaded region = cell incubation with 300 nM Ab897; dashed line = cell incubation with 300 nM Null×CD3 antibody. Figure 7A shows flow cytometry plots showing median fluorescence intensity (MFI) values of Ab897 binding to CLDN6+cell lines OVARC3 and PA1. Figure 7B shows flow cytometry plots showing MFI values of Ab897 binding to CLDN6+cell line OV90, CLDN6- cell line SKOV3, and to HepG2 cells. Figure 8 shows a dose response of Ab897-mediated cytotoxicity on PA1-NLG cells co- cultured with pan-T cells from 5 individual donors as shown at 3:1 E:T ratio for 72 hours (top panel) or 96 hours (bottom panel). Target only control (no effector cell) did not show any cytotoxicity. All data points were in duplicates, mean ± SD plotted. All negative lysis values were 6
[0007] contained to 0 for the purposes of data plotting in a non-linear regression curve. Figure 9 shows a dose response of Ab897-mediated cytotoxicity on OV90-NLG cells co- cultured with pan-T cells from individual donors as shown at 3:1 E:T ratio for 48 hours (top panel), 72 hours (middle panel) or 96 hours (bottom panel). Target only control (no effector cell) did not show any cytotoxicity. All data points were in duplicates, mean ± SD plotted. All negative lysis values were contained to 0 for the purposes of data plotting in a non-linear regression curve. Figure 10 shows dose response of Ab897-mediated cytotoxicity on OVCAR3, PA-1, and OV-90 cell lines co-cultured with pan-T cells from five individual donors at a 3:1 ratio for 72 hours. Data points represent duplicates of all five donors, mean ± SD plotted. Figure 11 shows a dose response of Ab897-mediated cytotoxicity on HepG2-NLG liver tumor cells co-cultured with pan-T cells from individual donors as shown at a 10:1 E:T ratio for 48 hours (top panel), 72 hours (middle panel) or 96 hours (bottom panel). Target only control (no effector cell) did not show any cytotoxicity. All data points were in duplicates, mean ± SD plotted. All negative lysis values were contained to 0 for the purposes of data plotting in a non-linear regression curve. Figure 12 shows a dose response of Ab897-mediated lysis on CLDN6+OVARC3 cells and CLDN6- SLOV3 cells in co-cultures with pan-T cells from individual donors at 3:1 (top panel) 1:1 (middle panel) and 1:3 (bottom panel) E:T ratio for 72 hours. All data points were in duplicates, mean ± SD plotted. Figure 13A shows a dose response of Ab897 mediated proliferation of CD4+(left panel) and CD8+(right panel) T cells in co-cultures of OVARC3 cells and pan-T cells from 5 individual donors at 3:1 E:T ratio for 72 hours. All data points are in duplicates. Mean ± SD is plotted. Figure 13B shows a dose response of Ab897 mediated activation of CD4+(top panel) and CD8+(bottom panel) T cells in co-cultures of OVARC3 cells and pan-T cells from 5 individual donors at 3:1 E:T ratio for 72 hours, as measured by increased percentage (%) of CD4+CD25+and CD4+CD69+(top panel), or CD8+CD25+and CD8+CD69+(bottom panel) T cells. All data points are in duplicates. Mean ± SD is plotted. Figure 13C shows a dose response of Ab897 mediated cytokine production (TNFα, left panel), IFNγ, middle panel, IL6 (right panel) in co-cultures of OVARC3 cells and pan-T cells from 5 individual donors at 3:1 E:T ratio for 72 hours. All data points are in duplicates. Mean ± SD is plotted. Figure 14A shows anti-tumor activity of Ab897 in a OVCAR3 tumor xenograft NSG mouse model. Ab897 was administered weekly at various concentrations for four weeks. All data points 7
[0008] represent eight mice, mean ± SEM plotted. Figure 14B shows anti-tumor activity of Ab897 in a OV90 tumor xenograft NSG mouse model. Ab897 was administered weekly at 0.1 mg / kg for three weeks. Each line represents an individual mouse. DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS Various publications, articles, and patents are cited or described in the background and throughout the specification; each of these references is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is for the purpose of providing context for the disclosure provided herein. Such discussion is not an admission that any of these matters, singularly or in combination, form part of the prior art with respect to any disclosure provided herein. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which the disclosure provided herein pertains. Otherwise, certain terms used herein have the meanings as set forth in the specification. The numbering of amino acid residues of the antibody constant regions throughout the specification is according to the EU numbering as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991), unless otherwise explicitly stated. EU numbering and its correspondence to other numbering systems are available at IMGT (ImMunoGeneTics) within IMGT scientific charts. It must be noted that as used herein and in the appended claims, the singular forms "a," "an," and "the" include plural reference unless the context clearly dictates otherwise. It should also be understood that the terms "about," "approximately," "generally," "substantially," and like terms, used herein when referring to a dimension or characteristic of a component described herein, indicate that the described dimension / characteristic is not a strict boundary or parameter and does not exclude minor variations therefrom that are functionally the same or similar, as would be understood by one having ordinary skill in the art. At a minimum, such references that include a numerical parameter would include variations that, using mathematical and industrial principles accepted in the art (e.g., rounding, measurement or other systematic errors, manufacturing tolerances, etc.), would not vary the least significant digit. Unless otherwise stated, any numerical values, such as a concentration or a concentration range described herein, are to be understood as being modified in all instances by the term "about." 8
[0009] Thus, a numerical value typically includes± 10% of the recited value. For example, a concentration of 1 mg / mL includes 0.9 mg / mL to 1.1 mg / mL. Likewise, a concentration range of 1% to 10% (w / v) includes 0.9% (w / v) to 11% (w / v). As used herein, the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise. Unless otherwise indicated, the term "at least" preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments described herein. Such equivalents are intended to be encompassed by the disclosure provided herein. As used herein, the terms "comprises," "comprising," "includes," "including," "has," "having," "contains" or "containing," or any other variation thereof, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers and are intended to be non-exclusive or open-ended. For example, a composition, a mixture, a process, a method, an article, or an apparatus that comprises a list of elements is not necessarily limited to only those elements but can include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus. Further, unless expressly stated to the contrary, "or" refers to an inclusive or and not to an exclusive or. For example, a condition A or B is satisfied by any one of the following: A is true (or present) and B is false (or not present), A is false (or not present) and B is true (or present), and both A and B are true (or present). As used herein, the conjunctive term "and / or" between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by "and / or," a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term "and / or" as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term “and / or.” As used herein, the term "consists of," or variations such as "consist of'' or "consisting of" indicate the inclusion of any recited integer or group of integers, but that no additional integer or group of integers can be added to the specified method, structure, or composition. As used herein, the term "consists essentially of," or variations such as "consist essentially 9
[0010] of'' or "consisting essentially of" indicate the inclusion of any recited integer or group of integers, and the optional inclusion of any recited structure or group of structures, that do not materially change the basic or novel properties of the specified method, structure or composition. See US Manual of Patent Examining Procedure (M.P.E.P) §2111.03. As used herein, "subject" means a mammal, such as a human. The term "mammal" as used herein, encompasses any mammal. The terms "identical" or percent "identity," in the context of two or more nucleic acids or amino acid sequences (e.g., antibodies that specifically bind CLDN6 and polynucleotides that encode them, the bispecific antibodies that specifically bind CLDN6 and CD3 and polynucleotides that encode them or the antibodies that specifically bind CD3 and polynucleotides that encode them), refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection. For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. Alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math.1981;2:482, by the homology alignment algorithm of Needleman & Wunsch, J Mol. Biol.1970;48:443, by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 1988;85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by visual inspection (see generally, Current Protocols in Molecular Biology, F.M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement)). Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. J Mol. Biol.1990;215:403-410 and Altschul et al. Nucleic Acids Res.1997;25:3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National 10
[0011] Center for Biotechnology Information. A further indication that two nucleic acid sequences or amino acid sequences are substantially identical is that the amino acid sequence encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions, as described, e.g., in Molecular Diagnostics, Edition 1, 2019, E. van Pelt-Verkuil, W.B. van Leeuwen, R. te Witt eds., Springer Singapore (ISBN 978-981-13-1603- 6). As used herein, the term ”Claudin-6” or "CLDN6" refers to a human tight junction protein having an amino acid sequence of SEQ ID NO:1 (UniProt P56747) and a molecular weight of 23 kDa and any variants thereof. The human CLDN6 gene is located on chromosome 16p13.3 (Singh et al. J Oncol: 541957 (2010)). CLDN6 has four transmembrane domains and a PDZ-binding region at the C-terminal and can bind with signal proteins and cytoskeletal proteins, and participate in the cellular response to external and intracellular signal transmission (Lin et al., Oncol Rep.2017; 38:875–885). CLDN6 is the only CLDN to potentially show specificity, as it can activate cell adhesion signals and regulate the activity of nuclear receptors (Anderson et al., Dev Dyn.2008; 237:504–512). CLDN6 is expressed in a variety of embryonic epithelia, induces epithelial cell junction formation and polarity, and participates in the differentiation of stem cells into epithelial cells. As used herein, “bispecific antigen-binding molecules” include any molecule that exhibits specific binding to two distinct antigens. A bispecific antigen-binding molecule may comprise one or more first binding domains that specifically bind a first antigen and one or more second binding domains that specifically bind a second antigen. Binding domains may include, but are not limited to, amino acid sequences, nucleic acid sequences, carbohydrates, and combinations thereof. Exemplary bispecific antigen-binding molecules include, but are not limited to, bispecific antibodies, bispecific aptamers, bispecific antibody-aptamer conjugates, bispecific lectins, bispecific antibody-lectin conjugates, and bispecific aptamer-lectin conjugates. Tight junctions (TJ) are an important component of cell connectivity; maintaining cell polarity, permeability and adhesion, and participating in the regulation of cell proliferation and differentiation. The CLDN family is integral to TJs, and CLDN6 is an important member of this family. Abnormal expression of CLDN6 can destroy the integrity of TJs through various 11
[0012] mechanisms and can serve multiple roles in the occurrence and development of tumors. The term "CD3" refers to the human Cluster of Differentiation 3 protein multi-subunit complex and includes any CD3, variant and / or isoform which is endogenously expressed (including expressed by T cells) or can be overexpressed on cells transfected with genes or cDNA encoding CD3. CD3 can also be referred to as "cluster of differentiation 3." The CD3 protein multi-subunit complex is composed of six (6) distinctive polypeptide chains, which include a CD3G chain (UniProt P09693) (SEQ ID NO:21), a CD3D chain (UniProt P04234) (SEQ ID NO:22), two CD3E chains (UniProt P07766) (SEQ ID NO:23), and a CD3Z chain homodimer (UniProt P20963) (SEQ ID NO:24). These CD3 protein subunits are part of the T-cell receptor (TCR)-CD3 complex present on T-lymphocytes and play an essential role in the adaptive immune response. When antigen presenting cells (APCs) activate TCR, TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. The redirection of T-lymphocytes to cancer cells expressing CLDN6 via the TCR / CD3 complex represents an attractive treatment approach and can be accomplished with an antibody or binding fragment thereof directed to the CD3E subunit of the CD3 complex. CD3E antibodies have been described. SP34 (Yang SJ, J. lmmunol.1986;137:1097-1100) reacts with both primate and human CD3 and is available commercially from Pharmingen. Additional anti-CD3 antibodies include UCHT-1, see PCT Intl. Publ. No. W02000 / 041474 and Anasetti et al., Transplantation 1992;54:844 and BC3 (available from Abcam). SP34 differs from UCHT-1 and BC3 in that SP34 recognizes an epitope present solely on the CD3E subunit (see Salmeron et al., J. Immunol.1991;147:3047) whereas UCHT-1 and BC3 recognize an epitope contributed by both the CD3E and CD3D subunits. An antibody sequence that is 96% identical to the SP34 VHis described in PCT Intl. Publ. No. W02007 / 042261. The CD3 specific antibodies provided herein are novel and exhibit different properties as compared to those described above. The novel CD3 specific antibodies provided herein exhibit moderate binding to human CD3 and do not bind cynomolgus CD3. As used herein, the term "antibody" is used in a broad sense and includes immunoglobulin or antibody molecules including human, humanized and chimeric antibodies and antibody fragments, including monospecific, bispecific or multispecific antibodies with single or multiple valency. Antibodies described herein can take a number of formats, including traditional antibodies as well 12
[0013] as antibody derivatives, fragments, and mimetics, including a number of bispecific or multispecific formats and antigen-binding domains described herein. In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. Antibody structures are well known. Traditional antibodies are “Y” shaped tetramers comprised of two heavy chains (HC) and two light chains (LC). Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (comprised of domains CH1, hinge, CH2 and CH3), and each light chain is comprised of a light chain variable region (VL and a light chain constant region (CL1). Other useful antibody formats are those described herein and those known in the art, and include antibody formats that incorporate single chain antigen-binding domains such as single chain Fv (scFv). Immunoglobulins can be assigned to five major classes (i.e., IgA, IgD, IgE, IgG and IgM), depending on the heavy chain constant domain amino acid sequence. IgA and IgG are further sub- classified as the isotypes IgA1, IgA2, IgG1, IgG2, IgG3 and IgG4. Further diversity of IgG1 is found in natural variations and polymorphisms known as allotypes (described, for example at imgt. org / IMGTrepertoire / Proteins / allotypes / human / IGH / IGHC / G1m_ allotypes. html). In one embodiment, bispecific antibodies that specifically bind CLDN6 and CD3 and are of the IgG1 subclass are provided. In one embodiment, antibodies of the IgG1 subclass, G1m17, 1 allotype are provided. As used herein, the term “Fc,” “Fc domain” or “Fc region” refers to a portion of an immunoglobulin molecule that correlates to a crystallizable fragment obtained by papain digestion of an Ig molecule. Within an Fc domain, there are two “Fc chains” (e.g., a “first Fc chain” and a “second Fc chain”), each Fc chain excluding the first constant region immunoglobulin domain (CH1), and optionally a hinge or a portion of the hinge. Although the boundaries of each Fc chain may vary, the human IgG1 heavy chain Fc chain is usually defined to comprise residues C226 or P230 in its N-terminus. In some embodiments, the Fc chain comprises from about amino acid residue T225 to about K447 of the human IgG1 heavy chain. The C-terminal lysine (residue 447) of the Fc domain may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue. The Fc domain mediates effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). In ADCC, the Fc domain of an antibody binds to Fc receptors (FcRs) on the 13
[0014] surface of immune effector cells such as natural killer cells and macrophages, leading to the phagocytosis or lysis of the targeted cells, such as CLDN6-expressing tumor cells. In CDC, the antibodies kill the targeted cells by triggering the complement cascade on the cell surface. The Fc domains may be engineered to modify the Fc-mediated effector functions using known mutations. For many applications of therapeutic antibodies, Fc-mediated effector functions are not desired as they may be detrimental and potentially pose a safety risk by causing off-mechanism toxicity. Modifying Fc-mediated effector functions can be achieved by engineering the Fc domains to reduce their binding to FcRs or complement factors while maintaining the stability, pharmacokinetics, and half-life of the engineered antibody. The binding of IgG to the activating (FcγRI, FcγRIIa, FcγRIIIa and FcγRIIIb) and inhibitory (FcγRIIb) FcRs or the first component of complement (Clq) depends on residues located in the hinge region and the CH2 domain. Mutations have been introduced in IgG1, IgG2 and IgG4 to reduce or silence Fc functionalities. In some embodiments, the IgG1 antibodies and bispecific antibodies provided herein include L234A and L235A substitutions in the Fc domain to reduce their binding to FcRs and reduce Fc-mediated effector functions. In one embodiment, the antibodies or the bispecific antibodies provided herein comprise a modified Fc domain with one or more of the following properties: (a) reduced effector function when compared to the parent (i.e., unmodified) Fc domain; (b) reduced affinity to FcγRI, FcγRIIa, FcγRIIb, FcγRIIIb and / or FcγRIIIa, (c) reduced affinity to FcγRI, (d) reduced affinity to FcγRIIa (e) reduced affinity to FcγRIIb, (f) reduced affinity to FcγRIIIb or (g) reduced affinity to FcγRIIIa. Reduced effector function and reduced affinity can be measured using known methods. “Reduced” may be a reduction from about 10% to 100%, or a statistically significant reduction when compared to a test molecule, such as a bispecific antigen-binding molecule with a native unmodified Fc domain. As used herein, the term "antigen-binding fragment" or “antigen-binding domain” is any proteinaceous structure that exhibits binding affinity for a particular antigen. Antigen-binding fragments include those provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques. Some antigen-binding fragments are composed of portions of intact antibodies that retain antigen-binding specificity of the parent antibody molecule. For example, antigen-binding fragments may comprise at least one variable region (either a heavy chain or light chain variable region) or one or more CDRs of an antibody known to bind a particular antigen. Examples of suitable antigen-binding fragments include, without limitation, a diabody, a Fab, a Fab', a F(ab')2, an Fv fragment, a single chain Fv (scFv), optionally a disulfide stabilized 14
[0015] single chain Fv fragment, a (scFv)2, a bispecific scFv (scFv-scFv'), a disulfide stabilized diabody (ds diabody), a single-chain antibody, a single domain antibody (sdab), a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a traditional Y-shaped antibody structure. Additionally, antigen binding fragments may include non-antibody proteinaceous frameworks that may successfully incorporate polypeptide segments in an orientation that confers affinity for a given antigen of interest, such as protein scaffolds. As used herein, the term "single-chain antibody" refers to a conventional single-chain antibody such as a single-chain variable fragment (scFv). “scFv” refers to a single chain protein comprising a VH, a VL and a linker between the VH and the VL. The scFv may comprise the VL and VH in either orientation, e.g., with respect to the N- to C-terminal order of the VH and the VL. The scFv may thus be in the orientation VL-linker-VH or VH-linker-VL. The VH and VL may be connected by a short flexible peptide linker of about 11 to about 20 amino acids to allow the VH and the VL to properly fold to retain antigen-binding capabilities of the scFv. An scFv may be engineered to comprise disulfide bonds between the VH and the VL, or between the VH, VL and the linker. scFv constructs can be linked to an antibody constant chain or Fc domain at either the N- or C-terminus, directly or through a linker. Provided herein is an scFv specifically binding CD3 comprising the amino acid sequence of SEQ ID NO:18. The scFv specifically binding CD3 comprises the amino acid sequence of SEQ ID NO:18 in a VL (SEQ ID NO:25)-linker (SEQ ID NO:19)-VH (SEQ ID NO:26) format where amino acids at VH44 / VL100 (Kabat numbering) in the framework are replaced with cysteines. In some embodiments, the scFv of SEQ ID NO:18 is conjugated to an Fc domain. “Isolated” refers to a homogenous population of molecules (such as synthetic polynucleotides or proteins such as an antibodies or bispecific antibodies) which have been substantially separated and / or purified away from other components of the system the molecules are produced in, such as a recombinant cell as well as proteins that have been subjected to at least one purification or isolation step. “Isolated antibody" refers to an antibody that is substantially free of other cellular material and / or chemicals and encompasses antibodies that are isolated to a higher purity, such as to at least 80% purity, for example 90%-100% purity. As used herein, the term "monoclonal antibody" refers to a preparation of antibody molecules of single molecular composition, i.e., the individual antibodies comprising the composition are identical except for possible naturally occurring mutations that may be present in minor amounts, or post-translational modifications that occur during production and storage. The 15
