mRNA vaccines for human papillomavirus (HPV)

Abstract

Described herein are compositions and methods of using the same. The compositions can include a first nucleic acid encoding for an HPV E6 peptide or a variant or fragment thereof; a second nucleic acid encoding for an HPV E7 peptide or a variant or fragment thereof; and a third nucleic acid encoding a subdomain of the SARS-CoV-2 spike protein.

Description

[0001] Attorney Docket No. 11538-009W01

[0002] MRNA VACCINES FOR HUMAN PAPILLOMAVIRUS (HPV)

[0003] CROSS-REFERENCE TO RELATED APPLICATION

[0004] This application claims priority to, and the benefit of U. S. Provisional Application 63 / 743,456, filed on January 9, 2025, the contents of which is hereby incorporated in its entirety.

[0005] REFERENCE TO SEQUENCE LISTING

[0006] The Sequence Listing submitted January 7, 2026, as a text filed named “11538- 009W01_ST26.xml” created January 5, 2026, and having a file size of 95,374 bytes is hereby incorporated by reference pursuant to 37 C. F. R. § 1.52(e)(5).

[0007] BACKGROUND

[0008] Cervical cancer is the second most common malignancy in women worldwide, accounting for 15% of all cancers diagnosed in women. In the United States, cervical cancer is one of the most common neoplasms of the female genital tract. Cervical intraepithelial neoplasia (CIN) is a precursor to cervical cancer, commonly caused by persistent infection with high-risk human papillomavirus (HR-HPV), particularly types 16, 18, and 31. Overall, HPV DNA has been detected in more than 79% of specimens of women with definite cervical disease. The most prevalent HPV type is HPV 16, which is detected in high-grade squamous intraepithelial lesions and cancer. Results from epidemiological studies support an association between cervical neoplasia and HPV, which is markedly stronger with HPV type 16. Neoplasia is characterized by abnormal growth of cells, which often results in the invasion of normal tissues, e.g., primary tumors or the spread to distant organs, e.g., metastasis.

[0009] Current treatments for CIN2-3, a high-grade pre-cancerous lesion, include surgical procedures, cryotherapy, and topical treatments, but these treatments do not address the underlying viral infection and may fail to preven recurrence. HPV infection is also highly associated with several cancers, including cervical carcinoma, oropharyngeal cancers (head and neck tumors) and other HPV-related cancers. A therapeutic vaccine targeting HPV- specific antigens could provide a non-invasive approach to treating ON 1-3 and preventing progression to cervical cancer and other HPV-related cancers (as well as precursors of these cancers).

[0010] There is a need for compositions targeting HPV-specific antigens. The compositions and methods disclosed herein address these and other needs.Attorney Docket No. 11538-009WO1

[0011] SUMMARY

[0012] Described herein are compositions including: a first nucleic acid encoding for an HPV E6 peptide or a variant or fragment thereof; a second nucleic acid encoding for an HPV E7 peptide or a variant or fragment thereof; and a third nucleic acid encoding a subdomain of the SARS-CoV-2 spike protein.

[0013] Also described herein are nucleic acids including SEQ. ID. NO. 1, SEQ. ID. NO. 2, SEQ. ID. NO. 3, or a combination thereof. Also described herein are proteins including SEQ. ID. NO.

[0014] 25, SEQ. ID. NO. 26, SEQ. ID. NO. 27, or a combination thereof.

[0015] Described herein are also fusion proteins including an E6 HPV portion including SEQ. ID. NO. 25, an E7 HPV portion including SEQ. ID. NO. 26, and a spike domain portion including SEQ. ID. NO. 27.

[0016] Also described herein are cells including the nucleic acid described herein, the protein described herein or the composition described herein.

[0017] Described herein are methods of treating or preventing HPV in a subject, the method including administering to the subject a therapeutically effective amount of the composition described herein, or the nucleic acid described herein.

[0018] Also described herein are methods of treating HPV -related cervical intraepithelial neoplasia (CIN) (e.g., CIN1-3 or CIN 2-3) in a subject, the method comprising administering to the subject a therapeutically effective amount of the composition described herein, or the nucleic acid described herein.

[0019] Also described herein are methods for reducing a risk of recurrence of a pre-cancerous or cancerous growth in a subject infected with HPV who has been treated for the growth, the method comprising administering to the subject a therapeutically effective amount of the composition described herein, or the nucleic acid described herein.