[0016] monoclonal antibodies can be made by the hybridoma method, phage display technology, single lymphocyte gene cloning technology, or by recombinant DNA methods. For example, the monoclonal antibodies can be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene. As used herein, the term "human antibody" refers to an antibody that is optimized to have minimal immune response when administered to a human subject. Variable regions of human antibodies are derived from human germline immunoglobulin sequences. If the antibody contains a constant region or a portion of the constant region (such as the Fc domain), the constant region is also derived from human germline immunoglobulin sequences. A human antibody comprises heavy or light chain variable regions that are “derived from” human germline immunoglobulin sequences if the variable regions of the antibody are obtained from a system that uses human germline immunoglobulin genes. Exemplary systems are human immunoglobulin gene libraries displayed on phage or mammalian cells, and transgenic non-human animals such as mice, rats or chickens carrying human immunoglobulin loci. A human antibody typically contains amino acid differences when compared to the immunoglobulins expressed in humans due to differences between the systems used to obtain the antibody and human immunoglobulin loci, introduction of naturally occurring somatic mutations, intentional introduction of substitutions into the frameworks or CDRs. A human antibody is typically about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical in amino acid sequence to an amino acid sequence encoded by human germline immunoglobulin sequences. In some cases, a human antibody may contain consensus framework sequences derived from human framework sequence analyses, for example as described in (Knappik et al., J. Mol. Biol.2000;296:57-86), or synthetic HCDR3 incorporated into human immunoglobulin gene libraries displayed on phage, for example as described in (Shi et al., J. Mol. Biol.2010;397:385-96), and in PCT Int. Publ. No. WO2009 / 085462. Antibodies in which CDRs are derived from a non-human species are not included in the definition of human antibody. As used herein, the term "humanized antibody" refers to a non-human antibody that is modified to increase the sequence homology to that of a human antibody, such that the antigen- binding properties of the antibody are retained, but its antigenicity in the human body is reduced. As used herein, the term "chimeric antibody" refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species. The variable regions of both the light and heavy chains often correspond to the variable region of an antibody 16
[0017] derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) having the desired specificity, affinity, and capability, while the constant regions correspond to the sequences of an antibody derived from another species of mammal (e.g., human) to avoid eliciting an immune response in that species. As used herein, the term "bispecific antibody" refers to an antibody that specifically binds two distinct antigens or epitopes. The bispecific antibody may comprise one or more antigen- binding domains that specifically bind each antigen or epitope. In one embodiment, the bispecific antibody of the disclosure binds two distinct antigens, CLDN6 and CD3. In one embodiment, the bispecific antibody is Ab897. As used herein, an antibody or a bispecific antibody that "specifically binds CLDN6" or “specifically binds CD3” refers to an antibody or a bispecific antibody that binds human CLDN6 orhuman CD3, with a KD of about 1x 10-7M or less, 1×10-8M or less, 5×10-9M or less, 1×10-9M orless, 5×10-10M or less or 1×10-10M or less, typically with a KD that is at least one hundred-fold lessthat its KDfor binding to a non-specific antigen (e.g., casein or bovine serum albumin (BSA)). The term "KD" refers to the dissociation constant and is expressed as a molar concentration (M). The smaller the KDvalue, the higher the binding affinity of the antibody for its target antigen. KDvalues for antibodies can be determined using well known methods and those described herein. For example, the KD of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system, e.g., a Biacore® system, or by using bio-layer interferometry technology, such as an Octet RED96 system. Antibodies that specifically bind to the antigen may, however, have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example, Macaca fascicularis (cynomolgus monkey, cyno). While a monospecific antibody specifically binds one antigen, a bispecific antibody specifically binds two distinct antigens (or two distinct epitopes on the same antigen). Antibodies Provided herein are bispecific antibodies that specifically bind CLDN6 and CD3, nucleic acids and expression vectors encoding the bispecific antibodies, recombinant cells containing the vectors, pharmaceutical compositions comprising the bispecific antibodies, methods of manufacturing the bispecific antibodies, and methods of use thereof. The CLDN6 binding domain of the bispecific antibody is useful for targeting cells (e.g., tumor cells) that express or overexpress CLDN6 (e.g., ovarian, endometrial, testicular, liver, lung, and gastric cancers), and the CD3 binding domain of the bispecific antibody is useful for activating T-cells. The simultaneous binding of 17
[0018] CLDN6 on a tumor cell and CD3 on a T-cell facilitates directed killing (cell lysis) of the targeted tumor cell by the activated T-cell. The bispecific antibodies that specifically bind CLDN6 and CD3 described herein are therefore useful, inter alia, for treating diseases and disorders related to or caused by CLDN6-expressing tumors (e.g., ovarian cancers, endometrial, testicular, liver, lung, and gastric cancers). Also provided herein are multispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6, a second antigen-binding domain that specifically binds CD3 and one or more additional antigen-binding domains that specifically bind one or more other antigens of interest. In some embodiments, multispecific antibodies that specifically bind CLDN6 and CD3 comprise a first antigen-binding domain that specifically binds CLDN6 and not CLDN9. In some embodiments, the first antigen-binding domain that specifically binds CLDN6 binds an epitope of CLDN6 (SEQ ID NO:1) comprising glutamine 156 (Q156). In some embodiments, the multispecific antibodies that specifically bind CLDN6 and CD3 comprise a second antigen-binding domain that specifically binds an epitope of CD3δ and an epitope of CD3ε. In some embodiments, the second antigen-binding domain specifically binds an epitope of CD3δ (SEQ ID NO:22) comprising at least one amino acid in SEQ ID NO:32. In some embodiments, the second antigen-binding domain that specifically binds an epitope of CD3δ (SEQ ID NO:22) comprising SEQ ID NO:32. In some embodiments, the second antigen-binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid of at least one amino acid sequence selected from SEQ ID NOs:27-31. In some embodiments, the second antigen-binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid sequence selected from SEQ ID NOs:27-31. In some embodiments, the second antigen-binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising the amino acid sequences of SEQ ID NOs:27-31. In some embodiments, the second antigen-binding domain specifically binds an epitope of CD3δ (SEQ ID NO:22) comprising at least one amino acid in SEQ ID NO:32 and an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid in at least one amino acid sequence selected from the group consisting of SEQ ID NO:27-31. In some embodiments, the second antigen- binding domain specifically binds an epitope of CD3δ (SEQ ID NO:22) comprising SEQ ID NO:32 and an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO:27-31. In some embodiments, the second antigen-binding 18
[0019] domain specifically binds an epitope of CD3δ (SEQ ID NO:22) comprising SEQ ID NO:32 and an epitope of CD3ε (SEQ ID NO:23) comprising at the amino acid sequences of SEQ ID NO:27-31. Further provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. In some embodiments, the first antigen-binding domain that specifically binds CLDN6 comprises: a) an HCDR1, HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively, and b) an LCDR1, LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a heavy chain variable region (VH) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% 19
[0020] identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:9. In some embodiments, the first antigen-binding domain that specifically binds CLDN6 comprises: a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:9. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the second antigen-binding domain comprises a heavy chain (HC) comprising an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:20. In some embodiments, the second antigen-binding domain that specifically binds CD3 comprises the amino acid sequence of SEQ ID NO:20. Further provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 20
[0021] 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and herein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. In some embodiments, the first antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: 21
[0022] a) a VH comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:8; and b) a VL comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. In some embodiments, the first antigen-binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and 22
[0023] d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a heavy chain (HC) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:10; and b) a light chain (LC) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:11; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. In some embodiments, the first antigen-binding domain comprises: 23
[0024] a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO:10; and b) a light chain (LC) comprising the amino acid sequence of SEQ ID NO:11; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises a single chain variable chain (scFv) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:18. In some embodiments, the first antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence of SEQ ID 24
[0025] NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises a single chain variable chain (scFv) comprising the amino acid sequence of SEQ ID NO:18. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises a HC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:20. In some embodiments, the first antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence of SEQ ID 25
[0026] NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises a HC comprising the amino acid sequence of SEQ ID NO:20. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a VH comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:8; and b) a VL comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises an scFv comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:18. In some embodiments, the first antigen-binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises an scFv comprising the amino acid sequence of SEQ ID NO:18. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: 26
[0027] a) a VH comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:8; and b) a VL comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a HC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:20. In some embodiments, the first antigen-binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a HC comprising the amino acid sequence of SEQ ID NO:20. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the bispecific antibodies comprises: a) a HC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:10; 27
[0028] b) a LC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:11; and c) an scFv comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:18. In some embodiments, the bispecific antibodies comprises: a) a HC comprising an amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence of SEQ ID NO:11; and c) an scFv comprising an amino acid sequence of SEQ ID NO:18. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the bispecific antibodies comprises: a) a HC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:11; and c) a second heavy chain (HC2) comprising an amino acid sequence at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% 28
[0029] identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:20. In some embodiments, the bispecific antibodies comprises: a) a HC comprising an amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence of SEQ ID NO:11; and c) a second heavy chain (HC2) comprising an amino acid sequence of SEQ ID NO:20. In certain embodiments, the bispecific antibodies that specifically bind CLDN6 and CD3 do not bind human CLDN3, CLDN4 or CLDN9. In some embodiments, the bispecific antibodies do not demonstrate any binding to human CLDN3, CLDN4, or CLDN9 at physiologically relevant concentrations. In some embodiments, the bispecific antibodies do not demonstrate any binding to human CLDN3, CLDN4, or CLDN9 at a concentration of 300 nM or less. Also provided herein are bispecific antibodies that specifically bind CLDN6 and CD3, wherein the bispecific antibodies bind CLDN6 with a binding EC50of about 10 nM to about 200 nM on CHO-CLDN6 overexpressing cells as measured by flow cytometry. In some embodiments, the EC50 is between about 10 nM and about 100 nM. In some embodiments, the EC50 is between about 10 nM and about 80 nM. In some embodiments, the EC50 is about 10 nM, about 11, about 12 nM, about 13 nM, about 14 nM, about 15 nM, about 16 nM, about 17 nM, about 18 nM, about 19 nM, about 20 nM, about 21 nM, about 22 nM, about 23 nM, about 24 nM, about 25 nM, about 26 nM, about 27 nM, about 28 nM, about 29 nM, about 30 nM, about 31 nM, about 32 nM, about 33 nM, about 34 nM, about 35 nM, about 36 nM, about 37 nM, about 38 nM, about 39 nM, about 40 nM, about 41 nM, about 42 nM, about 43 nM, about 44 nM, about 45 nM, about 46 nM, about 47 nM, about 48 nM, about 49 nM, about 50 nM, about 51 nM, about 52 nM, about 53 nM, about 54 nM, about 55 nM, about 56 nM, about 57 nM, about 58 nM, about 59 nM, about 60 nM, about 61 nM, about 62 nM, about 63 nM, about 64 nM, about 65 nM, about 66 nM, about 67 nM, about 68 nM, about 69 nM, about 70 nM, about 71 nM, about 72 nM, about 73 nM, about 74 nM, about 75 nM, about 76 nM, about 77 nM, about 78 nM, about 79 nM, about 80 nM, about 82 nM, about 84 nM, about 86 nM, about 88 nM, about 90 nM, about 92 nM, about 94 nM, about 96 nM, about 98 nM, about 100 nM, about 105 nM, about 110 nM, about 115 nM, about 120 nM, about 125 nM, about 130 nM, about 135 nM, about 140 nM, about 145 nM, about 150 nM, about 155 nM, about 160 nM, about 165 nM, about 170 nM, about 175 nM, about 180 nM, about 185 nM, about 190 nM, about 29
[0030] 195 nM, or about 200 nM. In some embodiments, the EC50 is about 20 nM. In some embodiments, the EC50 is about 70 nM. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the second antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising the amino acid sequence shown in SEQ ID NOs:12, 13 and 14, respectively, and b) a LCDR1, LCDR2, and LCDR3 comprising the amino acid sequence shown in SEQ ID NOs:15, 16 and 17, respectively. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, where the second antigen-binding domain does not bind cells expressing cynomolgus CD3. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the second antigen-binding domain binds CD3 with a binding dissociation constant (KD) value of less than about 2.0×10-7M as measured in a surface plasmon resonance assay at 25 °C. In some embodiments, the CD3-binding domain has a KDvalue of less than about 1.0×10-7. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the second antigen-binding domain comprises a single-chain antibody. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the second antigen-binding domain comprises an scFv comprising the amino acid sequence of SEQ ID NO:18. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the bispecific antibodies are IgG1 subtype. Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the bispecific antibodies comprise an Fc domain, comprising one or more substitutions in the Fc domain. In some embodiments, the one or more substitutions in the Fc domain reduce Fc domain-mediated effector function, reduce binding to protein A, or improve bispecific antibody production. 30
[0031] Also provided herein are bispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the bispecific antibodies comprise an Fc domain comprising one or more substitutions in the Fc domain, wherein the one or more substitutions in the Fc domain, using residue numbering according to EU numbering, comprise H435R, Y436F, T366S / L368A / Y407V, T366W, S354C, Y349C, L234A and / or L235A. In some embodiments, one Fc domain comprises L234A, L235A, S354C, Y349C, T366S, L368A, Y407V, H435R, and Y436F substitutions and the second Fc domain comprises L234A, L235A, S354C, Y349C, and T366W substitutions. In some embodiments, the bispecific antibodies described herein induce T-cell mediated cytotoxicity of CLDN6+ovarian cancer cell lines. In some embodiments, the bispecific antibodies described herein induce T-cell mediated cytotoxicity of OVCAR3 cancer cell lines. In some embodiments, the bispecific antibodies described herein induce T-cell mediated cytotoxicity of PA-1 cancer cell lines. In some embodiments, the bispecific antibodies described herein induce T-cell mediated cytotoxicity of OV-90 cancer cell lines. In some embodiments, the bispecific antibodies described herein induce T-cell activation and proliferation. In some embodiments, the bispecific antibodies described herein activate cytokine release. “Conservative modifications” refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody or an antigen-binding fragment containing the amino acid modifications. Conservative modifications include amino acid substitutions, insertions, and deletions. Conservative amino acid substitutions are those in which the amino acid is replaced with an amino acid residue having a similar side chain. The families of amino acid residues having similar side chains are well defined and include amino acids with acidic side chains (e.g., aspartic acid, glutamic acid), basic side chains (e.g., lysine, arginine, histidine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), uncharged polar side chains (e.g., glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine, tryptophan), aromatic side chains (e.g., phenylalanine, tryptophan, histidine, tyrosine), aliphatic side chains (e.g., glycine, alanine, valine, leucine, isoleucine, serine, threonine), amide (e.g., asparagine, glutamine), beta-branched side chains (e.g., threonine, valine, isoleucine) and sulfur-containing side chains (cysteine, methionine). Furthermore, any native residue in the polypeptide may also be substituted with alanine, as has been previously described for alanine scanning mutagenesis (MacLennan et al., 31
[0032] Acta Physiol. Scand. Suppl.1988;643:55-67; Sasaki et al., Adv. Biophys.1988;35:1-24). Table 1: Conservative Amino Acid Substitutions Within a group of amino acids, some substitutions may be preferred over others. For example, glycine and alanine may preferably be used to substitute for one another (since they have relatively short side chains) and valine, leucine and isoleucine may be used to substitute for one another (since they have larger aliphatic side chains which are hydrophobic). Amino acid substitutions to the antibodies described herein may be made by known methods for example by PCR mutagenesis (US Pat. No.4,683,195). Alternatively, libraries of variants may be generated for example using random (NNK) or non-random codons, for example DVK codons, which encode 11 amino acids (Ala, Cys, Asp, Glu, Gly, Lys, Asn, Arg, Ser, Tyr, Trp). The resulting antibody variants may be tested for their characteristics using assays described herein. Amino acid deletions or insertions can also be made relative to the amino acid sequences provided for the antibodies described herein. Thus, for example, amino acids which do not have a substantial effect on the activity of the polypeptide, or at least which do not eliminate such activity, can be deleted. Such deletions can be advantageous since the overall length and the molecular weight of a polypeptide can be reduced whilst still retaining activity. This can enable the amount of polypeptide required for a particular purpose to be reduced – for example, dosage levels can be reduced. 32
[0033] In some embodiments, the bispecific antibodies described herein comprise a Fab domain fused to a first Fc chain and a scFv fused to a second Fc chain as shown in Figure 1. In some embodiments, the Fab specifically binds CLDN6. In some embodiments, the Fab comprises the an HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 comprising the amino acid sequences of SEQ ID NOs:2, 3, 4, 5, 6, and 7, respectively. In some embodiments, the Fab comprises a VH comprising the amino acid sequence of SEQ ID NO:8 and a VL comprising the amino acid sequence of SEQ ID NO:9. In some embodiments, the scFv specifically binds CD3. In some embodiments, the scFv comprises an HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 comprising the amino acid sequences of SEQ ID NOs:12, 13, 14, 15, 16, and 17, respectively. In some embodiments, the scFv comprises the amino acid sequence of SEQ ID NO:18. Also provided herein are isolated antibodies or antigen-binding fragments thereof that specifically bind CLDN6, nucleic acids and expression vectors encoding the antibodies or antigen- binding fragments, recombinant cells containing the vectors, pharmaceutical compositions comprising the antibodies and methods of use thereof. Also provided herein are isolated antibodies or antigen-binding fragments that specifically bind CLDN6 but do not bind human CLDN3, CLDN4, or CLDN9. In some embodiments, the isolated antibodies or antigen-binding fragments that specifically bind CLDN6 do not demonstrate any binding to human CLDN3, CLDN4, or CLDN9 at physiologically relevant concentrations. In some embodiments, the isolated antibodies or antigen-binding fragments that specifically bind CLDN6 do not demonstrate any binding to human CLDN3, CLDN4, or CLDN9 at a concentration of 300 nM or less. In some embodiments, the isolated antibody or antigen-binding fragments thereof that specifically bind CLDN6 specifically binds an epitope of CLDN6 (SEQ ID NO:1) comprising glutamine 156 (Q156). Also provided herein are antibodies or antigen-binding fragments that specifically bind CLDN6 comprising: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Also provided herein are isolated antibodies or antigen-binding fragments that specifically 33
[0034] bind CLDN6 comprising: a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:9. Also provided herein are isolated antibodies or antigen-binding fragments that specifically bind CLDN6 comprising: a) a heavy chain comprising the amino acid sequence of SEQ ID NO:10; and b) a light chain comprising the amino acid sequence of SEQ ID NO:11. Also provided herein are bispecific antibodies that specifically bind CLDN6 and CD3, wherein the bispecific antibodies bind CLDN6 with a binding EC50 of about 10 nM to about 200 nM on CHO-CLDN6 overexpressing cells as measured by flow cytometry. In some embodiments, the EC50is between about 10 nM and about 100 nM. In some embodiments, the EC50is between about 10 nM and about 80 nM. In some embodiments, the EC50is about 10 nM, about 11, about 12 nM, about 13 nM, about 14 nM, about 15 nM, about 16 nM, about 17 nM, about 18 nM, about 19 nM, about 20 nM, about 21 nM, about 22 nM, about 23 nM, about 24 nM, about 25 nM, about 26 nM, about 27 nM, about 28 nM, about 29 nM, about 30 nM, about 31 nM, about 32 nM, about 33 nM, about 34 nM, about 35 nM, about 36 nM, about 37 nM, about 38 nM, about 39 nM, about 40 nM, about 41 nM, about 42 nM, about 43 nM, about 44 nM, about 45 nM, about 46 nM, about 47 nM, about 48 nM, about 49 nM, about 50 nM, about 51 nM, about 52 nM, about 53 nM, about 54 nM, about 55 nM, about 56 nM, about 57 nM, about 58 nM, about 59 nM, about 60 nM, about 61 nM, about 62 nM, about 63 nM, about 64 nM, about 65 nM, about 66 nM, about 67 nM, about 68 nM, about 69 nM, about 70 nM, about 71 nM, about 72 nM, about 73 nM, about 74 nM, about 75 nM, about 76 nM, about 77 nM, about 78 nM, about 79 nM, about 80 nM, about 82 nM, about 84 nM, about 86 nM, about 88 nM, about 90 nM, about 92 nM, about 94 nM, about 96 nM, about 98 nM, about 100 nM, about 105 nM, about 110 nM, about 115 nM, about 120 nM, about 125 nM, about 130 nM, about 135 nM, about 140 nM, about 145 nM, about 150 nM, about 155 nM, about 160 nM, about 165 nM, about 170 nM, about 175 nM, about 180 nM, about 185 nM, about 190 nM, about 195 nM, or about 200 nM. In some embodiments, the EC50 is about 20 nM. In some embodiments, the EC50is about 70 nM. In some embodiments, the antibodies described herein can be chimeric, humanized or fully human. Methods of making the antibodies, and methods of using the antibodies to treat diseases such 34
[0035] as CLDN6-expressing cancers are also provided herein. The bispecific antibodies described herein possess one or more desirable functional properties, including, but not limited to, high-affinity binding to CLDN6, high specificity to CLDN6, and moderate binding to CD3. It is expected that the bispecific antibodies of the disclosure will treat or prevent CLDN6-expressing cancers when administered alone or in combination with other anti-cancer therapies, such as surgery followed by carboplatin in combination with paclitaxel in ovarian cancer. Variants of the antigen-binding domains that specifically bind CLDN6 are within the scope of the disclosure. Such variants may comprise one or more modifications, such as conservative modifications as long as they retain or have improved functional properties when compared to the parental molecule, such as binding to CLDN6. Another embodiment of the disclosure provides an antigen-binding fragment that binds CLND6 comprising an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%or more, such as 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOs:8, 9, 10 or 11. According to another embodiment, an antigen-binding fragment that binds CD3 comprising an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%or more, such as 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOs:18 or 20 is disclosed herein. In other embodiments, variant antibodies, antigen-binding fragments, scFv or bispecific antibodies comprising one or more conservative mutations in the antigen-binding domain. The conservative mutations may reside in the well-known framework regions or any of the CDRs, as long as the variant antibodies, antigen-binding fragments or scFv retain the desired functional properties of the parent molecules, such as those described herein. “Conservative modifications” refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody or an antigen-binding fragment containing the amino acid modifications. Conservative modifications include amino acid substitutions, insertions, and deletions. Conservative amino acid substitutions are those in which the amino acid is replaced with an amino acid residue having a similar side chain. The families of amino acid residues having similar side chains are well defined and include amino acids with acidic side chains (e.g., aspartic acid, glutamic acid), basic side chains (e.g., lysine, arginine, histidine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), uncharged polar side chains (e.g., glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine, tryptophan), aromatic side chains (e.g., phenylalanine, tryptophan, histidine, tyrosine), aliphatic side chains (e.g., 35
[0036] glycine, alanine, valine, leucine, isoleucine, serine, threonine), amide (e.g., asparagine, glutamine), beta-branched side chains (e.g., threonine, valine, isoleucine) and sulfur-containing side chains (cysteine, methionine). Furthermore, any native residue in the polypeptide may also be substituted with alanine, as has been previously described for alanine scanning mutagenesis (MacLennan et al., Acta Physiol. Scand. Suppl.1988;643:55-67; Sasaki et al., Adv. Biophys.1988;35:1-24). Amino acid substitutions to the antibodies described herein may be made by known methods for example by PCR mutagenesis (U.S. Pat. No.4,683,195). Alternatively, libraries of variants may be generated for example using random (NNK) or non-random codons, for example DVK codons, which encode 11 amino acids (Ala, Cys, Asp, Glu, Gly, Lys, Asn, Arg, Ser, Tyr, Trp). The resulting antibody variants may be tested for their characteristics using assays described herein. Bispecific format Different formats of bispecific antibodies have been described andreviewed by Chames andBaty in Curr. Opin. Drug Disc. Dev.2009;12:276. In some embodiments, the present disclosure provides bispecific antibodies that are IgG-like molecules with CH3 domains with asymmetric mutations to drive heterodimerization (as compared to homodimerization) between two parental antibodies, forming recombinant IgG-like bispecificantibodies, wherein the two sides of the antibody each contain a Fabfragment, or part of a Fabfragment, or an scFv of at least two different antibodies. “Homodimerization" as used herein refers to an interaction of two heavy chains having identical CH3 amino acid sequences. "Heterodimerization" as used herein refers to an interaction of two heavy chains having non- identical CH3 amino acid sequences. In some embodiments, the bispecific antibodies are of IgG1 subtype. In some embodiments, the bispecific antibodies comprise a first antigen-binding domain that specifically binds CLDN6, a second antigen-binding domain that specifically binds CD3, and an Fc domain, wherein the Fc domain comprises one or more substitutions in the Fc domain that reduces Fc domain-mediated effector functions. In some embodiments, bispecific antibodies comprise a first antigen-binding domain that specifically binds CLDN6, a second antigen-binding domain that specifically binds CD3, and an Fc domain, wherein the Fc domain is of IgG1 isotype. In some embodiments, the IgG1 isotype Fc domain has one or more substitutions in the Fc domain that reduce effector function and knob-in- 36
[0037] hole mutations. The Fc domain, with reduced effector function and knob-in-hole mutations, IgG1 platform is designed to create bispecific antibodies with reduced or eliminated Fc-mediated effector functions while maintaining the stability, pharmacokinetics, and half-life of the bispecific antibody. This is particularly useful for bispecific antibodies where Fc-mediated effector functions are not desired or could cause unintended side effects. The “knob-in-hole” approach involves the introduction of specific mutations in the constant (CH) region of the heavy chains to promote the preferential pairing of two different heavy chains, typically of different antigenic specificity. (Sun et al., Science Translational Medicine 2015; 7:287ra70; PCT Intl. Publ. No. WO 2006 / 028936). The “knob” mutation creates a protruding amino acid side chain on one heavy chain, while the “hole” mutation generates a cavity on the other heavy chain. The knob fits into the hole, promoting the correct heterodimerization of the two heavy chains. In some embodiments, the “knob” mutation may comprise a mutation of threonine (T) to tyrosine (Y) or T to tryptophan (W) at position 366 (T366Y or T366W) on one heavy chain to create the knob. In some embodiments, the “hole” mutation may comprise mutations of threonine (T) to serine (S) at position 366 (T366S), leucine (L) to alanine (A) at position 368 (L368A), and tyrosine (Y) to serine (S) at position 407 (Y407S) or Y to valine (V) at position 407 (Y407V) on the other heavy chain to create the hole. In some embodiments, T366W functions as a knob mutation in the CD3 binding heavy chain and T366S, L368A and Y407V function as hole mutations in the CLDN6 binding heavy chain in the bispecific antibodies described herein. It is expected that the functionality of the bispecific antibodies is not altered if the knob-hole mutations were reversed in the two heavy chains. In some embodiments, an additional mutation of serine (S) to cysteine (C) at position 354 on one heavy chain and a mutation of tyrosine (Y) to cysteine (C) at position 349 may improve the heterodimerization ratio. In some embodiments, the additional mutations of S354C in the CD3 binding heavy chain and Y349C in the CLDN6 binding heavy chain are also present in the antibodies described herein and may provide for an improved heterodimerization ratio of up to 95%. (Nat. Biotechnol.1998;16(7):677–81). It is expected that functionality of the resulting bispecific antibody is not altered if the S354C and Y349C mutations were reversed in the two heavy chains. Further, in some embodiments, the bispecific antibody comprising a first antigen-binding domain that specifically binds Claudin-6 (CLDN6) and a second antigen-binding domain that specifically binds cluster of differentiation 3 (CD3) comprise one or more substitutions in the Fc domain that reduces its binding to protein A. In some embodiments, H435R and Y436F substitutions are incorporated into the CH3 domain of an antibody heavy chain of the present invention in an asymmetric manner (e.g., 37
[0038] mutations in one heavy chain only). In some embodiments the substitutions H435R and Y436F are in the CH3 domain of a heavy chain comprising a “knob” mutation. In some embodiments, H435R and Y436F substitutions are in a heavy chain comprising a T366W substitution. In some embodiments, H435R and Y436 substitutions are in the CLDN6 binding heavy chain, ablating protein A binding of the bispecific antibody incorporating these mutations. The H435R and Y436F mutations may also be introduced in the CH3 domain of the CD3 binding heavy chain with the same effect. By using this combination of mutations, highly pure monovalent bispecific antibodies can be rapidly purified directly from combined culture media using standard protein A purification. (Pharmaceutics 2019 Dec 18;12(1):3). Other strategies, such as promoting heavy chain heterodimerization using electrostatic interactions by substituting positively charged residues at one CH3 surface and negatively charged residues at a second CH3 surface, may be used, as described in US Pat. Publ. No. US2010 / 0015133; US Pat. Publ. No. US2009 / 0182127; US Pat. Publ. No. US2010 / 028637 or US Pat. Publ. No. US2011 / 0123532, to promote heterodimerization of two heavy chains of different binding specificity. In other such strategies, heterodimerization may be promoted using asymmetric substitutions in the heavy chains as described in U.S. Pat. Publ. No. US2012 / 0149876 or U.S. Pat. Publ. No. US2013 / 0195849. Another embodiment incorporates a VH44-VL100 interchain disulfide bond to increase the stability of the scFv portion of the bispecific antibodies described herein. See Prot. Eng. Des. Sel. 2012;25(7):321-9. In some embodiments, the bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3 comprises a first heavy chain (HC1) that comprises substitutions L234A, L235A, Y349C, T366S, L368A, Y407V, H435R and Y436F and a second heavy chain (HC2) that comprises substitutions L234A, L235A, T366W and S354C, according to EU numbering. In addition to the methods described above, the bispecific antibody comprising a first antigen-binding domain that specifically binds Claudin-6 (CLDN6) and a second antigen-binding domain that specifically binds cluster of differentiation 3 (CD3) described herein may be generated in vitro in a cell-free environment by introducing asymmetrical mutations in the CH3 regions of two mono specific homodimeric antibodies and forming the bispecific heterodimeric antibody from two parent monospecific homodimeric antibodies in reducing conditions to allow disulfide bond isomerization according to methods described in PCT Intl. Pat. Publ. No. W02011 / 131746. In the 38
[0039] methods, the first monospecific antigen-binding molecule (e.g., antibody that specifically binds CLDN6) and the second monospecific antigen-binding molecule (e.g., antibody that specifically binds CD3) are engineered to have certain substitutions at the CH3 domain that promotes heterodimer stability; the antigen-binding molecules are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the bispecific antibody by Fab arm exchange. The incubation conditions may optimally be restored to non-reducing conditions. Exemplary reducing agents that may be used are 2-mercaptoethylamine (2- MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione, tris (2-carboxyethyl) phosphine (TCEP), L-cysteine and beta-mercaptoethanol, preferably a reducing agent selected from the group consisting of: 2-mercaptoethylamine, dithiothreitol and tris (2- carboxyethyl) phosphine. For example, incubation for at least 90 minutes at a temperature of at least 20 °C in the presence of at least 25 mM 2-MEA or in the presence of at least 0.5 mM dithiothreitol at a pH from 5-8, for example at pH of 7.0 or at pH of 7.4 may be used. Also provided herein are isolated nucleic acids encoding the antibody or antigen-binding fragment thereof described herein. “Nucleic acid” refers to a synthetic molecule comprising a chain of nucleotides covalently linked by a sugar-phosphate backbone or other equivalent covalent chemistry. cDNA is an exemplary synthetic polynucleotide. In another general aspect, the disclosure provided herein relates to an isolated nucleic acid encoding a bispecific antibody described herein. It will be appreciated by those skilled in the art that the coding sequence can be altered or codon optimization may be performed without changing the amino acid sequence of the expressed protein, such as an antibody. Accordingly, it will be understood by those skilled in the art that nucleic acid sequences encoding the bispecific antibodies, antibodies or antigen-binding fragments thereof described herein can be altered or codon optimized without changing the amino acid sequences of the expressed antibodies. Also provided herein are vectors comprising an isolated nucleic acid encoding an antibody or antigen-binding fragment thereof described herein. Further provided herein are vectors comprising an isolated nucleic acid encoding a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3 described herein. Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector. In some embodiments, the vector is a recombinant expression vector such as a plasmid. The vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, 39
[0040] and origin of replication. The promoter can be a constitutive, inducible, or repressible promoter. A number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of an antibody or antigen-binding fragment thereof in the cell. Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to embodiments disclosed herein. Such techniques are well known to those skilled in the art in view of the present disclosure. Also provided herein are host cells comprising the vector described herein. Further provided herein is a host cell comprising a vector comprising an isolated nucleic acid encoding a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3 described herein. Any host cell known to those skilled in the art in view of the present disclosure can be used for recombinant expression of the bispecific antibodies, antibodies or antigen-binding fragments thereof described herein. In some embodiments, the host cells are E. coli TG1 or BL21 cells, CHO-DG44, CHO-K1 or HEK293 cells. According to particular embodiments, the recombinant expression vector is transformed into host cells by conventional methods such as chemical transfection, heat shock, or electroporation, where it is stably integrated into the host cell genome such that the recombinant nucleic acid is effectively expressed. Also provided herein are methods of producing an antibody or antigen-binding fragment thereof described herein, comprising culturing a host cell described herein under conditions to produce an antibody or antigen- binding fragment thereof described herein, and purifying the antibody or antigen-binding fragment thereof. Further provided herein are methods of producing a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, comprising culturing a host cell comprising a vector comprising an isolated nucleic acid encoding a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3 under conditions to produce the bispecific antibody, and purifying the bispecific antibody. Expressed bispecific antibodies or antigen-binding fragments thereof can be harvested from the cells and purified according to conventional techniques known in the art. Pharmaceutical Compositions Also provided herein is a pharmaceutical composition comprising an isolated antibody or antigen-binding fragment thereof described herein and a pharmaceutically acceptable carrier. In 40
[0041] another general aspect, the pharmaceutical composition comprises a bispecific antibody described herein and a pharmaceutically acceptable carrier. The term "pharmaceutical composition" as used herein means a product comprising an antibody described herein together with a pharmaceutically acceptable carrier. Antibodies described herein and compositions comprising them are also useful in the manufacture of a medicament for therapeutic applications mentioned herein. As used herein, the term "carrier" refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid, lipid containing vesicle, microsphere, liposomal encapsulation, or other material well known in the art for use in pharmaceutical formulations. It will be understood that the characteristics of the carrier, excipient or diluent will depend on the route of administration for a particular application. As used herein, the term "pharmaceutically acceptable carrier" refers to a non-toxic material that does not interfere with the effectiveness of a composition or the biological activity of a pharmaceutical composition as provided herein. In particular embodiments, any pharmaceutically acceptable carrier suitable for use in an antibody pharmaceutical composition can be used. The formulation of pharmaceutically active ingredients with pharmaceutically acceptable carriers is known in the art, e.g., Remington: The Science and Practice of Pharmacy (e.g., 21st edition (2005), and any later editions). Non-limiting examples of additional ingredients include buffers, diluents, solvents, tonicity regulating agents, preservatives, stabilizers, and chelating agents. One or more pharmaceutically acceptable carriers may be used in formulating the pharmaceutical compositions described herein. Another embodiment described herein provides a pharmaceutical composition formulated as a liquid formulation. An embodiment of a liquid formulation is an aqueous formulation, i.e., a formulation comprising water. The liquid formulation may comprise a solution, a suspension, an emulsion, a microemulsion, a gel, and the like. An aqueous formulation typically comprises at least 50% w / w water, or at least 60%, 70%, 75%, 80%, 85%, 90%, or at least 95% w / w of water. Another embodiment described herein provides a pharmaceutical composition as non- aqueous formulation. Non-aqueous antibody formulations are described in US Pat. No.11,795,429. Another embodiment described herein provides a pharmaceutical composition formulated as an injectable which can be injected, for example, via an injection device (e.g., a syringe or an infusion pump). The injection may be delivered subcutaneously, intramuscularly, intraperitoneally, intravitreally, or intravenously, for example. In another embodiment, the pharmaceutical composition is a solid formulation, e.g., a 41
[0042] freeze-dried or spray-dried composition, which may be used as is, or whereto the physician or the patient adds solvents, and / or diluents prior to use. The dosage forms may be immediate release, sustained release, or modified release. The pH in an aqueous formulation can be between pH 3 and pH 10. In one embodiment described herein, the pH of the pharmaceutical composition is from about 7.0 to about 9.5. In another embodiment described herein, the pH of the pharmaceutical composition is from about 3.0 to about 7.0. In another embodiment described herein, the pharmaceutical composition comprises a buffer. Non-limiting examples of buffers include: arginine, aspartic acid, bicine, citrate, disodium hydrogen phosphate, fumaric acid, glycine, glycylglycine, histidine, lysine, maleic acid, malic acid, sodium acetate, sodium carbonate, sodium dihydrogen phosphate, sodium phosphate, succinate, tartaric acid, tricine, and tris(hydroxymethyl)-aminomethane, and mixtures thereof. The buffer may be present individually or in the aggregate, in a concentration from about 0.01 mg / mL to about 50 mg / mL, for example from about 0.1 mg / mL to about 20 mg / mL. Pharmaceutical compositions comprising any of these specific buffers, alone or in combination, constitute alternative embodiments described herein. Another embodiment described herein provides a pharmaceutical composition comprising a preservative. Non-limiting examples of preservatives include: benzethonium chloride, benzoic acid, benzyl alcohol, bronopol, butyl 4-hydroxybenzoate, chlorobutanol, chlorocresol, chlorohexidine, chlorphenesin, o-cresol, m-cresol, p-cresol, ethyl 4-hydroxybenzoate, imidurea, methyl 4- hydroxybenzoate, phenol, 2- phenoxyethanol, 2-phenylethanol, propyl 4-hydroxybenzoate, sodium dehydroacetate, thiomerosal, and mixtures thereof. The preservative may be present individually or in the aggregate, in a concentration from about 0.01 mg / mL to about 50 mg / mL, for example from about 0.1 mg / mL to about 20 mg / mL. Pharmaceutical compositions comprising any of these specific preservatives, alone or in combination, constitute alternative embodiments described herein. Another embodiment described herein provides a pharmaceutical composition comprising an isotonic agent. Non-limiting examples of the embodiment include a salt (such as sodium chloride), an amino acid (such as glycine, histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, and threonine), an alditol (such as glycerol, 1,2- propanediol propyleneglycol), 1,3-propanediol, and 1,3- butanediol), polyethyleneglycol (e.g., PEG400), and mixtures thereof. Another example of an isotonic agent includes a sugar. Non-limiting examples of sugars may be mono-, di-, or polysaccharides, or water-soluble glucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, alpha- 42