[0020] Also described are methods of treating cervical cancer in a subject, the method comprising administering to the subject a therapeutically effective amount of the composition described herein, or the nucleic acid described herein.

[0021] Described herein are also methods of treating an HPV -related cancer in a subject, the method comprising administering to the subject a therapeutically effective amount of the composition described herein, or the nucleic acid described herein.

[0022] Described herein are also methods of treating recurrent respiratory papillomatosis (RRP) in a subject, the method comprising administering to the subject a therapeutically effective amount of the composition described herein or the nucleic acid described herein.Attorney Docket No. 11538-009W01

[0023] The details of one or more embodiments of the disclosure are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the disclosure will be apparent from the description and drawings, and from the claims.

[0024] DESCRIPTION OF DRAWINGS FIG. 1 shows a schematic design of pan-mRNA-5 and pan-mRNA-6 HPV therapeutic vaccines.

[0025] FIGs. 2A-2D show in vitro validation of pan-mRNA-5 therapeutic vaccine. (2A) Schematic representation of pan-mRNA-5 in vitro transcription and synthesis workflow. Pan- mRNA-5 encodes a polyprotein comprising HPV31-E6 / E7, HPV52-E6 / E7, and HPV18-E6 / E7. (2B) Western blot analysis of pan-mRNA-5 fusion protein expression in HEK293T cells following transfection with MessengerMAX reagent or lipid nanoparticle (LNP) formulation. (2C) Physicochemical characterization of LNP formulation showing particle size distribution and polydispersity index (PDI). (2D) mRNA encapsulation efficiency of the LNP formulation.

[0026] FIG. 3 shows Pan-mRNA-5 induces robust antigen-specific T cell responses in vivo. FIGs. 4A-4D illustrates the design, production, and validation of an example HPV vaccine described herein. Exemplary vaccine includes two mRNAs, which respectively induce broad T-cell and specific CD8 T-cell responses to achieve maximum antitumor activity. Design and in vitro validation of example mRNA vaccine. (4A) shows vaccine includes two mRNAs, mRNA-1 expressing HPV 16 E6 E7 and S2 gene fragments from SARS-CoV-2 to induce HPV-specific T-cell immunity in mice and humans. mRNA-3 expresses human and HLA-A2.1 restricted E6-derived CD8 T-cell epitopes and the HLA-A2 gene, inducing HLA-A2-specific CD8 T-cell immunity. (4B) electrophoresis detection of mRNA-1 and mRNA-3 transcription and purification in vitro. Detection of particle size (4C) and (4D) encapsulation efficiency of nanoparticles containing mRNA-1 and -3 using LNPs.

[0027] DETAILED DESCRIPTION

[0028] A number of embodiments of the disclosure have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.

[0029] Definitions

[0030] To facilitate understanding of the disclosure set forth herein, a number of terms are defined below. Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art to which thisAttorney Docket No. 11538-009W01

[0031] disclosure belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.

[0032] General Definitions

[0033] As used in this specification and the following claims, the terms “comprise” (as well as forms, derivatives, or variations thereof, such as “comprising” and “comprises”) and “include” (as well as forms, derivatives, or variations thereof, such as “including” and “includes”) are inclusive (i.e., open-ended) and do not exclude additional elements or steps. For example, the terms "comprise" and / or "comprising," when used in this specification, specify the presence of stated features, integers, steps, operations, elements, and / or components, but do not preclude the presence or addition of one or more other features, integers, steps, operations, elements, components, and / or groups thereof. Other than where noted, all numbers expressing quantities of ingredients, reaction conditions, geometries, dimensions, and so forth used in the specification and claims are to be understood at the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, to be construed in light of the number of significant digits and ordinary rounding approaches.

[0034] Accordingly, these terms are intended to not only cover the recited element(s) or step(s), but may also include other elements or steps not expressly recited. Furthermore, as used herein, the use of the terms “a”, “an”, and “the” when used in conjunction with an element may mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.” Therefore, an element preceded by “a” or “an” does not, without more constraints, preclude the existence of additional identical elements.