[0043] and beta-HPCD, soluble starch, hydroxyethyl starch, and sodium carboxymethyl- cellulose. Another example of an isotonic agent is a sugar alcohol, wherein the term "sugar alcohol" is defined as a C(4-8) hydrocarbon having at least one -OH group. Non- limiting examples of sugar alcohols include mannitol, sorbitol, inositol, galactitol, dulcitol, xylitol, and arabitol. Pharmaceutical compositions comprising any of the isotonic agents alone or in combination constitute alternative embodiments described herein. The isotonic agent may be present individually or in the aggregate, in a concentration from about 0.01 mg / mL to about 50 mg / mL, for example from about 0.1 mg / mL to about 20 mg / mL. Pharmaceutical compositions comprising any of these specific isotonic agents, alone or in combination, constitute alternative embodiments described herein. Another embodiment described herein provides a pharmaceutical composition comprising a chelating agent. Non-limiting examples of chelating agents include citric acid, aspartic acid, salts of ethylenediaminetetraacetic acid (EDTA) and mixtures thereof. The chelating agent may be present individually or in the aggregate, in a concentration from about 0.01 mg / mL to about 50 mg / mL, for example from about 0.1 mg / mL to about 20 mg / mL. Pharmaceutical compositions comprising any of these specific chelating agents, alone or in combination, constitute alternative embodiments described herein. Another embodiment described herein provides a pharmaceutical composition comprising a stabilizer. Non-limiting examples of stabilizers include one or more aggregation inhibitors, one or more oxidation inhibitors, one or more surfactants, and / or one or more protease inhibitors. Another embodiment described herein provides a pharmaceutical composition comprising a stabilizer, wherein the stabilizer is carboxy-hydroxycellulose and derivates thereof (such as HPC, HPC-SL, HPC-L and HPMC), cyclodextrins, 2-methylthioethanol, polyethylene glycol (such as PEG 3350), polyvinyl alcohol (PVA), polyvinylpyrrolidone, salts (such as sodium chloride), sulfur- containing substances such as monothioglycerol), or thioglycolic acid. The stabilizer may be present individually or in the aggregate, in a concentration from about 0.01 mg / mL to about 50 mg / mL, for example from about 0.1 mg / mL to about 20 mg / mL. Pharmaceutical compositions comprising any of these specific stabilizers, alone or in combination, constitute alternative embodiments described herein. Another embodiment described herein provides a pharmaceutical composition comprising one or more surfactants. The term "surfactant" refers to any molecules or ions that are comprised of a water-soluble (hydrophilic) part, and a fat-soluble (lipophilic) part. The surfactant may, for example, be selected from the group consisting of anionic surfactants, cationic surfactants, nonionic surfactants, and / or zwitterionic surfactants. The surfactant may be present individually or in the 43
[0044] aggregate, in a concentration from about 0.1 mg / mL to about 20 mg / mL. Pharmaceutical compositions comprising any of these specific surfactants, alone or in combination, constitute alternative embodiments described herein. Another embodiment described herein provides a pharmaceutical composition comprising one or more protease inhibitors, such as, e.g., EDTA, and / or benzamidine hydrochloric acid (HCl). The protease inhibitor may be present individually or in the aggregate, in a concentration from about 0.1 mg / mL to about 20 mg / mL. Pharmaceutical compositions comprising any of these specific protease inhibitors, alone or in combination, constitute alternative embodiments described herein. Another embodiment described herein provides a method of producing a pharmaceutical composition comprising a bispecific antibody, antibody or antigen-binding fragment thereof described herein, comprising combining the bispecific antibody, antibody, or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to generate the pharmaceutical composition. In another general aspect, an embodiment described herein relates to a method of producing a pharmaceutical composition comprising a bispecific antibody described herein, comprising combining a bispecific antibody described herein with a pharmaceutically acceptable carrier to generate the pharmaceutical composition. Methods of Use Provided herein are methods comprising administering to a subject a therapeutically effective amount of a pharmaceutical composition comprising a bispecific or multispecific antibody that specifically binds CLDN6 and CD3 of the invention. In some embodiments, the subject is a subject in need thereof. Further provided herein are methods comprising administering to a subject a therapeutically effective amount of a pharmaceutical composition comprising a bispecific or multispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen- binding domain that specifically binds CD3. In some embodiments, the subject is a subject in need thereof. The therapeutically effective amount of a pharmaceutical composition of the disclosure can comprise any of the antibodies or bispecific antibodies as disclosed herein and a pharmaceutically acceptable carrier or diluent. As used herein, the expression “a subject in need thereof” means a human or non-human animal that exhibits one or more symptoms or indicia of cancer (e.g., a subject expressing a tumor or suffering from any of the cancers mentioned herein), or who otherwise would 44
[0045] benefit from an inhibition or reduction in CLDN6 activity or a reduction in number or depletion of CLDN6+cells (e.g., ovarian, endometrial, testicular, liver, lung and gastric cancers). The bispecific antibodies of the disclosure demonstrated robust CLDN6-expressing tumor cell lysis and T cell activation in vitro. It is expected that the bispecific and multispecific antibodies of the disclosure will also demonstrate CLDN-expressing tumor cell lysis in vivo. The antibodies, bispecific antibodies, and multispecific antibodies described herein (and pharmaceutical compositions comprising the same) are useful, inter alia, for treating any disease or disorder in which stimulation, activation and / or targeting of an immune response would be beneficial. In particular, the antibodies specifically binding CLDN6 or the bispecific antibodies or multispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3 described herein may be used for the treatment, prevention and / or amelioration of any disease or disorder associated with or mediated by CLDN6 expression or activity or the proliferation of CLDN6+cells. The mechanism of action by which the therapeutic methods described herein are achieved include killing of the cells expressing CLDN6 by cytolytic activity by CD3+T-cells, clearance of the T cell receptor (TCR) complex from the tumor cell surface and apoptosis or by a combination of two or more of these mechanisms. Cells expressing CLDN6 which can be inhibited or killed using the bispecific antibodies described herein include, for example, ovarian, endometrial, testicular, liver, lung, and gastric cancers. The antibodies, bispecific antibodies, and multispecific antibodies described herein may be used to treat a disease or disorder associated with CLDN6 expression including, e.g., a cancer including ovarian cancer, endometrial cancer, testicular cancer, liver cancer, lung cancer, and gastric cancer. According to certain embodiments, the antibodies that specifically bind CLDN6, or the bispecific antibodies or multispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, are useful for treating a patient afflicted with ovarian cancer. According to other related embodiments, methods are provided comprising administering an antibody that specifically binds CLDN6, or a bispecific antibody or multispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, to a patient who is afflicted with ovarian cancer. Analytic / diagnostic methods known in the art, such as pelvic examination, ultrasound scan, computed tomography (CT) scan, and screening for the tumor antigen CA125 in blood may be used to ascertain whether a patient harbors an ovarian cancer. Also provided herein are methods for treating advanced cancer in a subject. As used herein, “advanced cancer” refers to a cancer which has grown beyond its original location. An advanced 45
[0046] cancer may be “locally advanced,” in which the cancer has spread outside the body part it originated in, but has not yet spread to other parts of the body, or “metastatic,” in which the cancer has spread to other parts of the body. Also provided herein are methods for treating refractory cancer in a subject. As used herein, the term “refractory cancer” refers to a cancer that has not responded to a treatment or has become resistant to said treatment. Also provided herein are methods for treating unresectable cancer in a subject. As used herein, the term “unresectable cancer” refers to a cancer that cannot be removed with surgery. Also provided herein are methods for treating residual cancer in a subject. As used herein, the term “residual cancer” means the existence or persistence of one or more cancerous cells in a subject following treatment with an anti-cancer therapy. As used herein, the terms "treat," "treating," and "treatment" are all intended to refer to an amelioration or reversal of at least one measurable physical parameter related to a disease or disorder, e.g., cancer. According to particular embodiments described herein, the therapeutically effective amount of pharmaceutical compositions administered to treat a subject are sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of the disease, disorder or condition to be treated or a symptom associated therewith; (ii) reduce the duration of the disease, disorder or condition to be treated, or a symptom associated therewith; (iii) prevent the progression of the disease, disorder or condition to be treated, or a symptom associated therewith; (iv) cause regression of the disease, disorder or condition to be treated, or a symptom associated therewith; (v) prevent the development or onset of the disease, disorder or condition to be treated, or a symptom associated therewith; (vi) prevent the recurrence of the disease, disorder or condition to be treated, or a symptom associated therewith; (vii) reduce hospitalization of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (viii) reduce hospitalization length of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (ix) increase the survival of a subject with the disease, disorder or condition to be treated, or a symptom associated therewith; (xi) inhibit or reduce the disease, disorder or condition to be treated, or a symptom associated therewith in a subject; and / or (xii) enhance or improve the prophylactic or therapeutic effect(s) of another therapy. The dosage of the therapeutically effective amount of the pharmaceutical composition can vary according to various factors, such as the disease, disorder or condition to be treated, the means of administration, the target site, the physiological state of the subject (including, e.g., age, body 46
[0047] weight, health), other medications administered, and whether the treatment is prophylactic or therapeutic. Treatment dosages are optimally titrated to optimize safety and efficacy. Administration Regimens According to certain embodiments provided herein, multiple doses of antibodies that specifically bind CLDN6, or bispecific antibodies or multispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, described herein may be administered to a subject over a defined time course. The methods according to this aspect comprise sequentially administering to a subject multiple doses of an antibody as described herein. As used herein, “sequentially administering” means that each dose of an antibody is administered to the subject at a different point in time, e.g., on different days separated by a predetermined interval (e.g., hours, days, weeks, or months). Also provided herein are methods which comprise sequentially administering to the patient a single initial dose of an antibody, followed by one or more secondary doses of the antibody and optionally followed by one or more tertiary doses of the antibody. The terms “initial dose,” “secondary doses,” and “tertiary doses,” refer to the temporal sequence of administration of the bispecific antibody of the disclosure. Thus, the “initial dose” is the dose which is administered at the beginning of the treatment regimen (also referred to as the “baseline dose”); the “secondary doses” are the doses which are administered after the initial dose; and the “tertiary doses” are the doses which are administered after the secondary doses. The initial, secondary, and tertiary doses may all contain the same amount of the antigen-binding molecule, but generally may differ from one another in terms of frequency of administration. In other embodiments, the amount of an antibody contained in the initial, secondary, and / or tertiary doses varies from one another (e.g., adjusted up or down as appropriate) during the course of treatment. In certain embodiments, two or more (e.g., 2, 3, 4, or 5) doses are administered at the beginning of the treatment regimen as “loading doses” followed by subsequent doses that are administered on a less frequent basis (e.g., “maintenance doses”). The methods according to this aspect may comprise administering to a patient any number of secondary and / or tertiary doses of an antibody that specifically binds CLDN6, or a bispecific antibody or multispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, described herein. The frequency of administration may also be adjusted during the course of treatment by a physician depending on the needs of the individual patient following clinical examination. 47
[0048] Diagnostic Use The antibodies and antigen-binding fragments thereof, and the bispecific antibodies described herein may also be used for diagnostic purposes, such as detecting CLDN6-positive cancer cells in a patient. Thus, further provided herein are diagnostic compositions comprising an antibody that specifically binds CLDN6 or antigen-binding fragments thereof, or the bispecific antibodies or multispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3 as described herein. In one embodiment, a kit is provided for diagnosis of CLDN6-positive cancer comprising a container comprising an antibody that specifically binds CLDN6 or antigen-binding fragments thereof, or the bispecific antibody or multispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, described herein and one or more reagents for detecting binding of the antibody to CLDN6. Reagents may include, e.g., fluorescent tags, enzymatic tags, or other detectable tags. The reagents may also include secondary or tertiary antibodies or reagents for enzymatic reactions, wherein the enzymatic reactions produce a product that may be visualized. For example, the antibodies that specifically bind CLDN6 or antigen-binding fragments thereof, or the bispecific antibodies or multispecific antibodies comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3 described herein described herein, may be labeled with a radiolabel, a fluorescent label, an epitope tag, biotin, a chromophore label, an electrochemiluminescent (ECL) label, an enzyme, ruthenium, diethylenetriaminepentaacetic acid (DTPA), horseradish peroxidase, alkaline phosphatase and beta-galactosidase, or poly-histidine or similar such labels known in the art. The antibodies that specifically bind CD3 are useful for detecting CD3 expressing cells in vitro or in vivo using known methods. 48
[0049] EMBODIMENTS This disclosure provided herein provides the following non-limiting embodiments. Anti-CLDN6×CD3 embodiments Embodiment 1 is a bispecific antibody comprising a first antigen-binding domain that specifically binds Claudin-6 (CLDN6) and a second antigen-binding domain that specifically binds cluster of differentiation (CD3), wherein the first antigen-binding domain binds an epitope of CLDN6 (SEQ ID NO:1) comprising glutamine 156 (Q156). Embodiment 2 is the bispecific antibody of embodiment 1, wherein the second antigen- binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid in at least one of: SEQ ID NO:27-31 and an epitope of CD3δ (SEQ ID NO:22) comprising at least one amino acid in SEQ ID NO:32. Embodiment 3 is the bispecific antibody of embodiment 1 or 2, wherein the second antigen- binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid sequence selected from SEQ ID NO:27-31 and an epitope of CD3δ (SEQ ID NO:22) comprising SEQ ID NO:32. Embodiment 4 is the bispecific antibody of any one of embodiments 1-3, wherein the second antigen-binding domain specifically binds an epitope of CD3ε comprising SEQ ID NOs:27-31 and an epitope of CD3δ comprising SEQ ID NO:32. Embodiment 5 is the bispecific antibody of any one of embodiments 1-4, wherein the first antigen binding comprises: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% 49
[0050] identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Embodiment 6 is the bispecific antibody of any one of embodiments 1-5, wherein the first antigen-binding domain comprises: a) an HCDR1, HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) an LCDR1, LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Embodiment 7 is the bispecific antibody of any one of embodiments 1-6, wherein the second antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Embodiment 8 is the bispecific antibody of any one of embodiments 1-7, wherein the antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:12, 13, and 14, respectively, and b) a LCDR1, LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:15, 16, and 17, respectively. Embodiment 9 is a bispecific antibody comprising a first antigen-binding domain that specifically binds Claudin-6 (CLDN6) and a second antigen-binding domain that specifically binds 50
[0051] cluster of differentiation 3 (CD3), wherein the first antigen-binding domain comprises: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Embodiment 10 is the bispecific antibody of embodiment 9, wherein the first antigen- binding domain comprises: a) an HCDR1, HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) an LCDR1, LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Embodiment 11 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a heavy chain variable region (VH) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% 51
[0052] identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:9. Embodiment 12 is the bispecific antibody of embodiment 11, wherein the first antigen- binding domain comprises: a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:9. Embodiment 13 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the CD3 binding domain comprises a heavy chain (HC) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:20. Embodiment 14 is the bispecific antibody of embodiment 13, wherein the CD3 binding domain comprises a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO:20. Embodiment 15 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% 52
[0053] identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Embodiment 16 is the bispecific antibody of embodiment 15, wherein the first antigen- binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Embodiment 17 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a VH comprising an amino acid sequence having at least 50% identity, at least 53
[0054] 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:8; and b) a VL comprising an amino acid sequence at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Embodiment 18 is the bispecific antibody of embodiment 17, wherein the first antigen- binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and 54
[0055] d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Embodiment 19 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a heavy chain (HC) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:10; and b) a light chain (LC) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:11; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Embodiment 20 is the bispecific antibody of embodiment 19, wherein the first antigen- 55
[0056] binding domain comprises: a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO:10; and b) a light chain (LC) comprising the amino acid sequence of SEQ ID NO:11; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively. Embodiment 21 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises a single chain variable chain (scFv) comprising an amino acid sequence at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:18. Embodiment 22 is the bispecific antibody of embodiment 21, wherein the first antigen- 56
[0057] binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises a single chain variable chain (scFv) comprising the amino acid sequence of SEQ ID NO:18. Embodiment 23 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises a HC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:20. Embodiment 24 is the bispecific antibody of embodiment 23, wherein the first antigen- binding domain comprises: 57
[0058] a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence of SEQ ID NOs:2, 3, and 4, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively; and wherein the second antigen-binding domain comprises a HC comprising the amino acid sequence of SEQ ID NO:20. Embodiment 25 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a VH comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:8; and b) a VL comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a scFv comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:18. Embodiment 26 is the bispecific antibody of embodiment 25, wherein the first antigen- binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a scFv comprising the amino 58
[0059] acid sequence of SEQ ID NO:18. Embodiment 27 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the first antigen-binding domain comprises: a) a VH comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:8; and b) a VL comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a HC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:20. Embodiment 28 is the bispecific antibody of embodiment 27, wherein the first antigen- binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a HC comprising the amino acid sequence of SEQ ID NO:20. Embodiment 29 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the bispecific antibody comprises: a) a HC comprising an amino acid sequence having at least 50% identity, at least 59