[0035] Ranges can be expressed herein as from “about” one particular value, and / or to “about” another particular value. By “about” is meant within 5% of the value, e.g., within 4, 3, 2, or 1 % of the value. When such a range is expressed, another aspect includes from the one particular value and / or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent “about,” it will be understood that the particular value forms another aspect. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint. It is also understood that there are a number of values disclosed herein, and that each value is also herein disclosed as “about” that particular value in addition to the value itself. For example, if the value “10” is disclosed, then “about 10” is also disclosed. A range may be construed to include the start and the end of the range. For example, a range of 10% to 20% (i.e., range ofAttorney Docket No. 11538-009W01

[0036] 10%-20%) can includes 10% and also includes 20%’, and includes percentages inbetween 10% and 20%, unless explicitly stated otherwise herein.

[0037] As used herein, the terms "may," "optionally," and "may optionally" are used interchangeably and are meant to include cases in which the condition occurs as well as cases in which the condition does not occur. Thus, for example, the statement that a formulation "may include an excipient" is meant to include cases in which the formulation includes an excipient as well as cases in which the formulation does not include an excipient.

[0038] It is understood that when combinations, subsets, groups, etc. of elements are disclosed (e.g., combinations of components in a composition, or combinations of steps in a method), that while specific reference of each of the various individual and collective combinations and permutations of these elements may not be explicitly disclosed, each is specifically contemplated and described herein.

[0039] “Administration" to a subject includes any route of introducing or delivering to a subject an agent. Administration can be carried out by any suitable route, including oral, topical, transcutaneous, transdermal, intra-joint, intra-arteriole, intradermal, intraventricular, intralesional, intranasal, rectal, vaginal, by inhalation, via an implanted reservoir, parenteral (e.g., subcutaneous, intravenous, intramuscular, intra- articular, intra-synovial, intrasternal, intrathecal, intraperitoneal, intrahepatic, intralesional, and intracranial injections or infusion techniques), and the like. " Concurrent administration", "administration in combination", "simultaneous administration" or "administered simultaneously" as used herein, means that the compounds are administered at the same point in time or essentially immediately following one another. In the latter case, the two compounds are administered at times sufficiently close that the results observed are indistinguishable from those achieved when the compounds are administered at the same point in time. " Systemic administration" refers to the introducing or delivering to a subject an agent via a route which introduces or delivers the agent to extensive areas of the subject's body (e.g. greater than 50% of the body), for example through entrance into the circulatory or lymph systems. By contrast, "local administration" refers to the introducing or delivery to a subject an agent via a route which introduces or delivers the agent to the area or area immediately adjacent to the point of administration and does not introduce the agent systemically in a therapeutically significant amount. For example, locally administered agents are easily detectable in the local vicinity of the point of administration but are undetectable or detectable at negligible amounts in distal parts of the subject's body. Administration includes self-administration and the administration by another.Attorney Docket No. 11538-009W01

[0040] As used here, the terms “beneficial agent” and “active agent” are used interchangeably herein to refer to a chemical compound or composition that has a beneficial biological effect. Beneficial biological effects include both therapeutic effects, i.e., treatment of a disorder or other undesirable physiological condition, and prophylactic effects, i.e., prevention of a disorder or other undesirable physiological condition. The terms also encompass pharmaceutically acceptable, pharmacologically active derivatives of beneficial agents specifically mentioned herein, including, but not limited to, salts, esters, amides, prodrugs, active metabolites, isomers, fragments, analogs, and the like. When the terms “beneficial agent” or “active agent” are used, then, or when a particular agent is specifically identified, it is to be understood that the term includes the agent per se as well as pharmaceutically acceptable, pharmacologically active salts, esters, amides, prodrugs, conjugates, active metabolites, isomers, fragments, analogs, etc.

[0041] A "decrease" can refer to any change that results in a smaller amount of a symptom, disease, composition, condition, or activity. A substance is also understood to decrease the genetic output of a gene when the genetic output of the gene product with the substance is less relative to the output of the gene product without the substance. Also, for example, a decrease can be a change in the symptoms of a disorder such that the symptoms are less than previously observed. A decrease can be any individual, median, or average decrease in a condition, symptom, activity, composition in a statistically significant amount. Thus, the decrease can be a 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100% decrease so long as the decrease is statistically significant.

[0042] " Inhibit," "inhibiting," and "inhibition" mean to decrease an activity, response, condition, disease, or other biological parameter. This can include but is not limited to the complete ablation of the activity, response, condition, or disease. This may also include, for example, a 10% reduction in the activity, response, condition, or disease as compared to the native or control level. Thus, the reduction can be a 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between as compared to native or control levels.