[0060] 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:11; and c) a scFv comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:18. Embodiment 30 is the bispecific antibody of embodiment 29, wherein the bispecific antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence of SEQ ID NO:11; and c) a scFv comprising an amino acid sequence of SEQ ID NO:18. Embodiment 31 is a bispecific antibody comprising a first antigen-binding domain that specifically binds CLDN6 and a second antigen-binding domain that specifically binds CD3, wherein the bispecific antibody comprises: a) a HC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% 60
[0061] identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:11; and c) a second heavy chain (HC2) comprising an amino acid sequence at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:20. Embodiment 32 is a bispecific antibody of embodiment 30, wherein the bispecific antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence of SEQ ID NO:11; and c) a second heavy chain (HC2) comprising an amino acid sequence of SEQ ID NO:20. Embodiment 33 is the anti-CD3 antibody of any one of embodiments 1-32, wherein the antibody comprises from 1 to 10, from 1 to 5, or from 1 to 2 amino acid substitutions across all framework regions. Embodiment 34 is the anti-CD3 antibody of any one of embodiments 1-33, wherein the antibody comprises amino acid substitutions across all framework regions. Embodiment 35 is the anti-CD3 antibody of any one of embodiments 1-34, wherein the antibody comprises from 1 to 10, from 1 to 5, or from 1 to 2 amino acid substitutions across all six CDR regions. Embodiment 36 is the anti-CD3 antibody of any one of embodiments 1-35, wherein the antibody comprises 1 or 2 amino acid substitution across all six CDR regions. Embodiment 37 is the anti-CD3 antibody of embodiment 33 or 34, wherein the amino acid substitutions are not in a CDR region. Embodiment 38 is the anti-CD3 antibody of any one of embodiments 1-37, wherein the amino acid substitutions are all conservative amino acid substitutions. Embodiment 39 is the bispecific antibody of any one of embodiments 1-38, wherein the first antigen-binding domain does not have cross-reactivity to human CLDN3, CLDN4 or CLDN9. Embodiment 40 is the bispecific antibody of any one of embodiments 1-39, wherein the 61
[0062] first-antigen-binding domain does not have any cross-reactivity to human CLDN3, CLDN4, or CLDN9 at a concentration up to 300 nM. Embodiment 41 is the bispecific antibody of any one of embodiments 1-40 wherein the first antigen-binding domain binds CLDN6 binds CLDN6 with a KDof 10-200 nM on CHO-CLDN6 overexpressing cells as measured by flow cytometry. Embodiment 42 is the bispecific antibody of any one of embodiments 1-41, wherein the first antigen-binding domain that binds CLDN6 binds CLDN6 with a KDof 10-100 nM. Embodiment 43 is the bispecific antibody of any one of embodiments 1-42, wherein the first antigen-binding domain that binds CLDN6 binds CLDN6 with a KD of about 23 nM. Embodiment 44 is the bispecific antibody of any one of embodiments 1-43, wherein the second antigen-binding domain does not bind cynomolgus monkey cells expressing cynomolgus CD3. Embodiment 45 is the bispecific antibody of any one of embodiments 1-44, wherein the second antigen-binding domain binds CD3 with a KDof 10-200 nM M as measured in a surface plasmon resonance assay at 25 °C. Embodiment 46 is the bispecific antibody of any one of embodiments 1-45, wherein the second antigen-binding domain that binds CD3 with a KDof 20-100 nM. Embodiment 47 is the bispecific antibody of any one of embodiments 1-46, wherein the second antigen-binding domain comprises a single-chain antibody. Embodiment 48 is the bispecific antigen-binding molecule of embodiment 47, wherein the single-chain antibody comprises a single-chain variable fragment (scFv) comprising the amino acid sequence of SEQ ID NO:18. Embodiment 49 is the bispecific antibody of any one of embodiments 1-48, which is an IgG1 subtype. Embodiment 50 is the bispecific antibody of any one of embodiments 1-49, comprising an Fc domain comprising one or more substitutions in the Fc domain that reduce F domain-mediated effector function, reduce binding to protein A, or improve bispecific antibody production. Embodiment 51 is the bispecific antibody of embodiment 50, wherein the one or more substitutions in the Fc domain, using residue numbering according to EU numbering, comprises H435R, Y436F, T366S / L368A / Y407V, T366W, S354C, Y349C, L234A, or L235A. Embodiment 52 is the bispecific antibody of any one of embodiments 1-51, which binds both human T-cells and CLDN-6 expressing cells. Embodiment 53 is the bispecific antibody of any one of embodiments 1-52, which induces 62
[0063] T-cell mediated cytotoxicity of CLDN6+ovarian cancer cell lines. Embodiment 54 is the bispecific antibody of any one of embodiments 1-53, which induces T-cell mediated cytotoxicity of OVCAR3 cancer cell lines. Embodiment 55 is the bispecific antibody of any one of embodiments 1-54, which induces T-cell mediated cytotoxicity of PA-1 cancer cell lines. Embodiment 56 is the bispecific antibody of any one of embodiments 1-55, which induces T-cell mediated cytotoxicity of OV-90 cancer cell lines. Embodiment 57 is the bispecific antibody of any one of embodiments 1-56, which induces T-cell activation and proliferation. Embodiment 58 is the bispecific antibody of any one of embodiments 1-57, which activates cytokine release. Embodiment 59 is a pharmaceutical composition comprising the bispecific antibody of any one of embodiments 1-58 and a pharmaceutically acceptable carrier. Embodiment 60 is an isolated nucleic acid encoding the bispecific antigen-binding molecule of any one of embodiments 1-58. Embodiment 61 is a vector comprising the isolated nucleic acid of embodiment 60. Embodiment 62 is a host cell comprising the vector of embodiment 61. Embodiment 63 is a method of producing the isolated bispecific antibody of any one of embodiments 1-58, comprising culturing a host cell of embodiment 62 under conditions to produce the bispecific antibody, and purifying the bispecific antibody. Anti-CLDN6 embodiments Embodiment 64 is an isolated antibody or antigen-binding fragment thereof that specifically binds CLDN6, antibody or antigen-binding fragment thereof binds an epitope of CLDN6 comprising glutamine 156 (Q156) of wildtype CLDN6 (SEQ ID NO:1). Embodiment 65 is the isolated antibody or antigen-binding fragment thereof of embodiment 64 comprising: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% 63
[0064] identity to the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Embodiment 66 is the antibody antigen-binding fragment thereof of embodiment 64 or 65 comprising: a) an HCDR1, HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) an LCDR1, LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Embodiment 67 is an isolated antibody or antigen-binding fragment thereof that specifically binds CLDN6 comprising: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Embodiment 68 is the isolated antibody or antigen binding fragment of embodiment 67 comprising: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3 64
[0065] comprising the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively. Embodiment 69 is an isolated antibody or antigen-binding fragment thereof that specifically binds CLDN6 comprising: a) a heavy chain variable region (VH) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:9. Embodiment 70 the isolated antibody or antigen-binding fragment thereof of embodiment 69 comprising: a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:9. Embodiment 71 is an isolated antibody or antigen-binding fragment thereof that specifically binds CLDN6 comprising: a) a heavy chain comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:10; and b) a light chain comprising an amino acid sequence having at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 65
[0066] 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the amino acid sequence of SEQ ID NO:11. Embodiment 72 is the isolated antibody or antigen-binding fragment thereof of embodiment 71 comprising: a) a heavy chain comprising the amino acid sequence of SEQ ID NO:10; and b) a light chain comprising the amino acid sequence of SEQ ID NO:11. Embodiment 73 is the anti-CD3 antibody of any one of embodiments 64-72, wherein the antibody comprises from 1 to 10, from 1 to 5, or from 1 to 2 amino acid substitutions across all framework regions. Embodiment 74 is the anti-CD3 antibody of any one of embodiments 64-73, wherein the antibody comprises amino acid substitutions across all framework regions. Embodiment 75 is the anti-CD3 antibody of any one of embodiments 64-73, wherein the antibody comprises from 1 to 10, from 1 to 5, or from 1 to 2 amino acid substitutions across all six CDR regions. Embodiment 76 is the anti-CD3 antibody of any one of embodiments 64-74 wherein the antibody comprises 1 or 2 amino acid substitution across all six CDR regions. Embodiment 77 is the anti-CD3 antibody of embodiment 73 or 74, wherein the amino acid substitutions are not in a CDR region. Embodiment 78 is the anti-CD3 antibody of any one of embodiments 64-77, wherein the amino acid substitutions are all conservative amino acid substitutions. Embodiment 79 is the isolated antibody or antigen-binding fragment of any one of embodiments 64-78 wherein the isolated antibody or antigen-binding fragment specifically binds CLDN6 and does not bind human CLDN3, CLDN4 or CLDN9. Embodiment 80 is the isolated antibody or antigen-binding fragment of any one of embodiments 64-79 wherein the isolated antibody or antigen-binds CLDN6 does not have any cross-reactivity to human CLDN3, CLDN4, or CLDN9 at a concentration up to 300 nM. Embodiment 81 is an isolated antibody or antigen-binding fragment of any one of embodiments 64-80 wherein the isolated antibody or antigen-binding fragment binds human CLDN6 with a binding KD of 10-200 nM on CHO-CLDN6 overexpressing cells as measured by flow cytometry. Embodiment 82 is the isolated antibody or antigen-binding fragment of any one of 66
[0067] embodiments 64-81, wherein the isolated antibody or antigen-binding fragment binds CLDN6 with a binding KD of 10-100 nM. Embodiment 83 is the isolated antibody or antigen-binding fragment of any one of embodiments 64-82, wherein the isolated antibody or antigen-binding fragment binds CLDN6 with a KD of about 23 nM. Embodiment 84 is an isolated nucleic acid encoding the antibody or antigen-binding fragment thereof of any one of embodiments 64-83. Embodiment 85 is a vector comprising the isolated nucleic acid of embodiment 84. Embodiment 86 is a host cell comprising the vector or embodiment 85. Methods of treatment Embodiment 87 is a method of treating a CLDN6 expressing cancer in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the pharmaceutical composition of embodiment 59. Embodiment 88 is the method of embodiment 87, wherein the cancer is a solid tumor. Embodiment 89 is the method of embodiment 87 or 88, wherein the cancer is ovarian, endometrial, testicular, liver, lung, or gastric cancer. EXAMPLES Example 1: CLDN6 Binder Generation SJL and BALB / c mice were immunized with a pVAX (Invitrogen) CLDN6 vector incorporating the human CLDN6 ECD sequence (UniProt ID: P56747). Antibody titers were assessed by flow cytometry with titration of individual animal immune serum on a CHO-CLDN6 overexpressing cell line and parental cell line throughout the course of the immunization. The animals with the best test bleed titers were selected for B cell isolation and culture, followed by primary screening by flow cytometry on CHO-CLDN6 cells. Top binders were advanced for secondary screening by flow cytometry to verify CLDN6 specificity and cross-reactivity with CHO- CLDN9 overexpressing cells. The top 48 CLDN6-specific B cells with minimal binding to CLDN9 were selected for cloning and sequencing to recover the V region sequence. The recovered heavy and light variable region sequence for each antibody were transfected and expressed in CHO cells, followed by the screening of cell culture supernatants by flow cytometry to confirm recombinant antibodies retain CLDN6 specificity. The 48 CLDN6 binders were screened by flow cytometry 67
[0068] against CHO cells expressing closely related proteins CLDN3, CLDN4, and CLDN9. Of the 48 binders, 19 were selected for additional screening against CLDN6 vs CLDN9 (Table 2). Of these, one binder demonstrated substantial binding to CDLN6 without any observable binding to CLDN3, CLDN4, and CLDN9. Table 2: Antibody Binding to CLDN6 and CLDN9 To gain further insight into the molecular features underlying the specificity of 51H102 for CLDN6 over CLDN9, site-directed mutagenesis was performed at the three amino acid positions that differ in their ECDs to enable epitope mapping at the residue level (Figure 2). A total of six CLDN6 / CLDN9 hybrid constructs were generated by substituting the CLDN6 residues with the corresponding CLDN9 residues at each differing position. These included three single-point mutants (M29L, R145Q, and Q156L) and three double-point mutants (M29L+R145Q, M29L+Q156L, and R145Q+Q156L), along with wide-type CLDN6 and CLDN9 controls. All constructs were cloned into the pcDNA3.1 vector and transiently expressed in SKOV3 cells, which lack endogenous CLDN6 or CLDN9 expression, and antibody binding was assessed by flow cytometry. In addition to 51H102, a similarly high-affinity CLDN6 binder 112H105, which exhibits 50% cross-reactivity with CLDN9, was included to further evaluate the role of these residues in 68
[0069] determining binding specificity. Anti-CLDN6 antibodies (100 nM) were incubated with each transfected cell line for 1 hour at 4 °C. Cells were washed with PBS, and the bound antibodies were stained with PE-conjugated polyclonal goat anti-human IgG (Abcam, Cat# ab98596) for 1 hour at 4 °C. Samples were acquired in the PE channel on the Novocyte Flow Cytometer (Agilent Technologies). Data were analyzed using NovoExpress software (Agilent Technologies, version 1.2.5). The antibody binding percentage to mutants relative to wild-type CLDN6 was calculated by subtracting the binding signal from untransfected cells and dividing by the binding signal from wild-type CLDN6 cells. To define the molecular basis of 51H102 binding specificity, site-directed mutagenesis was performed at the three amino acid positions in the ECDs that differ between CLDN6 and CLDN9, enabling epitope mapping at the residue level (Figure 2). Six CLDN6 / CLDN9 hybrid constructs were generated by substituting CLDN6 residues with their CLDN9 counterparts, including three single-point mutants (M29L, R145Q, and Q156L) and three double-point mutants (M29L+R145Q, M29L+Q156L, and R145Q+Q156L), along with wild-type CLDN6 and CLDN9 controls. Constructs were transiently expressed in SKOV3 cells, which lack endogenous CLDN6 and CLDN9 expression, and antibody binding was assessed via flow cytometry. In addition to 51H102, a similarly high-affinity CLDN6 binder 112H105, which exhibits 50% cross-reactivity with CLDN9, was included as a comparator. The results showed that both M29L and Q156L mutations impaired 51H102 binding to CLDN6 (Figure 3). The Q156L substitution completely abolished binding, while M29L reduced binding by an approximate 50%. R145Q alone had no effect; however, when combined with Q156L, CLDN6 binding was entirely lost. Similarly, the M29L+Q156L double abolished binding, mirroring the single Q156L effect. In contrast, the M29L+ R145Q mutant reduced binding by an approximate 50%, comparable to the single M29L mutant. These findings indicate that Q156 in ECD2 is the primary contact residue for 51H102, with M29 in ECD1 also contributing to CLDN6 recognition, consistent with binding to a conformational epitope spanning both ECD domains. Data from the CLDN9-cross-reactive binder 112H105 showed a similar trend, with both M29 and Q156 contributing to CLDN6 binding but with differential effects on CLDN9. The Q156L substitution, as well as its double mutants M29L+Q156L and R145Q+Q156L, significantly impaired binding to CLDN6 (Figure 3). Unlike 51H102, for which Q156L completely abolished CLDN6 binding, this mutation reduced 112H105 binding to CLDN6 by 70–80% while also decreasing binding to CLDN9 by an approximate 50%. In contrast, the M29L single and its M29L+ R145Q mutant had no negative impact on CLDN9 but reduced CLDN6 binding by an approximate 30%. Collectively, these results indicate that Q156 is a critical determinant for 69 interactions with both CLDN6 and CLDN9, while 51H102 achieves exquisite specificity by recognizing Q156 together with M29 in a CLDN6-specific conformational context. Example 2: CD3 Binder Generation and Conversion to scFv Format Human immunoglobulin Kappa-Lambda mice (Ablexis®; AlivaMab, LLC.) transgenic mice were immunized with human CD3 epsilon / delta heterodimer protein and primary human T cells. Titers were assessed by flow cytometry with titration of individual animal immune serum on parental Jurkat and Jurkat KO cells throughout the course of the immunization. The animals with the best test bleed titers were selected for hybridoma generation in which the lymph nodes and spleen were pooled and processed for B-cell enrichment prior to electrofusion hybridoma generation. The plated hybridomas were screened by flow cytometry on Jurkat parental and Jurkat KO cells in a primary screen.93 hybridomas were advanced to confirmatory screening via binding to human pan T cells, ELISA binding to human CD3 epsilon / delta, human CD3 epsilon / gamma, and cyno CD3 epsilon / delta heterodimer proteins, as well as off-target analysis by Octet using the same proteins.52 representative hybridomas were selected for subcloning, and 39 subclones with the most promising preliminary results were obtained for molecular recovery and sequencing of heavy and light variable regions. Binding Screening on Jurkat and Pan T Cells: Multiplex screening on Jurkat WT (ATCC), Jurkat RT3-T3.5 CD3-KO (ATCC), and human pan T cells (Stemcell, Cat# 70024) were performed on an iQue3 cytometer.50 µL of neat hybridoma supernatant from each clone was added to cells seeded at 50K per well and incubated for 30 minutes at 4 °C, followed by washing twice with FACS buffer and incubation with a secondary goat anti-mouse IgG Fc-647 (Jackson, Cat# 115-606-071) detection antibody for 30 minutes at 4 °C. Upon final washing with the FACS buffer, the data was acquired on the cytometer. Cell binding results are displayed in Table 3. Table 3: Cell Binding Screen of CD3 Binders Binding to Jurkat cells Binding to Pan T cells
[0070] CD3 Protein Binding Screen: ELISA assays for direct protein binding were performed using a capture format coated with 1 µg / mL anti-huFc (Jakson, Cat# 109-007-008). Each 1 µg / mL in- house produced human CD3 E / D (epsilon delta)-Fc, human CD3 E / G (epsilon gamma)-Fc, cyno CD3 E / D (epsilon delta)-Fc, and huIgG Fc protein (Jackson, Cat# 009-000-008) was added to the well containing the anti-huFc surface, followed by the addition of hybridoma supernatants, and the secondary HRP-Goat Anti-Mouse IgG (Jackson, Cat# 115-035-164) for detection. Protein binding results are depicted in Table 4. For lower cytotoxicity, antibodies that demonstrated minimal binding to cyno CD3 were favored over those which displayed significant binding to cyno CD3. The CD3-TCR complex is made of multiple protein chains, in addition to TCR chains, it comprises epsilon, delta, and gamma chains. While the TCR confers the binding specificity for targets, the CD3 subunits facilitate signal transduction necessary for T cell activation. While the mechanisms through which antigen sensing and signal transduction occur in the CD3–TCR complex 71 are still under debate, recent revelations regarding the intricate 3D structure of the CD3–TCR complex open the possibility of modulating its activity by designing targeted drugs and tools. Aptamers and other CD3 binders that can activate this complex can bind to one of these chains or multiple chains. It is believed that different epitopes of CD3 can confer different functionality (Menon, A. P., et al., 2023, Cancers, 15(4):1189). Currently almost all the CD3 engagers target only one epitope identified by CD3 antibody SP34 on the epsilon chain (Martin, G., et al., 2020, J Immunother Cancer, 8(Suppl 3):A7-A8) The various CD3 binders generated here recognize different epitopes on the CD3 complex. To identify the epitope diversity, proteins that either contained epsilon and delta chain or epsilon and gamma chain were used. It was reasoned that if a binder binds both proteins, it is most likely identifying only the epsilon chain. If, however, it recognizes only one of the proteins the majority of its binding epitope is being contributed by the non-epsilon chain (either delta or gamma). Table 4: CD3 Binding Fold Fold Fold
[0071] Binding Affinity for Human CD3: Binding kinetics of the identified CD3 binders to human CD3 proteins were determined on an Octet using anti-mouse Fc capture (AMC) sensors (Sartorius, Cat# 18-5088). Each hybridoma supernatant was diluted 1:3 in kinetics buffer and loaded onto the AMC sensor, followed by the binding measurement to 200 nM human CD3 E / D (epsilon delta)-Fc or human CD3 E / G (epsilon gamma)-Fc protein in solution. The experimental setup included a 180s sensor equilibration step, a 120s baseline step, a 300s loading step, a 240s association step, and a 360s dissociation step with a 120s regeneration step in between each loading-binding cycle. The collected data were referenced using a parallel buffer blank subtraction, and the baseline was aligned to the y-axis prior to fitting using a 1:1 Langmuir kinetic model. The kinetic parameters include kon the association rate constant for the antibody-antigen binding reaction, koff the dissociation rate constant of the antibody-antigen complex, and KD the equilibrium dissociation constant defined by koff / kon. Binding affinity data for the identified CD3 binders is shown in Table 5. Table 5: Human CD3 Binding Affinity Hu CD3 E / D Hu CD3 E / G
[0072] Bispecific Antibody Design: For flexibility in the design of bispecific and multispecific antibodies, the CD3 binders were converted to an scFv VL-linker-VH format, with a standard linker. In order to determine which of the scFvs would be able to stably bind CD3, the scFvs were used to form a test bispecific antibody with the scFv conjugated to an Fc domain and coupled with a tumor antigen-binding Fab conjugated to an Fc. Heterodimerization was achieved by incorporation of “knob” and “hole” substitutions in Fc domains. The test bispecific antibodies were analyzed for thermostability, and of the anti-CD3 binders, four (01C03A, 08M15A, 14C10A, and 14E03A) demonstrated high thermostability (Tm >60 °C) scFvs in a VL-linker-VH orientation (Table 6), These four CD3 binders were then engineered to further increase stability, with a linker sequence of GGSEGKSSGSGSESKSTGGS (SEQ ID NO:19), and with the amino acids at positions VH44 and VL100 (Kabat numbering) substituted with cysteines. The C-terminus of the anti-CD3 scFv was conjugated to a human IgG1 Fc domain. Of the four anti-CD3 binders, upon formation of anti- CD3×anti-CLDN6 bispecific antibodies, antibody Ab897, comprising the VH and VL of 14C10, demonstrated moderate CD3 binding which resulted in the best targeted cell killing of the four bispecific antibodies. Ab897 comprises the CD3-binding domain of 14C10 and the CLDN6-binding domain of 51H102 / 51K301 of Table 2. Table 6: CD3 scFv Thermostability Clone Name Tm(°C) KDat RT (nM) 74
[0073] Binding sites on CD3 engaged by 14C10A were subsequently mapped by hydrogen- deuterium exchange mass spectrometry (HDX-MS),A mixture containing Ab897 and human CD3εδ (ACROBiosystems, Cat# CDD-H52W1) was prepared at a 1:1.3 molar ratio, with concentrations of 10.5 µM and 8.1 µM, respectively. The deuterium exchange reaction was initiated by mixing 10 µl of the mixture solution or 10 µL of CD3 alone into 90 µL of deuterium oxide labeling buffer (50 mM sodium phosphate, 100 mM sodium chloride, pH 7.0). The reaction was incubated for 0 s, 15 s, 60 s, 600 s, and 3600 s at 20°C, and then quenched by adding 100 µL of 4 M Guanidine HCl, 0.85 M TCEP buffer to the fully deuterated samples. The quenched samples were subjected to on-column pepsin and prolyl endopeptidase digestion, followed by LC-MS analysis using a UPLC-MS system consisting of a Waters Acquity UPLC coupled to an Orbitrap Exploris™ 240 Mass Spectrometer (Thermo Scientific). Peptide identification was performed by searching the MS / MS data against the sequences of human CD3 using Protein Metrics. The mass tolerance for the precursor and product 75
[0074] ions was set to 10 ppm and 0.02 Da, respectively. For the analysis of H / D exchange MS data, HDX WorkBench was used to calculate the deuterium uptake level of individual peptides by determining the mass difference between the deuterated peptide and its native form. Peptides exhibiting a significantly reduced average percentage of deuterium uptake in the presence of Ab897 were considered the epitope. HDX revealed interactions with both the CD3ε and CD3δ subunits (Figure 4). Comparative deuterium uptake analysis between the 14C10A / CD3εδ complex and CD3εδ alone identified the primary binding regions on CD3ε [UniProt ID: P07766] as residues 54-58 (GSEIL, SEQ ID NO:27) and 98-106 (CYPRGSKPE, SEQ ID NO:28), marked by significant reductions in deuterium uptake. Additional residues 48-54 (TCPQYP, SEQ ID NO:29), 92-97 (QSGYYV, SEQ ID NO:30), and 107-116 (DANFYLYLRA, SEQ ID NO:31) were considered peripheral interaction regions due to moderate reductions observed. Similarity, a substantial decrease in deuterium uptake was observed on CD3δ [UniProt ID: P04234] at residues 57-71 (RLDLGKRILDPRGIY, SEQ ID NO:32) upon 14C10A binding. Example 3: Expression, purification, and characterization of a CLDN6xCD3 bispecific antibody Large-scale expression Transient transfection of Ab897 constructs was performed in ExpiCHO-S™ (Thermo-Fisher Scientific) cells at 4 L scale. Ab897 comprises an HC1 comprising the amino acid sequence of SEQ ID NO:10, an LC comprising the amino acid sequence of SEQ ID NO:11 and an HC2 comprising the amino acid sequence of SEQ ID NO:20. Three plasmid DNA were co-transfected for the expression of Ab897: Table 7: Plasmid DNA for expression Plasmid Concentration (ng / µL) The three plasmid DNAs were co-transfected in the ratio of 1×Knob, 2×Hole, 3×LC. Total 3.2 mg of DNA mixture was prepared to transfect 3.2 L of cells (1 mg DNA / L). Table 8: Transient transfection details Host cell line ExpiCHO-S™ P b C ll d f t f ti 17 76
[0075] Cells were maintained at cell density of (0.25-6.0)×106cells / mL with viability of ≥ 95% for routine maintenance and incubated at 37 °C with 8% CO2 at 100 RPM. Transfection ExpiCHO Max Titer Transfection Protocol was followed as per the manufacturer’s instructions. Twenty-four hours before transfection, ExpiCHO-S™ Cells with cell viability of >99%, were centrifuged at 800 RPM for 5 minutes and re-suspended at ~2.5×106cells / mL into 8×2 L Erlenmeyer shake flask, containing 400 mL of culture media. On the day of transfection, the cell density was maintained at ~6.0×106cells / mL. For 3200 mL transfection volume, 3.2 mg plasmid DNA (1.0 mg / L) mix was diluted in 160 mL of OptiPRO SFM Medium and filter sterilized. In another 160 mL of OptiPRO SFM medium, 10.24 mL of transfection reagent, ExpiFectamine CHO Reagent (3.2×DNA) was diluted. Diluted plasmid DNA and ExpiFectamine CHO Reagent were mixed together and incubate for 2 minutes at room temperature (RT). After the incubation, the complex was added immediately to the flask containing cells and gently swirled for homogeneous mixing. Flasks were then incubated at 37 °C with 8% CO2 at 100 RPM. At 18-20 hours of post transfection on Day 01, cells were fed with the kit provided ExpiCHO Feed (16% of culture volume (512 mL)) and Enhancer (0.6% of culture volume (19.2 mL). The cells were shifted to a 32 °C incubator with 5% CO2for the remaining expression days. At Day 05, the cells were fed with ExpiCHO feed (16% of culture volume (512 mL)). Harvest preparation The transfected culture (~4 L) was harvested on day 12 having 9.61×106Cell Count and 58% viability. Culture medium was centrifuged at 4700 RPM for 20 minutes. Supernatant harvest was filtered through a 0.22 µm membrane capsule filter and submitted for purification. Purification 77
[0076] Affinity capture was performed with a MabSelectSure XK 16 / 20 Protein A-Affinity column. The column was regenerated with 0.5 M NaOH and after water wash, equilibrated with 1X PBS, pH 7.4. Harvest was loaded on the column and binding was carried at a flow rate of 3 mL / min using AKTA Pure system (Unicorn version 7.6). Antibody captured column was washed with 1X PBS, pH 7.4 and eluted first with 50 mM Sodium Citrate pH 3.5 (eluate 1) followed by 100 mM Glycine pH 2.5 (eluate 2). Both eluates were neutralized by 2 M Tris pH 8.0. Elute from pH 3.5 was taken for further processing. Gel filtration chromatography Eluate 1 volume was 215 mL. The sample was concentrated to 70 mL using Amicon® Ultra 15 mL filter (30 kDa NMWL) for gel filtration chromatography. No visual precipitation was observed during the concentration step. A HiLoad 26 / 600 Superdex200 (320 mL) column was used with standard 3 mL / min flow rate. The column was cleaned with 0.5 M NaOH, followed by a water wash. The column was then equilibrated to 20 mM Histidine, 150 mM NaCl pH 6.0. 14 mL of prepared sample was injected into the column and eluted with elution buffer (20 mM Histidine, 150 mM NaCl pH 6.0) at 3 mL / min and 2 mL fractions were collected. The eluted fractions were analyzed by HPLC-based SEC purity and SDS-PAGE. SDS-PAGE Analysis A 4-12% NuPAGE Precasted Gel (Invitrogen Cat. No.13010771) was used with LDS 4X sample buffer (Invitrogen Cat. No. LC6065). Pre-stained protein standard from Pure Gene (Cat. No. PG-PMT0772) was used. The running buffer was NuPAGE MES SDS Running buffer-20X (Invitrogen Cat. No. NP000202). Antibody expression was observed in the harvest sample showing a protein band at the expected ~125kDa size (calculated molecular weight is 124,858.01 Da). Additional SDS-PAGE analysis was conducted with protein samples prepared in 4× loading dye in non-reduced and reduced conditions and post incubation at 95 °C for 5minutes. The results showed the migration of an intact molecule of ~124kDa in nonreducing conditions. In reducing condition, the Ab897 heavy and light chains were observed to run separately localizing as per their molecular weight. SEC-HPLC Analysis 78
[0077] A TSKgel G300SWXL column with a 1XPBS (pH 7.4) + 0.2 M L-arginine monohydrochloride mobile phase was used to analyze gel filtration column fractions on a Shimadzu Prominence-I LC-2030C-3D plus instrument at a detection wavelength of 280 nm. Biorad standards (Cat. No.1511901) were used. The results showed that the Ab897 protein purity was >98.7% and confirmed the protein mass. Example 4: Assessment of the binding specificity of Ab897 for human T cells and CLDN6 overexpressing cell lines T-cells The binding of an exemplary bispecific antibody that specifically binds CLDN6 and CD3 (Ab897) to Pan T cells from 5 human peripheral blood mononuclear cells (PBMC) donors was determined. Isolation of Pan T cell PBMCs were thawed and centrifuged for 5 minutes at 1200 RPM at room temperature. Pan T cells were isolated using EasySep human T cell isolation kit as per manufacturer’s instructions (StemCell Technologies; Cat no.# 17951) and counted using a hemocytometer. T-cells were re-suspended in L / D staining (Violet fluorescent dye in 1X DPBS; 1 µL / million / mL) and were incubated at 37 ˚C for 20 minutes. Post incubation, double the volume of FACS buffer (2% FBS in PBS) was added to stop the reaction, and suspension was centrifuged for 5 minutes at 1200 RPM. Cells were then re-suspended in FACS buffer to obtain 2 million / mL final cell concentration. Cells were seeded in a 96 well V bottom plate at a density of 0.1 million cells in 50 µL per well. Cell suspensions were made using FACS buffer. Primary Antibody Dilution A working concentration of 4000 nM (2X) followed by a 3-fold, 10 -point DRC was prepared in media.50 µL of antibody were added to 50 µL of cell suspension (final top concentration is 2000 nM followed by a 3-fold, 10- point DRC). Separate wells were kept for NBS (no bispecific sample). The plates were incubated at 37 °C for 1 hour. Post incubation, cells were washed by adding 79
[0078] 150 µL / well FACS buffer and pelleted at 1400 RPM for 5 minutes. Washing was repeated twice with 200 µL / well of FACS buffer. The supernatant was decanted completely. Secondary Antibody Addition 100 µL / well of Alexa Fluor 647 anti-human IgG (1:100 dilution) was used to re-suspend the pellet. The plates were incubated for 30 minutes at 4 °C. Post incubation, the cells were washed with 150 µL / well FACS buffer and centrifuged at 1400 RPM for 5 minutes. Washing was repeated twice with 200 µL / well 1X DPBS. Supernatant was decanted completely. The pellets were re-suspended in 60 µL of FACS buffer per well. Data from the plates were acquired using a Novocyte flow cytometer and the data were analyzed using NovoExpress software. Binding Assay Calculations The median fluorescence intensity (MFI) of each sample was obtained from the analyzed flow cytometry data file. The average MFI value of the secondary alone control wells (labelled as NBS) was calculated. The control average MFI value was subtracted from each sample MFI to remove background. The background-subtracted MFI value for each sample was plotted using GraphPad prism and fitted with a 4-parameter non-linear regression with log transformed X-axis. Figure 5A shows flow cytometry plots showing median fluorescence intensity (MFI) values of Ab897b binding to Pan T cells from 5 donors. The results showed Ab897 binds to Pan T cells in a similar dose-dependent manner in all 5 donors with an average EC50 of 33nM. CHO Cells The binding of Ab897 to CHO-K-CLDN6 and CHO-K-CLDN9 over expression cell lines was determined. Assay Protocol Cells were dissociated using 0.25% trypsin and the cell suspension was collected. Cells were centrifuged at 1200 RPM for 5 minutes at room temperature, re-suspended in complete media (F12K+10% FBS) and counted. The cells were re-suspended in prepared L / D staining (violet fluorescent dye in 1X DPBS; 1 µL / million / mL) and were incubated at 37 °C for 15-20 minutes. Post incubation the cells were topped up with double the volume of FACS buffer (2% FBS in 1X PBS) to stop the reaction and centrifuged for 5 minutes at 1200 RPM. The cells were re-suspended in FACS buffer. Cells were seeded in a 96 well V bottom plate at a density of 0.1 million cells in 50 80
[0079] µL per well. Cells were dissociated using 0.25% trypsin and the cell suspension was collected. Cells were centrifuged at 1200 RPM for 5 minutes at room temperature, re-suspended in complete media (F12K+10% FBS) and counted. The cells were re-suspended in prepared L / D staining (violet fluorescent dye in 1X DPBS; 1 µL / million / mL) and were incubated at 37 °C for 15-20 minutes. Post incubation the cells were topped up with double the volume of FACS buffer (2% FBS in 1X PBS) to stop the reaction and centrifuged for 5 minutes at 1200 RPM. The cells were re-suspended in FACS buffer. Cells were seeded in a 96 well V bottom plate at a density of 0.1 million cells in 50 µL per well. Primary Antibody Dilution A working concentration of 600 nM (2X) followed by a 4-fold, 5-point DRC was prepared in media.50 µL of antibody were added to 50 µL of cell suspension (final top concentration is 300 nM, followed by a 4-fold, 5-point DRC). Separate wells were kept for NBS (0 nM antibody). The plates were incubated at 37 °C for 1 hour. Post incubation the cells were washed by adding 150 µL / well FACS buffer and pelleted at 1400 RPM for 5 minutes. Washing was repeated twice with 200 µL / well of FACS buffer. The supernatant was removed completely after the second wash. Secondary Antibody Addition 100 µL / well of Alexa Fluor 647 anti-human IgG (1:300 dilution in FACS buffer) was used to re-suspend the pellets. The plates were incubated for 30 minutes at 4 °C. Post incubation, the cells were washed with 150 µL / well FACS buffer and centrifuged at 1400 RPM for 5 minutes. Washing was repeated twice with 200 µL / well 1X DPBS. The supernatant was removed completely after the second wash. The pellets were re-suspended in 60 µL of FACS buffer per well. Data from the plates were acquired on a Novocyte flow cytometer and data were analyzed using NovoExpress software. Binding Assay Calculation The median fluorescence intensity (MFI) of each sample was obtained from the analyzed flow cytometry data file. The average MFI value of the secondary alone control wells (labelled as NBS or no bispecific sample) was calculated. The control average MFI value was subtracted from each sample MFI to remove background. The background-subtracted MFI value for each sample was plotted using GraphPad prism and fitted with a 4-parameter non-linear regression with log transformed X-axis. 81
[0080] Figure 5B shows flow cytometry plots showing median fluorescence intensity (MFI) values of Ab897 binding to CHO-CLDN6 and CHO-CLDN9 cells. The results showed dose-dependent binding of Ab897 on CHO-CLDN6 cells, with a KDof about 23 nM, but does not show any binding on CHO-CLDN9 cells up to a concentration of 300 nM. Example 5: Assessment of the binding profile of Ab897 using a human plasma membrane protein cell array and flow cytometry The Retrogenix Cell Microarray Technology (Charles River, Derbyshire, UK) was used to screen for specific off-target binding interactions of an exemplary bispecific antibody that specifically binds CLDN6 and CD3 (Ab897) by evaluating levels of binding of Ab897. A control human IgG antibody targeting CD3 (Ab946) was used as a positive control. The study was divided into 4 phases: Phase 1. Pre-screens to determine the level of background binding of Ab897 to fixed untransfected HEK293 cells and cells over-expressing CD3E (plasma membrane and tethered secreted forms), CD3D + CD3E, CD3G + CD3E or CLDN6. These data were used to assess the suitability and optimal concentration for onward screening. Phase 2. Library screen. Ab897 was screened for binding against fixed HEK293 cells over- expressing 6105 individual full-length human plasma membrane proteins, secreted and cell surface- tethered human secreted proteins, as well as a further 400 human heterodimers. This identified library interactions. Phase 3. Confirmation screens. All library interactions were re-expressed, and probed with Ab897 or control s, to determine which interactions, if any, were repeatable and specific to Ab897. This was performed on both fixed and live cells. Phase 4. Flow cytometry-based follow-on study to investigate the identified Ab897b-specific interactions further on live cells. Methodology Pre-screen 1. Slides were spotted with expression vectors encoding both ZsGreen1 and human CD3E (plasma membrane and tethered secreted forms), CD3D + CD3E, CD3G + CD3E, CLDN6, CD20 or EGFR, and used to reverse-transfect HEK293 cells. 2.2, 5 or 20 µg / mL of Ab897, 1 µg / mL of Rituximab biosimilar or PBS only was added to the above cells / slides after fixation. 82
[0081] 3. Binding to target-expressing cells and untransfected cells was assessed using an AlexaFluor 647 labelled anti-human IgG Fc (AF647 anti-hIgG Fc) detection antibody, followed by fluorescence imaging. 4. This detection antibody has been validated previously for use in the Retrogenix Cell Microarray Technology system for detecting human IgGs and human Fc fusion proteins. Library screen For Library screening, 6,105 expression vectors, encoding both ZsGreen1 and a full-length human plasma membrane protein, secreted or a cell surface-tethered human secreted protein, plus a further 400 human heterodimers were individually arrayed in duplicate across cell microarray slides (‘slide-sets’). The test human proteins included CLDN1, CLDN2, CLDN3, CLDN4, CLDN5, CLDN6, CLDN7, CLDN8, CLDN9, CLDN10, CLDN11, CLDN12, CLDN13, CLDN14, CLDN15. CLDN16, CLDN17, CLDN18, CLDN19, CLDN20, CLDN22, CLDN23, CLDN24, CLDN25 and CLDN34. An expression vector (pIRES-hEGFR-IRES-ZsGreen1) was spotted in quadruplicate on every slide and was used to ensure that a minimal threshold of transfection efficiency had been achieved or exceeded on every slide. Human HEK293 cells were used for reverse transfection / expression. Ab897 was added to each slide after cell fixation, giving a final concentration of 2 µg / mL.Detection of binding was performed using the same fluorescent secondary antibody as used in the Pre-screen (AF647 anti- hIgG Fc). Ab897 was screened against 2 replicate slide-sets. Fluorescent images were analyzed and quantitated (for transfection) using ImageQuant software (GE healthcare, Version 8.2). A protein interaction was defined as a duplicate spot showing a raised signal compared to background levels. This was achieved by visual inspection using the ImageQuant software. Interactions were classified as ‘strong, medium, weak or very weak,’ depending on the intensity of the duplicate spots. A significant interaction was defined as a signal of weak intensity or greater and did not refer to a statistical significance. Confirmation screen Vectors encoding all interactions identified in the Library screen, plus control vectors encoding CD20 (positive control) and EGFR (transfection and negative control), were arrayed and expressed in HEK293 cells on new slides. Confirmation screen slides and analyses were carried out as for the Library screen either 83
[0082] after cell fixation (n=2) or in the absence of fixation (n=1). Slides were treated with 2 µg / mL of Ab897b, 2 µg / mL of Ab946 (positive control), 1 µg / mL of Rituximab biosimilar (Charles River positive control) or no test molecule (secondary only; negative control). Binding to target-expressing cells and untransfected cells was again assessed by fluorescence imaging. Follow-on flow cytometry validation study Human HEK293 cells were transfected with expression vectors encoding ZsGreen1 only, or ZsGreen1 and CLDN6, CD3E (plasma membrane and tethered secreted forms), SIRPA (isoform 2 and isoform 4) or CD20 (assay control). Live cell transfectants were incubated with 2 µg / mL Ab897, 1 µg / mL Rituximab biosimilar (Charles River positive control) or assay buffer only, as indicated. Cells were washed and incubated with the same AF647 anti-hIgG Fc detection antibody as used in the cell microarray screens. Cells were washed again and analyzed by flow cytometry. A 7AAD live / dead dye was used to exclude dead cells, and ZsGreen+ (transfected) cells were selected for analysis. Results Pre-screenAb897 showed low to high levels of background binding to fixed untransfected HEK293 cells when tested at 2, 5 and 20 µg / mL. Binding to over- expressed CLDN6, CD3D + CD3E and CD3G + CD3E, the primary targets, were observed at all 3 concentrations tested. Based upon these data, Ab897 was fully profiled at a final concentration of 2 μg / mL on fixed cells. Library screenAfter screening 2 µg / mL of Ab897 for binding against fixed HEK293 cells expressing 6105 individual full-length human plasma membrane proteins, secreted and cell surface-tethered human secreted proteins, as well as a further 400 human heterodimers 15 library interactions were identified altogether. Spot intensities ranged from very weak to medium / strong. 84
[0083] Confirmation screensIn subsequent Confirmation screens, all 15 library interactions, vectors encoding CD3E (plasma membrane and tethered secreted forms) and 2 control receptors (CD20 and EGFR) were over-expressed in HEK293 cells. Rituximab biosimilar showed a strong intensity interaction with over-expressed CD20 on fixed cell microarrays, validating the incubation conditions and detection system. On fixed cell microarrays, all of the library interactions were reproducibly observed with Ab897 in the Confirmation screen. Ten of the 15 library interactions were determined to be non-specific binding as at least 1 of the control treatments (Rituximab biosimilar and / or no primary test molecule) also displayed binding. These 10 interactions included Fc gamma receptor, binding occurring through Fc domain of antibodies. Five specific interactions were identified. Four of those were interactions with the primary targets CLDN6, and CD3E (also in a heterodimer with either CD3D or CD3G. Specific interactions using this method were detected with SIPRA (isoforms 2 and 4), and were investigated further. Flow cytometry follow up results (live cells) In order to investigate the identified interactions of Ab897 further, CLDN6, CD3E (plasma membrane and tethered secreted forms), SIRPA (isoform 2 and isoform 4) and CD20 as a control were over-expressed in HEK293 cells. Live cell transfectants, including ZsGreen1-only transfected cells, were incubated with 2 µg / mL Ab897, 1 µg / mL Rituximab biosimilar (Charles River positive control) or assay buffer alone. Interactions were then investigated by flow cytometry. Ab897 showed an interaction measured as strong fluorescence intensity, with its primary target, CLDN6. Ab897 showed no significant interaction with CD3E (plasma membrane or tethered secreted form) or SIRPA (isoform 2 or isoform 4). The lack of interaction with CD3E is likely to be caused by CD3 being unstable and undetectable at the cell membrane in living cells in the absence of fixation. The binding pattern of Ab897 to heterodimers CD3E + CD3D and CD3E + CD3G suggested that the binding epitope of Ab892 is contained within CD3E, as the common element of both heterodimers. Binding to CD3E alone was not observed in fixed cells, which has also been observed with other CD3E binders. Although not stabilized at the cell surface, the process of cell fixation makes the cells slightly porous and allows some binding to intracellular CD3E. The fact that no binding was observed with Ab897 suggests that the CD3E epitope is unmasked by a conformational 85