[0043] “Inactivate”, “inactivating” and “inactivation” means to decrease or eliminate an activity, response, condition, disease, or other biological parameter due to a chemical (covalent bond formation) between the ligand and a its biological target.

[0044] By “reduce” or other forms of the word, such as “reducing” or “reduction,” is meant lowering of an event or characteristic (e.g., tumor growth). It is understood that this is typically in relation to some standard or expected value, in other words it is relative, but that it is not always necessary for the standard or relative value to be referred to.Attorney Docket No. 11538-009W01

[0045] As used herein, the terms "‘treating” or “treatment” of a subject includes the administration of a drug to a subject with the purpose of preventing, curing, healing, alleviating, relieving, altering, remedying, ameliorating, improving, stabilizing or affecting a disease or disorder, or a symptom of a disease or disorder. The terms “treating” and “treatment” can also refer to reduction in severity and / or frequency of symptoms, elimination of symptoms and / or underlying cause, prevention of the occurrence of symptoms and / or their underlying cause, and improvement or remediation of damage.

[0046] By “prevent” or other forms of the word, such as “preventing” or “prevention,” is meant to stop a particular event or characteristic, to stabilize or delay the development or progression of a particular event or characteristic, or to minimize the chances that a particular event or characteristic will occur. Prevent does not require comparison to a control as it is typically more absolute than, for example, reduce. As used herein, something could be reduced but not prevented, but something that is reduced could also be prevented. Likewise, something could be prevented but not reduced, but something that is prevented could also be reduced. It is understood that where reduce or prevent are used, unless specifically indicated otherwise, the use of the other word is also expressly disclosed. For example, the terms “prevent” or “suppress” can refer to a treatment that forestalls or slows the onset of a disease or condition or reduced the severity of the disease or condition. Thus, if a treatment can treat a disease in a subject having symptoms of the disease, it can also prevent or suppress that disease in a subject who has yet to suffer some or all of the symptoms. As used herein, the term “preventing” a disorder or un anted physiological event in a subject refers specifically to the prevention of the occurrence of symptoms and / or their underlying cause, wherein the subject may or may not exhibit heightened susceptibility to the disorder or event.

[0047] By the term “effective amount” of a therapeutic agent is meant a nontoxic but sufficient amount of a beneficial agent to provide the desired effect. The amount of beneficial agent that is “effecti ve” will vary from subject to subject, depending on the age and general condition of the subject, the particular beneficial agent or agents, and the like. Thus, it is not always possible to specify an exact “effective amount”. However, an appropriate “effective’ amount in any subject case may be determined by one of ordinary skill in the art using routine experimentation. Also, as used herein, and unless specifically stated otherwise, an “effective amount” of a beneficial can also refer to an amount covering both therapeutically effective amounts and prophylactically effective amounts.Attorney Docket No. 11538-009W01

[0048] An “effective amount” of a drug necessary to achieve a therapeutic effect may vary according to factors such as the age, sex, and weight of the subject. Dosage regimens can be adjusted to provide the optimum therapeutic response. For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the therapeutic situation.

[0049] As used herein, a “therapeutically effective amount” of a therapeutic agent refers to an amount that is effective to achieve a desired therapeutic result, and a “prophylactical ly effective amount” of a therapeutic agent refers to an amount that is effective to prevent an unwanted physiological condition. Therapeutically effective and prophylactically effective amounts of a given therapeutic agent will typically vary with respect to factors such as the type and severity of the disorder or disease being treated and the age, gender, and weight of the subject. The term “therapeutically effective amount” can also refer to an amount of a therapeutic agent, or a rate of delivery of a therapeutic agent (e.g., amount over time), effective to facilitate a desired therapeutic effect. The precise desired therapeutic effect will vary according to the condition to be treated, the tolerance of the subject, the drug and / or drug formulation to be administered (e.g., the potency of the therapeutic agent (drug), the concentration of drug in the formulation, and the like), and a variety of other factors that are appreciated by those of ordinary skill in the art.

[0050] As used herein, the term “pharmaceutically acceptable” component can refer to a component that is not biologically or otherwise undesirable, i.e., the component may be incorporated into a pharmaceutical formulation of the invention and administered to a subject as described herein without causing any significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the formulation in which it is contained. When the term “pharmaceutically acceptable” is used to refer to an excipient, it is generally implied that the component has met the required standards of toxicological and manufacturing testing or that it is included on the Inactive Ingredient Guide prepared by the U. S. Food and Drug Administration.

[0051] " Pharmaceutically acceptable carrier" (sometimes referred to as a "carrier") means a carrier or excipient that is useful in preparing a pharmaceutical or therapeutic composition that is generally safe and non-toxic and includes a carrier that is acceptable for veterinary and / or human pharmaceutical or therapeutic use. 'The terms "carrier" or "pharmaceutically acceptable carrier" can include, but are not limited to, phosphate buffered saline solution, water, emulsions (such as an oil / water or water / oil emulsion) and / or various types of wetting agents. As used herein, the term "carrier" encompasses, but is not limited to, any excipient, diluent, filler, salt, buffer,Attorney Docket No. 11538-009W01

[0052] stabilizer, solubilizer, lipid, stabilizer, or other material well known in the art for use in pharmaceutical formulations and as described further herein.

[0053] As used herein, “pharmaceutically acceptable salt” is a derivative of the disclosed compound in which the parent compound is modified by making inorganic and organic, nontoxic, acid or base addition salts thereof. The salts of the present compounds can be synthesized from a parent compound that contains a basic or acidic moiety by conventional chemical methods. Generally, such salts can be prepared by reacting free acid forms of these compounds with a stoichiometric amount of the appropriate base (such as Na, Ca, Mg, or K hydroxide, carbonate, bicarbonate, or the like), or by reacting free base forms of these compounds with a stoichiometric amount of the appropriate acid. Such reactions are typically carried out in water or in an organic solvent, or in a mixture of the two. Generally, non-aqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are typical, where practicable. Salts of the present compounds further include solvates of the compounds and of the compound salts.

[0054] Examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like. The pharmaceutically acceptable salts include the conventional non-toxic salts and the quaternary ammonium salts of the parent compound formed, for example, from non-toxic inorganic or organic acids. For example, conventional non-toxic acid salts include those derived from inorganic acids such as hydrochloric, hydrobromic, sulfuric, sulfamic, phosphoric, nitric and the like; and the salts prepared from organic acids such as acetic, propionic, succinic, glycolic, stearic, lactic, malic, tartaric, citric, ascorbic, pamoic, maleic, hydroxymaleic, phenylacetic, glutamic, benzoic, salicylic, mesylic, esylic, besylic, sulfanilic, 2- acetoxybenzoic, fumaric, toluenesulfonic, methanesulfonic, ethane disulfonic, oxalic, isethionic, H00C-(CH2)n- COOH where n is 0-4, and the like, or using a different acid that produces the same counterion. Lists of additional suitable salts may be found, e.g., in Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, Pa., p. 1418 (1985).

[0055] Also, as used herein, the term “pharmacologically active” (or simply “active”), as in a “pharmacologically active” derivative or analog, can refer to a derivative or analog (e.g., a salt, ester, amide, conjugate, metabolite, isomer, fragment, etc.) having the same type of pharmacological activity as the parent compound and approximately equivalent in degree.

[0056] A “control” is an alternative subject or sample used in an experiment for comparison purposes. A control can be "positive" or "negative."Attorney Docket No. 11538-009W01

[0057] As used herein, by a “subject” is meant an individual. Thus, the “subject” can include domesticated animals (e.g., cats, dogs, etc.), livestock (e.g., cattle, horses, pigs, sheep, goats, etc.), laboratory animals (e.g., mouse, rabbit, rat, guinea pig, etc.), and birds. “Subject” can also include a mammal, such as a primate or a human. Thus, the subject can be a human or veterinary patient. The term “patient” refers to a subject under the treatment of a clinician, e.g., physician. In some embodiments, the subject is a mammal. In some embodiments, the mammal is a human. In some embodiments, the subject is a veterinary patient. Administration of the therapeutic agents can be carried out at dosages and for periods of time effective for treatment of a subject. In some embodiments, the subject is a human.

[0058] Genetic Definitions

[0059] The term “nucleic acid” as used herein means a polymer composed of nucleotides, e.g. deoxyribonucleotides or ribonucleotides.

[0060] The terms “ribonucleic acid” and “RNA” as used herein mean a polymer composed of ribonucleotides.

[0061] The terms “deoxyribonucleic acid” and “DNA” as used herein mean a polymer composed of deoxyribonucleotides.