[0084] change in CD3E upon binding to CD3D or CD3G subunits and this hypothesis is supported by published data (Salmerón et al., A conformational epitope expressed upon association of CD3- epsilon with either CD3-delta or CD3-gamma is the main target for recognition by anti-CD3 monoclonal antibodies. J. Immunol.1991;147:3047-3052.) In conclusion, these results indicate high specificity of Ab897b for its primary targets, CLDN6 and CD3E. Summary of the evaluated specific interactions are shown in Table 9 (NI = no interaction detected; NT = not tested). Table 9: Identified specific interactions in the Library and Confirmation screens (weak intensity and above) i fi i Example 6: Assessment of the binding specificity of Ab897 for CLDN6-expressing human tumor cell lines and the CLDN6-negative human tumor cell line SKOV3 The binding of an exemplary bispecific antibody that specifically binds CLDN6 and CD3 (Ab897) to OVCAR3, PA1, OV90, HepG2 and SKOV3 cell lines was determined to examine endogenous expression of, and binding to, CLDN6. Media composition for the cell lines tested is shown in Table 20. Table 10: Cell Culture Media Cell Line Media Composition A ssay ro oco Harvesting of Target Cells 86
[0085] Cells were washed with DPBS twice (5 mL / flask) and dissociated using 5 mL / flask of 0.25% trypsin. The flasks were incubated at 37 °C for 3 minutes and neutralized using 10 mL of respective complete media. Cell suspensions were centrifuged at 1,200 RPM for 5 minutes at RT. Supernatants were discarded after centrifugation and the pellets were re-suspended in 1 mL of respective complete media.10 µL aliquots were taken for cell counting using Neubauer chamber hemocytometer and trypan blue method. Live Dead Staining and Seeding of Target Cells The cells were centrifuged at 1,200 RPM for 5 minutes at RT. Pellets were re-suspended in 3 mL of prepared L / D staining (Violet fluorescent dye in 1X DPBS; 1 µL / million / mL). Resuspended cells in Falcon tubes were incubated at RT for 20 minutes. Post incubation, 6 mL of 2% FACS buffer (2% FBS in PBS) was added to stop the reaction. Cells suspensions were centrifuged for 5 minutes at 1,200 RPM. The cells were re-suspended in 1.5 mL of 2% FACS buffer. Cells were seeded in a 96 well V-bottom plate at a density of 0.1 million cells in 50 µL of 2% FACS buffer per well. Primary Antibody Dilution Working concentration of 600 nM (2X) followed by a 4-fold, 5-point DRC was prepared in RMPI 1640 media containing 10% FBS.50 µL of each antibody were added to 50 µL of cell suspension in 96 well V-bottom plate (final top concentration is 300 nM followed by a 4-fold, 5- point DRC). Separate wells were kept for NBS (0 nM antibody). The plates were incubated at 37 °C for 1 hour. Post incubation, the cells were washed by adding 150 µL FACS buffer / well and pelleted at 1,400 RPM for 5 minutes. Washing was repeated twice with 200 µL FACS buffer / well. The supernatant was decanted completely after washing. Secondary Antibody Dilution 100 µL of Alexa Fluor 647 anti-human IgG (1:100 dilution) were used to re-suspend the pellets. The plates were incubated for 30 minutes at 4 °C. Post incubation, the cells were washed by adding 150 µL FACS buffer / well and pelleted at 1,400 RPM for 5 minutes. Washing was repeated twice with 200 µL 1X DPBS / well. The supernatant was decanted completely after washing. The pellets were re-suspended in 60 µL FACS buffer / well. Data from the plates were acquired on a Novocyte flow cytometer and data were analyzed using NovoExpress software. 87
[0086] Binding Assay Calculation The median fluorescence intensity (MFI) of each sample was obtained from the analyzed flow cytometry data file. The average MFI value of the secondary alone control wells (labelled as NBS or no bispecific sample) was calculated. The control average MFI value was subtracted from each sample MFI to remove background. The background-subtracted MFI value for each sample was plotted using GraphPad prism and fitted with a 4-parameter non-linear regression with log transformed X-axis. Results Figure 6 shows flow cytometry histograms for incubation with 300 nM Ab897, while Figure 7 shows flow cytometry plots showing median fluorescence intensity (MFI) values of Ab897 binding to different tumor cell lines as follows: 1. High binding at the top dose of 300 nM to OVCAR3, OV90, PA1 (MFI>100,000) 2. Moderate to low binding to HepG2 (MFI<100,000) at the top dose of 300 nM 3. No binding to CDLN6 negative SKOV3 cells even at the top dose 300 nM 4. At 37 °C for 1 hour, saturable binding does not appear to be achieved on any of the cell lines. Example 7: T-cell mediated cytotoxicity of Ab897 on CLDN6+tumor cell line PA1 The cytotoxicity of an exemplary bispecific antibody that specifically binds CLDN6 and CD3 (Ab897) on the PA1 (CLDN6+) ovarian tumor cell line at 72 and 96 hours in cocultures of the PA1 tumor cell line with 5 independent human Pan T-cell donors at a 3:1 E:T ratio was determined. Assay Protocol NLG transduction and seeding of PA1-NLG cells A PA1-NLG stable cell line was utilized for these studies (stably transduced with Incucyte Nuclight Green). Cells grown in flasks were trypsinized and spun at 1,200 RPM for 5 minutes at RT. The cell pellet was resuspended in EMEM media + 10% FBS and cells were counted by hemocytometer.96 well flat bottom plates were seeded as per the plate map with 3,000 cells / 100 µL / well PA1-NLG cells. Seeded plates were incubated overnight at 37 °C, 5% CO2.Addition of antibodies and effector cells PBMCs from 5 donors were thawed and Pan T cells were isolated from the PBMCs using 88
[0087] StemCell Pan T cell isolation kit as per manufacturer’s instructions. Purified T cells were counted on a hemocytometer. The Pan T cells were resuspended in RPMI media + 10% FBS and added to the PA1-NLG cells at a 3:1 E:T ratio (9,000 T cells / 80 µL / well). In order to prepare antibody dilutions, a 10× (300 nM) intermediate stock was prepared using complete media. The 300 nM stock was further serially diluted 4-fold, 10-point DRC to prepare all intermediate stocks. From these respective 10X intermediate stocks, 20 µL was added to each well as per plate map that already contains 180 µL of cell culture media with effector and target cells to obtain final top concentration of 30 nM with a 4-fold, 10-point DRC. Ab897 (full DRC) with target cells referred to as Ab+T; 0 nM Ab897 with T cells+ target cells referred to ×10T and 0 nM Ab897 with target cells alone referred to T were used as controls. Incucyte set up After setting up the assay, plates were placed in the Incucyte chamber at 37 °C with 5% CO2. The plates were left undisturbed in the Incucyte chamber for 30 minutes to stabilize, and any condensation that formed was subsequently removed from the plate. Using the Incucyte S3 software, the plates were set to scan each well at every 6 or 12 hours, till the end point as per assay requirement. The time-lapse images were taken with phase and respective fluorescent channel (Green or Red) from every well and then analyzed using the same software. The fluorescent intensity captured as “Integrated Intensity Per Well (GCU×µm² / well)” was used further to calculate the % cytotoxicity. Cytotoxicity assay calculation The cytotoxicity file from the Incucyte was analyzed and the raw data based on fluorescence intensity was exported. The fluorescence intensity value from the control well (×10T alone, 0 nM Ab897) was set to 100%. Percentage killing for samples with Ab897 was determined compared to ×10 alone control. The relative percentages were plotted using GraphPad Prism using the formula: 100-((sample / avg control)×100). Figure 8 plots show % lysis at 72 and 96 hr timepoints in an Incucyte based cytotoxicity assay of Ab897b on PA1-NLG cells at 3:1 E:T ratio. Target only control (no effector cells) did not show any cytotoxicity. All data points are in duplicates, mean ± SD plotted. All negative lysis values were constrained to 0 for the purpose of data plotting in a non-linear regression curve. After up to 96 hours of human Pan-T cell coculture with tumor cell lines at a fixed E:T ratio of 3:1, Ab897 shows sub-nM dose dependent cytotoxicity across all 5 human T cell donors on the 89
[0088] PA1 tumor cell line. Maximal cytotoxicity (~75-80%) was observed at the 3:1 ratio at both the 72- and 96-hour time points in all donors. There was clear donor dependent variability in the potency at both timepoints. Example 8: T-cell mediated cytotoxicity of Ab897 on CLDN6+tumor cell line OV90 The cytotoxicity of an exemplary bispecific antibody that specifically binds CLDN6 and CD3 (Ab897) on the OV90 (CLDN6+) ovarian tumor cell line at 72 and 96 hours in cocultures of the OV90 tumor cell line with 5 independent human Pan T-cell donors at a 3:1 E:T ratio was determined. Assay Protocol NLG transduction and seeding of OV90-NLG cells OV90-NLG stable cell line was utilized for these studies (stably transduced with Incucyte Nuclight Green). Cells grown in flasks were trypsinized and spun at 1,200 RPM for 5 minutes at RT. The cell pellet was resuspended in complete medium (1:1 mixture of MCDB 105 media with 1.5 g / L sodium bicarbonate and Medium 199 with 2.2 g / L sodium bicarbonate +15% FBS) and cells were counted using a hemocytometer.96 well flat bottom plates were seeded as per the plate map with 7,500 OV90-NLG cells / 100 µL / well. Seeded plates were incubated overnight at 37 °C, 5% CO2. Addition of antibodies and effector cells PBMCs from 5 donors were thawed and Pan-T cells were isolated from the PBMCs using StemCell kit as per manufacturer’s instructions. T cells were counted on a hemocytometer. The Pan T cells were resuspended in complete medium and added to the OV90-NLG cells at an E:T ratio of 3:1 (22,500 T cells / 50 µL / well). In order to prepare antibody dilutions, a 10× (300 nM) intermediate stock was prepared using complete media. The 300nM stock was further serially diluted 4-fold, 10- point DRC to prepare all intermediate stocks. From these respective 10× intermediate stocks, 20 µL was added to each well as per plate map that already contains 180 µL of cell culture media with effector and target cells to obtain final top concentration of 30 nM with a 4-fold, 10-point DRC. Ab897 (full DRC) with target cells referred to as Ab+T; 0 nM Ab897b with T cells+ target cells referred to ×10T and 0 nM Ab897b with target cells alone referred to T were used as controls. Incucyte set up 90
[0089] After setting up the assay, plates were placed in the Incucyte chamber at 37 °C with 5% CO2. The plates were left undisturbed in the Incucyte chamber for 30 minutes to stabilize, and any condensation that formed was subsequently removed from the plate. Using the Incucyte S3 software, the plates were set to scan each well at every 6 or 12 hours, till the end point as per assay requirement. The time-lapse images were taken with phase and respective fluorescent channel (Green or Red) from every well and then analyzed using the same software. The fluorescent intensity captured as “Integrated Intensity Per Well (GCU×µm² / well)” was used further to calculate the % cytotoxicity. Cytotoxicity assay calculation The cytotoxicity file from the Incucyte was analyzed and the raw data based on fluorescence intensity was exported. The fluorescence intensity value from the control well (×10T alone, 0 nM Ab897) was set to 100%. Percentage killing for samples with Ab897 was determined compared to ×10 alone control. The relative percentages were plotted using GraphPad Prism using the formula: 100-((sample / avg control)×100). Figure 9 plots show % lysis at 48-, 72-, and 96-hour timepoints in an Incucyte based cytotoxicity assay of Ab897 on OV90-NLG cells at 3:1 E:T ratio. Target only control (no effector cells) did not show any cytotoxicity. All data points are in duplicates, mean ± SD plotted. All negative lysis values were constrained to 0 for the purpose of data plotting in a non-linear regression curve. After up to 96 hours of human Pan-T cell coculture with tumor cell lines at a fixed E:T ratio of 3:1, Ab897 shows sub-nM dose dependent cytotoxicity across all 5 human T cell donors on the OV90 tumor cell line with peak potency obtained at 96 hours. Maximal cytotoxicity (~95%) was observed at the 3:1 ratio at the 96-hour time point only in all donors. There was donor dependent variability in the potency and maximal cytotoxicity at early time points (48 hours) which resolved by 96 hours in all donors. Ab897 showed dose dependent cytotoxicity in OV90 cells at 3:1 E:T ratio reaching a maximum of ~95% killing. Comparative cytotoxicity against CLDN6+OVCAR3, PA-1, and OV-90 cell lines are shown in Figure 10. Example 9: T-cell mediated cytotoxicity of Ab897 on CLDN6+tumor cell line HepG2 The cytotoxicity of an exemplary bispecific antibody that specifically binds CLDN6 and 91
[0090] CD3 (Ab897) on the HepG2 (CLDN6+) liver cancer cell line at 72 and 96 hours in cocultures of the HepG2 cell line with 5 independent human Pan T-cell donors at a 10:1 E:T ratio was determined. Assay Protocol NLG transduction and seeding of HepG2-NLG cells HepG2-NLG stable cell line was utilized for these studies (stably transduced with Incucyte Nuclight Green). Cells grown in flasks were trypsinized and spun at 1,200 RPM for 5 minutes at RT. The cell pellet was resuspended in complete medium (EMEM + 10% FBS) and cells were counted using a hemocytometer.96 well flat bottom plates were seeded with 3,000 HepG2-NLG cells / 100 µL / well. Seeded plates were incubated overnight at 37 °C, 5% CO2. Addition of antibodies and effector cells PBMCs from 5 donors were thawed and Pan-T cells were isolated from the PBMCs using StemCell kit as per manufacturer’s instructions. T cells were counted on a hemocytometer. The Pan T cells were resuspended in complete medium and added to the HepG2-NLG cells at an E:T ratio of 10:1 (30,000 T cells / 50 µL / well). In order to prepare antibody dilutions, a 10× (300 nM) intermediate stock was prepared using complete media. The 300 nM stock was further serially diluted 4-fold, 10-point DRC to prepare all intermediate stocks. From these respective 10× intermediate stocks, 20 µL was added to each well that already contained 180 µL of cell culture media with effector and target cells to obtain final top concentration of 30 nM with a 4-fold, 10- point DRC. Ab897 (full DRC) with target cells referred to as Ab+T; 0 nM Ab897b with T cells+ target cells referred to ×10T and 0 nM Ab897 with target cells alone referred to T were used as controls. Incucyte set up After setting up the assay, plates were placed in the Incucyte chamber at 37 °C with 5% CO2. The plates were left undisturbed in the Incucyte chamber for 30 minutes to stabilize, and any condensation that formed was subsequently removed from the plate. Using the Incucyte S3 software, the plates were set to scan each well at every 6 or 12 hours, till the end point as per assay requirement. The time-lapse images were taken with phase and respective fluorescent channel (Green or Red) from every well and then analyzed using the same software. The fluorescent intensity captured as “Integrated Intensity Per Well (GCU×µm² / well)” was used further to calculate the % cytotoxicity. 92 Cytotoxicity assay calculation The cytotoxicity file from the Incucyte was analyzed and the raw data based on fluorescence intensity was exported. The fluorescence intensity value from the control well (×10T alone, 0 nM Ab897) was set to 100%. Percentage killing for samples with Ab897 was determined compared to ×10 alone control. The relative percentages were plotted using GraphPad Prism using the formula: 100-((sample / avg control)×100). Figure 11 plots show % lysis at 48-, 72-, and 96-hour timepoints in an Incucyte based cytotoxicity assay of Ab897 on HepG2-NLG cells at 10:1 E:T ratio. Target only control (no effector cells) did not show any cytotoxicity. All data points are in duplicates, mean ± SD plotted. All negative lysis values were constrained to 0 for the purpose of data plotting in a non-linear regression curve. After up to 96 hours of human Pan-T cell coculture with tumor cell lines at a fixed E:T ratio of 10:1, Ab897 shows sub-nM dose dependent cytotoxicity across all 5 human T cell donors on the HepG2 tumor cell line with peak potency obtained by 72 hours. Maximal cytotoxicity (~95%) was observed as early as 48 hours in the majority of donors. There was donor dependent variability in the potency and maximal cytotoxicity at early time points (48 hours) which resolved by 72 hours in all donors. Example 10: T-cell mediated cytotoxicity of Ab897 on CLDN6+tumor cell line OVCAR3 and CLDN6- tumor cell line SKOV3 The cytotoxicity of an exemplary bispecific antibody that specifically binds CLDN6 and CD3 (Ab897) on the OVCAR3 (CLDN6+) and SKOV3 (CLDN6-) ovarian tumor cell lines at various E:T ratios (3:1, 1:1, 1:3) at 72 hours in cocultures of the cell lines with 5 independent human Pan T-cell donors was determined. Assay Protocol Seeding of OVCAR3-NLG and SKOV3-NLR cells OVCAR3-NLG stable cell line was utilized for these studies (stably transduced with Incucyte Nuclight Green). Cells grown in flasks were trypsinized and spun at 1,200 RPM for 5 minutes at RT. The cell pellet was resuspended in RPMI media + 20% FBS and cells were counted using a hemocytometer.96 well flat bottom plates were seeded with 5,000 OVCAR3-NLG cells / 100µL / well.Seeded plates were incubated overnight at 37 °C, 5% CO2.93
[0091] SKOV3-NLR stable cell line was utilized for these studies (stably transduced with Incucyte Nuclight Red). Cells grown in flasks were trypsinized and spun at 1,200 RPM for 5 minutes at RT. The cell pellet was resuspended in McCoy’s 5A media + 10% FBS and count was obtained using a hemocytometer.96-well flat bottom view plates were seeded with 2,500 SKOV3-NLR cells / 100 µL / well. Seeded plates were incubated overnight at 37 °C, 5% CO2. Addition of antibodies and effector cells PBMCs from 5 donors were thawed and Pan-T cells were isolated from the PBMCs using StemCell kit as per manufacturer’s instructions. T cells were counted on a hemocytometer. The Pan T cells were resuspended in RPMI media + 10% FBS. The E:T ratios used were 3:1, 1:1 and 1:3. For OVCAR3 cells, 15,000 T cells / 50 µL / well were added for 3:1 E:T, 5,000 T cells / 50 µL / well were added for 1:1 E:T, and 1,650 T cells / 50 µL / well were added for 1:3 E:T ratio. For SKOV3 cells, 7,500 T cells / 50 µL / well were added for 3:1 E:T, 2,500 T cells / 50 µL / well were added for 1:1 E:T, and 850 T cells / 50 µL / well were added for 1:3 E:T ratio. Antibody dilutions were prepared in RPMI + 10% FBS, where 4× antibody stock was made and 50 µL of this was added to a well to give the 1× final concentration. Ab897 was used at a starting concentration of 30 nM and diluted 4-fold (9 dilutions) for a total of 10 points. Control wells (0 nM Ab897) were included for each ×10T ratio and target cell alone conditions.50 µL of 4× dilutions of antibody + 50µL cell suspension were added. For the control wells, only media was added instead of antibody. Incucyte set up After setting up the assay, plates were placed in the Incucyte chamber at 37 °C with 5% CO2. The plates were left undisturbed in the Incucyte chamber for 30 minutes to stabilize, and any condensation that formed was subsequently removed from the plate. Using the Incucyte S3 software, plates were set to scan each well every 6 hours up to 24 hours and every 12 hours thereafter, until the end point was reached. The time-lapse images were taken with phase and respective fluorescent channel (Green or Red) from every well and then analyzed using the same software. The fluorescent intensity captured as “Integrated Intensity Per Well (GCU×µm² / well)” was used further to calculate the %cytotoxicity. Cytotoxicity assay calculation The cytotoxicity file from the Incucyte was analyzed and the raw data based on fluorescence 94
[0092] intensity was exported. The fluorescence intensity value from the control well (×10T alone, 0 nM Ab897) was set to 100%. Percentage killing for samples with Ab897 was determined compared to ×10T alone control. The relative percentages were plotted using GraphPad Prism using the formula: 100-((sample / avg control)×100). Figure 12 plots show % lysis at 72-hour timepoint in an Incucyte based cytotoxicity assay of Ab897 on OVCAR3 and SKOV3 cell lines at different E:T ratios. All data points are in duplicates, mean ± SD plotted. At 72 hours of human Pan-T cell coculture with tumor cell lines, Ab897b shows sub-nM dose dependent cytotoxicity across all 5 human T cell donors on OVCAR3 (CLDN6+) cells at all tested E:T ratios (3:1, 1:1 and 1:3). Maximal cytotoxicity (~ 90-95%) was observed at 3:1 and 1:1 E:T ratios, with a lower maximal cytotoxicity observed (~ 50-80%) at 1:3 E:T ratio. Ab897 demonstrates no / negligible cytotoxicity in all 5 donors and E:T ratios tested when assessed on the SKOV3 (CLDN6-) cell. Cytotoxicity and T-cell activation with Ab897 on SKOV3 (CLDN6-) cells at 3:1 E:T ratio at 48 and 72 hours in human Pan-T cell cocultures (5 independent donors) was also determined. As described above, cytotoxicity was measured via Incucyte-based cell viability over time using stably transduced SKOV3 (Incucyte Nuclight Red) cells. T-cells on the plate were collected for flow- cytometry-based measurement of activation and proliferation. At 48 and 72 hours coculture of human Pan-T cells with tumor cell lines: Ab897b demonstrated no or minimal cytotoxicity in all 5 donors on the SKOV3 cell line at both time points. Ab897b demonstrated no stimulation of T cell proliferation or activation in all 5 donors on the SKOV3 cell line at both time (results not shown). Example 11: T cell proliferation, activation, and cytokine release with Ab897 on OVCAR3 (CLDN6+) cells Antibody-induced T cell activation and proliferation and cytokine release at 72 hours in human Pan-T cell cocultures (5 independent donors) with the OVCAR3 ovarian tumor cell line at 3:1 E:T ratio by an exemplary bispecific antibody that specifically binds CLDN6 and CD3 (Ab897) was determined. Assay Protocol 95