[0062] The term “oligonucleotide” denotes single- or double-stranded nucleotide multimers of from about 2 to up to about 100 nucleotides in length. Suitable oligonucleotides may be prepared by the phosphoramidite method described by Beaucage and Carruthers, Tetrahedron Leu., 22:1859-1862 (1981), or by the triester method according to Matteucci, et al., J. Am. Chem. Soc., 103:3185 (1981), both incorporated herein by reference, or by other chemical methods using either a commercial automated oligonucleotide synthesizer or VLSIPS™ technology. When oligonucleotides are referred to as “double-stranded,” it is understood by those of skill in the art that a pair of oligonucleotides exist in a hydrogen-bonded, helical array typically associated with, for example, DNA. In addition to the 100% complementary form of double-stranded oligonucleotides, the term “double-stranded,” as used herein is also meant to refer to those forms which include such structural features as bulges and loops, described more fully in such biochemistry texts as Stryer, Biochemistry, Third Ed., (1988), incorporated herein by reference for ail purposes.

[0063] The term “polynucleotide” refers to a single or double stranded polymer composed of nucleotide monomers. The polynucleotide sequence may be modified, for example, to enhance efficacy and / or to reduce immune responsivity, by using, for example, base modifications or end-capping. In other embodiments, an unmodified polynucleotide sequence is used. ForAttorney Docket No. 11538-009W01

[0064] example, the polynucleotide can be an RNA sequence or a DNA sequence. In some embodiments, the mRNA can include an optimized codon. By codon optimizing, the formation of secondary structures can be reduced and translational efficiency improved. In certain embodiments, the codon optimization includes GC enrichment of the coding region. In certain embodiments, the codon optimization includes codon quality enrichment of the coding region. In certain aspects, the mRNA can include one or more regions or parts, which act or function as an untranslated region (UTRs) of a gene. UTRs are transcribed but not translated. In mRNA, the 5' UTR starts at the transcription start site and continues to the start codon but does not include the start codon. The 3' UTR starts immediately following the stop codon and continues until the transcriptional termination signal. The use of human-derived UTRs may facilitate the expression of the polypeptide in cells. In some embodiments, the polynucleotide comprises at least one chemically modified nucleotide. In some embodiments, the at least one chemically modified nucleotide comprises a chemically modified nucleobase, a chemically modified ribose, a chemically modified phosphodiester linkage, or a combination thereof. In some embodiments, the polynucleotide sequence as used comprise modified nucleosides such as 5-methylcystonsine or psudouridine.

[0065] As used herein “modified” refers to a changed state or structure of a molecule of the invention. Molecules may be modified in many ways including chemically, structurally, and functionally. In one embodiment, the polynucleotides of the present invention are “chemically modified” by the introduction of non-natural nucleosides and / or nucleotides, e.g., as it relates to the natural ribonucleotides A, U, G, and C. Modifications of the nucleosides and / or nucleotides as used in the present invention may be naturally occurring (i.e. comprise a nucleotide and / or nucleoside other than the natural ribonucleotides A, U, G, and C) or may be artificial. Non-canonical nucleotides such as the cap structures are not considered “modified” although they differ from the chemical structure of A, G, C, and U ribonucleotides. As used herein, a “structural” modification is one in which two or more linked nucleosides are inserted, deleted, duplicated, inverted or randomized in a polynucleotide without significant chemical modification to the nucleotides themselves. Because chemical bonds will necessarily be broken and reformed to affect a structural modification, structural modifications are of a chemical nature and hence are chemical modifications. However, structural modifications will result in a different sequence of nucleotides. Wien the polynucleotides of the present invention are chemically and / or structurally modified, the polynucleotides may be referred to as “modified nucleotides”.Attorney Docket No. 11538-009WO1

[0066] In some embodiments, the nucleic acids disclosed herein can include at least one chemically modified nucleotide. In some embodiments, the at least one chemically modified nucleotide comprises a chemically modified nucleobase, a chemically modified ribose, a chemically modified phosphodiester linkage, or a combination thereof.

[0067] In one embodiment, the at least one chemically modified nucleotide is a chemically modified nucleobase.

[0068] In one embodiment, the chemically modified nucleobase is selected from 5-formylcytidine (5fC), 5-niethylcytidine (5meC), 5 -methoxy cytidine (5moC), 5 -hydroxy cytidine (5hoC), 5 -hydroxymethylcytidine (5hmC), 5-formyluridine (5fU), 5 -methyluridine (5-meU), 5-m ethoxyuridine (5moU), 5 -carboxy methyl esteruridine (5camU), pseudouri dine (T), N1-methylpseudouridine (melvP), N°-methyladenosine (me6A), or thienoguanosine (*G).