[0093] Seeding of OVCAR3 NLG cells OVCAR3-NLG stable cell line was utilized for these studies (stably transduced with Incucyte Nuclight Green). Cells grown in flasks were trypsinized and spun at 1,200 RPM for 5 minutes at RT. The cell pellet was resuspended in RPMI media + 20% FBS and the count was obtained using a hemocytometer.96 well flat bottom plates were seeded as per the plate map with 5,000 cells / 100 µL / well OVCAR3 NLG cells well in RPMI1640 + 20% FBS + 0.01 mg / mL humaninsulin. Seeded plates were incubated overnight at37 °C, 5% CO2.Addition of antibodies and effector cells PBMCs (peripheral blood mononuclear cells) from 5 human donors were thawed and Pan-T cells were isolated from the PBMCs using StemCell kit according to manufacturer’s instructions. T cell counts were obtained using a hemocytometer. To allow for measurement of T cell proliferation, T cells were incubated with 5 µM CellTrace Violet (CTV) dye in DPBS for 10 minutes at room temperature. After 10 minutes, 10 mL of complete media was used to terminate the staining. Cells were then spun down at 1,700 RPM for 5 minutes. Cell pellets were resuspended in 1 mL of RPMI 1640 media + 10% FBS, counted and added to OVCAR3-NLG cells at a 3:1 E:T ratio (15,000 T cells / 50 µL / well). Antibody dilutions were prepared in RPMI 1640 + 10% FBS, where 4× antibody stock was made and 50 µL of each 4x dilution was added to the well to give the 1× final concentration. Ab897 was used at a starting concentration of 30 nM and diluted 4-fold (9 dilutions) for a total of 10 points. Controls (no antibody added) included T cells + OVCAR3 cells or OVCAR3 target cells alone. 50 µL of antibody + 50 µL cell suspension were added. For control wells, only media with no antibody was added. After 72 hours, supernatants were collected from the plates and assessed for TNF-α, IFN-γ and IL-6 using Luminex kits. T cells remaining in the plate were collected after centrifugation and used for flow cytometry-based assay to test for T cell activation and proliferation. T cell activation and proliferation assay The replica assay plates were processed to analyze T cell activation and proliferation by flow cytometry. In brief, the cells from the plates were mixed gently with multi- channel pipette and the plates were centrifuged at 1,700 RPM for 3 minutes. The supernatants were collected and stored at -80 °C for the Luminex assay if required. The cell pellets were further processed for flow cytometry as follows. 96
[0094] Cells were stained with Live / Dead stain for 20 minutes at room temperature. The cells were washed twice using FACS buffer (3% FBS in HBSS) at 1,700 RPM for 3 minutes and re-suspended in 100 µL of FACS buffer. Surface staining antibodies were added to the respective wells as a cocktail of antibodies as per the panel (see Table 11) and incubated for 30 minutes at 4 °C in the dark. Table 11 Sam After incubation, cells were washed twice using FACS buffer (3% FBS in HBSS) and re- suspended in 100 µL of the same buffer. Data from Samples 1-5 were acquired on a Novocyte flow cytometer and the data were analyzed using NovoExpress software. Luminex Assay On the day of the assay, supernatants stored at -80 °C were thawed on ice and centrifuged at 16,000×g for 4 minutes prior to use. All samples, reagents, & standards were prepared as per manufacturer’s instruction. In brief, the standards provided in the kit were reconstituted using Calibrator Diluent RD6- 52. The standards were serially diluted 3-fold, 6-point DRC. The samples were diluted as required using Calibrator Diluent RD6-52. The Microparticle Cocktail vial was centrifuged for 30 seconds at 1,000×g, vortexed gently, and was diluted using Diluent RD2-1.50 μL of standard or sample was added per well as per the plate map.50 μL of the microparticle cocktail was added to each well of the microplate. The plates were securely covered with a foil plate sealer and incubated overnight at 4 °C on a horizontal orbital microplate shaker set at 800 RPM. Using a magnetic device designed to accommodate a microplate, the plates were washed using the magnet. The plates were washed three times with Wash Buffer (100 µL / well).50 μL of diluted Biotin-Antibody Cocktail was added to each well. The plates were securely covered with a foil plate sealer and incubated for 1 hour at room temperature on a horizontal orbital microplate shaker set at 800 RPM. After incubation, the plates were washed 3 times as mentioned before.50 μL of diluted Streptavidin-PE was then added to each well. The plates were securely covered with a foil plate sealer and incubated for 30 minutes at room temperature on a horizontal orbital microplate shaker set at 800 RPM. After incubation, the plates 97
[0095] were washed 3 times as mentioned before. After washing, the microparticles were resuspended in 100 μL of Wash Buffer / well. The plates were incubated for 2 minutes on the shaker and read within 90 minutes using a Luminex® Analyzer. Calculations T-cell proliferation and activation For T cell proliferation and activation assays, cells were gated on live cells, then CD4 or CD8. Cells were scored for % CTV for T cell proliferation and %CD25 and %CD69 for T cell activation. For activation, graphs show % positive gated on CD4+or CD8+cells. For proliferation assay, ×10T (no antibody control) was used for gating and decrease in the CTV intensity was collectively taken as % proliferation from the respective parent population (×10T / no antibody control). Cytokine profiling Data were collected using a Luminex MAGPIX system (Thermo Fisher Scientific). MFI values were converted to cytokine levels in pg / mL using the standard curve by MAGPIX software with a 5-parameter weighted logistic regression analysis. Results Figure 13 shows plots of A) T cell proliferation; B) CD4+and CD8+T cell activation and C) cytokine profiling at 72 hr timepoint from OVCAR3 cell cocultured with Pan-T cells from 5 donors at a 3:1 E:T ratio using Ab897b antibody. All data points in duplicates. Mean ± SD is plotted. The results with Ab897 in coculture with human Pan T cells from multiple donors with the OVCAR3 ovarian tumor cell line demonstrated: 1. Dose dependent T cell proliferation and activation after 72-hour coculture with Ab897b and OVCAR3 cells at 3:1 ET ratio. Sub-nM potency of both T cell proliferation and activation was observed in all donors. Percent maximal activity in both activation and proliferation was donor dependent. 2. Dose dependent cytokine increase (TNF-α, IFN-γ and IL-2) were observed at 72 hours with Ab897b and OVCAR3 cells at 3:1 ET ratio. Potency of cytokine release was right shifted (less potent) compared to activation and proliferation of T cells and maximal cytokine release was variable and donor dependent. 98
[0096] Example 12: In Vivo Ovarian Cancer Tumor Xenograft Model To evaluate the potential effectiveness of Ab897, OVCAR3 xenografts were transplanted into a humanized NSG mice. The mice were then treated with Ab897 weekly for four weeks at various doses, all of which demonstrated significant inhibition of tumor growth (at least 50% tumor growth inhibition (TGI), Figure 14A). Given the OVCAR3 results, OV90 xenografts were transplanted into humanized NSG mice and treated with Ab897 weekly at 0.1 mg / kg for three weeks, with a significant decrease in tumor volume observed after only two weeks (Figure 14B). ___________________________________ It will be appreciated by those skilled in the art that changes could be made to the embodiments described above without departing from the broad inventive concept thereof It is understood, therefore, that the disclosure provided herein is not limited to the particular embodiments disclosed, but it is intended to cover modifications within the spirit and scope of the present disclosure as defined by the present description. 99
[0097] REFERENCES 1. https: / / www. cdc. gov / cancer / dcpc / data / index. htm 2. https: / / www. cancer. gov / about- cancer / understanding / statistics 3. https: / / www. medicalnewstoday. com / articles / 323798# how- common- is- it 4. Mol. Med. Rep.2021;24(3):677 5. Cancer Res.1983;43:5379 6. Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991) 7. US Manual of Patent Examining Procedure (M.P.E.P).§ 2111.03 8. Adv. Appl. Math.1981;2:482 9. J Mol. Biol.1970;48:443 10. Proc. Nat'l. Acad. Sci. USA 1988;85:2444 11. Current Protocols in Molecular Biology, F.M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) 12. J. Mol. Biol.1990;215:403 13. Nucl. Acids Res.1997;25:3389 100
[0098] 14. Molecular Diagnostics, Edition 1, 2019, E. van Pelt-Verkuil, W.B. van Leeuwen, R. te Witt eds., Springer Singapore (ISBN 978-981-13-1603-6) 15. J. Oncol.2010; 2010:541957 16. Oncol. Rep.2017;38:875 17. Dev. Dyn.2008;237:504 18. J. Immunol.1986;137:1097 19. PCT Intl. Publ. No. W02000 / 041474 20. Transplantation 1992;54:844 21. J. Immunol.1991;147:3047 22. PCT Intl. Publ. No. W02007 / 042261 23. imgt. org / IMGTrepertoire / Proteins / allotypes / human / IGH / IGHC / G1m_ allotypes. html 24. Biochemistry 1968;61: 1414 25. imgt. org / IMTGScientificChart / Numbering / Hu_ IGHGnumber. html 26. J. Mol. Biol.2000;296:57 27. J. Mol. Biol.2010;397:385 28. PCT Int. Publ. No. WO2009 / 085462 101
[0099] 29. Acta Physiol. Scand. Suppl.1988;643:55 30. Adv. Biophys.1988;35:1 31. US Pat. No.4,683,19532.Curr. Opin. Drug. Disc. Dev. 2009;12:27633. Science Translational Medicine 2015;7:287ra70 34. PCT Intl. Publ. No. WO 2006 / 028936 35. Nat. Biotechnol.1998;16:677 36. Pharmaceutics 2019;12:3 37. Prot. Eng. Des. Sel.2012; 25: 321 38. US Pat. Publ. No. US2010 / 0015133 39. US Pat. Publ. No. US2009 / 0182127 40. US Pat. Publ. No. US2010 / 028637 41. US Pat. Publ. No. US2011 / 0123532 42. US Pat. Publ. No. US2012 / 0149876 43. US Pat. Publ. No. US2013 / 0195849 44. PCT Intl. Pat. Publ. No. W02011 / 131746 45. US Pat. No.11,795,429 102
[0100] 46. J. Immunol.1991;147:3047 103
[0101] SEQUENCE LISTING In the event of any discrepancy between the below sequences and the sequences in the sequence listing or as provided elsewhere in this application, the below sequences should prevail. SEQ ID NO: 1. Human CLDN6 (from UniProt P56747) MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQS TGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLV LTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGL LCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV 2. HC CDR1 of anti-CLDN6 NYGVH 3. HC CDR2 anti-CLDN6 VIWAAGRTNYNSALMS 4. HC CDR3 anti-CLDN6 DRYDYGYFDV 5. LC CDR1 anti-CLDN6 SASSSVSYMY 6. LC CDR2 anti-CLDN6 RTSSLAS 7. LC CDR3 anti-CLDN6 QQYHSYPLT 8. Full length VHanti-CLDN6 QVQLQESGPGLVKPSETLSITCTVSGFSLINYGVHWIRQPPGKGLEWLGVIWAAGRTNYNS ALMSRLYISVDTSKNQVSLKLSSVTAADTAVYYCARDRYDYGYFDVWGQGTMVTVSS 104
[0102] 9. Full length VL anti-CLDN6 AIVLTQSPSSLSASTGDRVTISCSASSSVSYMYWYQQKSGKAPKLWIYRTSSLASRVPSRFS GSGSGTDYTLTISSLQSEDFATYYCQQYHSYPLTFGGGTKVEIK 10. Full length HC anti-CLDN6 arm QVQLQESGPGLVKPSETLSITCTVSGFSLINYGVHWIRQPPGKGLEWLGVIWAAGRTNYNS ALMSRLYISVDTSKNQVSLKLSSVTAADTAVYYCARDRYDYGYFDVWGQGTMVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELTKNQVS LSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSC SVMHEALHNRFTQKSLSLSPGK 11. Full length LC anti-CLDN6 arm AIVLTQSPSSLSASTGDRVTISCSASSSVSYMYWYQQKSGKAPKLWIYRTSSLASRVPSRFS GSGSGTDYTLTISSLQSEDFATYYCQQYHSYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADY EKHKVYACEVTHQGLSSPVTKSFNRGEC 12. HC CDR1 anti-CD3 RYSMN 13. HC CDR2 anti-CD3 SISSGSRYIYYRDSVRG 14. HC CDR3 anti-CD3 EPRNHFDY 15. LC CDR1 anti-CD3 TRSSGSIASNYVQ 16. LC CDR2 anti-CD3 105
[0103] EDNQRPS 17. LC CDR3 anti-CD3 QSYDSSIRV 18. Full length sequence of anti-CD3 scFv NFMLIQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQHHPGSSPTTVIYEDNQRPSGVPDRF SGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSIRVFGCGTKLTVLGGSEGKSSGSGSESKS TGGSEVQLVESGGGLVKPGGSLKLSCAASGFTFSRYSMNWVRQASGKCLEWVSSISSGSRY IYYRDSVRGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAREPRNHFDYWGQGTLVTVSS 19. Anti-CD3 scFv linker GGSEGKSSGSGSESKSTGGS 20. Full length sequence of anti-CD3 arm heavy chain NFMLIQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQHHPGSSPTTVIYEDNQRPSGVPDRF SGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSIRVFGCGTKLTVLGGSEGKSSGSGSESKS TGGSEVQLVESGGGLVKPGGSLKLSCAASGFTFSRYSMNWVRQASGKCLEWVSSISSGSRY IYYRDSVRGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAREPRNHFDYWGQGTLVTVSS EPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 21. CD3G chain (UniProt P09693) MEQGKGLAVLILAIIILQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKM IGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFA EIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN 22. CD3D chain (UniProt P04234) MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRI LDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFA GHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK 106
[0104] 23. CD3E chain (UniProt P07766) MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCEN CMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP PPVPNPDYEPIRKGQRDLYSGLNQRRI 24. CD3Z chain (UniProt P20963) MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPA YQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 25. scFv VL NFMLIQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQHHPGSSPTTVIYEDNQRPSGVPDRF SGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSIRVFGCGTKLTVL 26. scFv VH EVQLVESGGGLVKPGGSLKLSCAASGFTFSRYSMNWVRQASGKCLEWVSSISSGSRYIYYR DSVRGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAREPRNHFDYWGQGTLVTVSS 27. CD3ε epitope 1 GSEIL 28. CD3ε epitope 2 CYPRGSKPE 29. CD3ε epitope 3 TCPQYP 30. CD3ε epitope 4 QSGYYV 31. CD3ε epitope 5 107
[0105] DANFYLYLRA 32. CD3δ epitope RLDLGKRILDPRGIY 108
Claims
CLAIMS 1. A bispecific antibody comprising a first antigen-binding domain that specifically binds Claudin-6 (CLDN6) and a second antigen-binding domain that specifically binds cluster of differentiation 3 (CD3), wherein the first antigen-binding domain comprises: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively.
2. The bispecific antibody of claim 1, wherein the first antigen-binding domain comprises: a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:
9.
3. The bispecific antibody of claim 1, wherein the second antigen-binding domain comprises: a) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and b) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in SEQ ID NOs:15, 16, and 17, respectively.
4. The bispecific antibody of claim 1, wherein the first antigen-binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises: c) a HCDR1, HCDR2, and HCDR3 comprising an amino acid sequence shown in SEQ ID NOs:12, 13, and 14, respectively; and d) a LCDR1, LCDR2, and LCDR3 comprising an amino acid sequence shown in 109SEQ ID NOs:15, 16, and 17, respectively.
5. The bispecific antibody of claim 1, wherein the first antigen-binding domain comprises: a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO:10; and b) a light chain (LC) comprising the amino acid sequence of SEQ ID NO:
11.
6. The bispecific antibody of claim 1, wherein the second antigen-binding domain comprises a single chain variable chain (scFv) comprising the amino acid sequence of SEQ ID NO:
18.
7. The bispecific antibody of claim 1, wherein the second antigen-binding domain comprises a HC comprising the amino acid sequence of SEQ ID NO:
20.
8. The bispecific antibody of claim 1, wherein the first antigen-binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a scFv comprising the amino acid sequence of SEQ ID NO:
18.
9. The bispecific antibody of claim 1, wherein the first antigen-binding domain comprises: a) a VH comprising the amino acid sequence of SEQ ID NO:8; and b) a VL comprising the amino acid sequence of SEQ ID NO:9; and wherein the second antigen-binding domain comprises a HC comprising the amino acid sequence of SEQ ID NO:
20.
10. The bispecific antibody of claim 1, wherein the bispecific antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence of SEQ ID NO:11; and c) a scFv comprising an amino acid sequence of SEQ ID NO:
18. 11011. The bispecific antibody of claim 1, wherein the bispecific antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO:10; b) a LC comprising an amino acid sequence of SEQ ID NO:11; and c) a second heavy chain (HC2) comprising an amino acid sequence of SEQ ID NO:
20.
12. The bispecific antibody of claim 1, wherein the first antigen-binding domain does not have cross-reactivity to human CLDN3, CLDN4 or CLDN9.
13. The bispecific antibody of claim 1, wherein the first antigen-binding domain specifically binds an epitope of CLDN6 (SEQ ID NO:1) comprising glutamine 156 (Q156).
14. The bispecific antibody of claim 1, wherein the second antigen-binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid in at least one of amino acid sequence selected from SEQ ID NOs:27-31 and an epitope of CD3δ (SEQ ID NO:22) comprising at least one amino acid in SEQ ID NO:
32.
15. The bispecific antibody of claim 14, wherein the second antigen-binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising at least one amino acid sequence selected from SEQ ID NOs:27-31 and an epitope of CD3δ (SEQ ID NO:22) comprising SEQ ID NO:
32.
16. The bispecific antibody of claim 15, wherein the second antigen-binding domain specifically binds an epitope of CD3ε (SEQ ID NO:23) comprising SEQ ID NOs:27-31 and an epitope of CD3δ (SEQ ID NO:22) comprising SEQ ID NO:
32.
17. The bispecific antibody of claim 1, wherein the first antigen-binding domain binds CLDN6 with a KD of about 23 nM on CHO-CLDN6 overexpressing cells as measured by flow cytometry.
18. The bispecific antibody of claim 17, wherein the second antigen-binding domain does not bind cynomolgus monkey cells expressing cynomolgus CD3. 11119. The bispecific antibody of claim 1, wherein the second antigen-binding domain binds CD3 with a KD of 10-100 nM as measured in a surface plasmon resonance assay at 25 °C.
20. The bispecific antibody of claim 1, wherein the second antigen-binding domain comprises a single-chain antibody.
21. The bispecific antibody of claim 20, wherein the single-chain antibody comprises a single-chain variable fragment (scFv) comprising the amino acid sequence of SEQ ID NO:
18.
22. The bispecific antibody of claim 21, which is an IgG1 subtype.
23. The bispecific antibody of claim 22 comprising an Fc domain, comprising one or more substitutions in the Fc domain that reduces Fc domain-mediated effector function, reduces binding to protein A, or improves bispecific antibody production.
24. The bispecific antibody of claim 23, wherein the one or more substitutions in the Fc domain, using residue numbering according to EU numbering, comprises H435R, Y436F, T366S / L368A / Y407V, T366W, S354C, Y349C, L234A, or L235A.
25. The bispecific antibody of claim 1, which binds both human T-cells and CLDN6 expressing cells.
26. The bispecific antibody of claim 1, which induces T-cell mediated cytotoxicity of CLDN6+ovarian cancer cell lines.
27. The bispecific antibody of claim 1, which induces T-cell mediated cytotoxicity of OVCAR3 cancer cell lines.
28. The bispecific antibody of claim 1, which induces T-cell mediated cytotoxicity of PA-1 cancer cell lines.
29. The bispecific antibody of claim 1, which induces T-cell mediated cytotoxicity of OV-90 cancer cell lines. 11230. The bispecific antibody of claim 1, which induces T-cell activation and proliferation.
31. The bispecific antibody of claim 1, which activates cytokine release.
32. A pharmaceutical composition comprising the bispecific antibody of claim 1 and a pharmaceutically acceptable carrier.
33. A pharmaceutical composition comprising the bispecific antibody of claim 3 and a pharmaceutically acceptable carrier.
34. An isolated nucleic acid encoding the bispecific antibody of claim 3.
35. A vector comprising the isolated nucleic acid of claim 34.
36. A host cell comprising the vector of claim 35.
37. A method of producing the isolated bispecific antibody of claim 1, comprising culturing a host cell of claim 36 under conditions to produce the bispecific antibody, and purifying the bispecific antibody.
38. An isolated antibody or antigen-binding fragment thereof that specifically binds CLDN6 comprising: a) a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3 comprising the amino acid sequence of SEQ ID NOs:2, 3 and 4, respectively, and b) a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3 comprising the amino acid sequence of SEQ ID NOs:5, 6, and 7, respectively.
39. The isolated antibody or antigen-binding fragment thereof of claim 38, wherein the isolated antibody or antigen-binding fragment thereof comprises: a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:8; and b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID 113NO:
9.
40. The isolated antibody or antigen-binding fragment thereof of claim 38, wherein the isolated antibody or antigen-binding fragment thereof comprises: a) a heavy chain comprising the amino acid sequence of SEQ ID NO:10; and b) a light chain comprising the amino acid sequence of SEQ ID NO:
11.
41. The isolated antibody or antigen-binding fragment thereof of claim 38, wherein the isolated antibody or antigen-binding fragment specifically binds human CLDN6 and does not bind human CLDN3, CLDN4 or CLDN9.
42. The isolated antibody or antigen-binding fragment thereof of claim 38, wherein the antibody or antigen-binding fragment thereof specifically binds an epitope of CLDN6 comprising glutamine 156 (Q156) of wildtype CLDN6 (SEQ ID NO:1).
43. The isolated antibody or antigen-binding fragment thereof of claim 38, wherein the isolated antibody or antigen-binding fragment binds human CLDN6 with a KDof about 23 nM on CHO-CLDN6 overexpressing cells as measured by flow cytometry.
44. An isolated nucleic acid encoding the antibody or antigen-binding fragment thereof of claim 38.
45. A vector comprising the isolated nucleic acid of claim 44.
46. A host cell comprising the vector of claim 45.
47. A method of treating a CLDN6 expressing cancer in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the pharmaceutical composition of claim 33.
48. The method of claim 47, wherein the CLDN6 expressing cancer is a solid tumor.
49. The method of claim 47, wherein the CLDN6 expressing cancer is ovarian, 114endometrial, testicular, liver, lung, or gastric cancer.
50. The bispecific antibody of claim 1 for use in a method of treating a disease or disorder in a subject in need thereof.
51. The bispecific antibody for use of claim 50, wherein the disease or disorder is cancer.
52. The bispecific antibody for use of claim 51, wherein the cancer of claim 51, wherein the cancer is a CLDN6 expressing cancer.
52. The bispecific antibody for use of claim 52, wherein the cldn6 expressing cancer is a solid tumor.
53. The bispecific antibody for use of claim 52, wherein the cldn6 expressing cancer is ovarian, endometrial, testicular, liver, lung, or gastric cancer.
54. Use of the bispecific antibody of claim 1 in a method of treating a disease or disorder in a subject in need thereof.
55. The use of claim 54, wherein the disease or disorder is cancer.
56. The use of claim 55, wherein the cancer of claim 51, wherein the cancer is a CLDN6 expressing cancer.
57. The use of claim 56, wherein the CLDN6 expressing cancer is a solid tumor.
58. The use of claim 56, wherein the CLDN6 expressing cancer is ovarian, endometrial, testicular, liver, lung, or gastric cancer.
59. Use of the bispecific antibody of claim 1 in the manufacture of a medicament for treating a disease or disorder in a subject in need thereof.
60. The use of claim 59, wherein the disease or disorder is cancer. 11561. The use of claim 60, wherein the cancer of claim 51, wherein the cancer is a CLDN6 expressing cancer.
62. The use of claim 61, wherein the CLDN6 expressing cancer is a solid tumor.
63. The use of claim 61, wherein the CLDN6 expressing cancer is ovarian, endometrial, testicular, liver, lung, or gastric cancer. 116