[0069] In some embodiments, the chemically modified nucleobase is 5-methoxyuridine (5moU). In some embodiments, the chemically modified nucleobase is pseudouridine (T). In some embodiments, the chemically modified nucleobase is N^-methylpseudouridine (melvP).

[0070] The structures of these modified nucleobases are shown below:

[0071] S'methoxyeytkisn® S-ii / dioxyineti.yU (5tnoC) (5huC) cyiidiBie (5temC)

[0072] Uridine 54wmylaridine 5-meftyliiridine 5-methosty- 5-carboxy- pswttowiriirse bl -methylpsoinjo- (U) (5fUj (SirieU) uridine (StnoU } (Vi tifidine (me' V } estemrtdsne (SesmUj r MN-" O

[0073] NH2R*rBtose R

[0074] Adenosine iVieiftyiadsnosine Guanosine Thien>ianosins (G) rs)

[0075]

[0076] In one embodiment, the at least one chemically modified nucleotide is a chemically modified ribose.

[0077] In one embodiment, the chemically modified ribose is selected from 2'-O-methyl (2'-O- Me), 2'-Fluoro (2'-F), 2'-deoxy-2'-fIuoro-beta-D-arabino-nucleic acid (2'F-ANA), 4'-S, 4'-Attorney Docket No. 11538-009W01

[0078] SFANA, 2'-azido, UNA, 2'-O-methoxy-ethyl (2'-0-ME), 2'-0-Allyl, 2'-0-EthyIamine, '-0- Cyanoethyl, Locked nucleic acid (LAN), Methylene-cLAN, N-MeO-amino BNA, or N-MeO-aminooxy BNA. In one embodiment, the chemically modified ribose is 2'-O-methyl (2'-0-Me). In one embodiment, the chemically modified ribose is 2'-Fluoro (2'-F).

[0079] The structures of these modified riboses are shown below:

[0080] S'-O-mthyi rtudefe -scid {2T-ANA;

[0081] 4’-S UNA

[0082] a'-a-rctsitoy- a'-CLCyanoeihyl W (2*-OA1£)

[0083] Locketf nucisfc acid BNA

[0084]

[0085] (LAN) In one embodiment, the at least one chemically modified nucleotide is a chemically modified phosphodiester linkage.

[0086] In one embodiment, the chemically modified phosphodiester linkage is selected from phosphorothioate (PS), boranophosphate, phosphodithioate (PS2), 3',5'-amide, N3'-phosphoramidate (NP), Phosphodiester (PO), or 2', 5 '-phosphodiester (2',5'-PO). In one embodiment, the chemically modified phosphodiester linkage is phosphorothioate.

[0087] The structures of these modified phosphodiester linkages are shown below:Attorney Docket No. 11538-009W01

[0088] Ph&sphodfthtoste (PS2J

[0089]

[0090] (MP) Phosphofiissier (PO) (2’,5’-PO) In some embodiments, the mRNA can include a heterologous 5’ untranslated region (5’UTR). In some embodiments, the mRNA can include a heterologous 3’ untranslated region (3’UTR).

[0091] The term “polypeptide” refers to a compound made up of a single chain of D- or L-amino acids or a mixture of D- and L-amino acids joined by peptide bonds. A polypeptide is comprised of approximately twenty, standard naturally occurring amino acids, although natural and synthetic amino acids which are not members of the standard twenty amino acids may also be used. The standard twenty amino acids include alanine (Ala, A), arginine (Arg, R), asparagine (Asn, N), aspartic acid (Asp, D), cysteine (Cys, C), glutamine (Gin, Q), glutamic acid (Glu, E), glycine (Gly, G), histidine, (His, H), isoleucine (lie, I), leucine (Leu, L), lysine (Lys, K), methionine (Met, M), phenylalanine (Phe, F), proline (Pro, P), serine (Ser, S), threonine (Thr, T), tryptophan (Trp, W), tyrosine (Tyr, Y), and valine (Vai, V). The terms "polypeptide sequence" or “amino acid sequence” are an alphabetical representation of a polypeptide molecule.

[0092] Conservative substitutions of amino acids in proteins and polypeptides are known in the art. For example, the replacement of one amino acid residue with another that is biologically and / or chemically similar is known to those skilled in the art as a conservative substitution. For example, a conservative substitution would be replacing one hydrophobic residue for another, or one polar residue for another. The substitutions include combinations such as, for example, Gly, Ala; Vai, He, Leu; sp, Glu; Asn, Gin; Ser, Thr; Lys, Arg; and Phe, Tyr. Such conservatively substituted variations of each explicitly disclosed sequence are included within the polypeptides provided herein.Attorney Docket No. 11538-009W01

[0093] Substantial changes in protein function or immunological identity are made by selecting substitutions that are less conservative, i.e., selecting residues that differ more significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site or (c) the bulk of the side chain. The substitutions which in general are expected to produce the greatest changes in the protein properties will be those in which (a) a hydrophilic residue, e.g. seryl or threonyl, is substituted for (or by) a hydrophobic residue, e.g. leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, e.g., lysyl, arginyl, or histidyl, is substituted for (or by) an electronegative residue, e.g., glutamyl or aspartyl; or (d) a residue having a bulky side chain, e.g., phenylalanine, is substituted for (or by) one not having a side chain, e.g., glycine, in tills case, (e) by increasing the number of sites for sulfation and / or glycosylation.

[0094] A “variant” refers to a molecule substantially similar in structure. Thus, in one embodiment, a variant refers to a protein whose amino acid sequence is similar to a reference amino acid sequence, but does not have 100% identity with the respective reference sequence. The variant protein has an altered sequence in which one or more of the amino acids in the reference sequence is deleted or substituted, or one or more amino acids are inserted into the sequence of the reference amino acid sequence. As a result of the alterations, the variant protein has an amino acid sequence which is at least 60%, 70%, 75%, 80%, 85%, 90%, or 95% identical to the reference sequence. For example, variant sequences which are at least 95% identical have no more than 5 alterations, i.e. any combination of deletions, insertions or substitutions, per 100 amino acids of the reference sequence.

[0095] The term “complementary” refers to the topological compatibility or matching together of interacting surfaces of a probe molecule and its target. Thus, the target and its probe can be described as complementary, and furthermore, the contact surface characteristics are complementary to each other.

[0096] The term “hybridization” refers to a process of establishing a non-covalent, sequence¬ specific interaction between two or more complementary strands of nucleic acids into a single hybrid, which in the case of two strands is referred to as a duplex.

[0097] The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60%Attorney Docket No. 11538-009W01

[0098] identity, preferably 61%, 62%’, 63%, 64%, 65%’, 66%, 67%, 68%’, 69%, 70%, 71%’, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, SH%, 95%, 96%, 97%, 98%, 99% or higher identity over a specified region when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site or the like). Such sequences are then said to be “substantially identical.” This definition also refers to, or may be applied to, the compliment of a test sequence. The definition also includes sequences that have deletions and / or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like. Preferably, identity exists over a region that is at least about 10 amino acids or 20 nucleotides in length, or more preferably over a region that is 10-50 amino acids or 20-50 nucleotides in length. As used herein, percent (%) amino acid sequence identity is defined as the percentage of amino acids in a candidate sequence that are identical to the amino acids in a reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared can be determined by known methods.

[0099] For sequence comparisons, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Preferably, default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.

[0100] One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves firstAttorney Docket No. 11538-009W01

[0101] identifying high scoring sequence pairs (IISPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al. (1990). J. Mol. Biol. 215:403-410). These initial neighborhood word hits act as seeds for initiating searches to find longer IISPs containing them. 'The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.

[0102] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01.

[0103] The term "nucleobase" refers to the pat of a nucleotide that bears the Watson / Crick base¬ pairing functionality. The most common naturally-occurring nucleobases, adenine (A), guanine (G), uracil (U), cytosine (C), and thymine ('I') bear the hydrogen-bonding functionality that binds one nucleic acid strand to another in a sequence specific manner.

[0104] CompositionsAttorney Docket No. 11538-009WO1

[0105] In some embodiments, a composition can include: a first nucleic acid encoding for an HPV E6 peptide or a variant or fragment thereof; a second nucleic acid encoding for an HPV E7 peptide or a variant or fragment thereof; and a third nucleic acid encoding a subdomain of the SARS-CoV-2 spike protein.

[0106] In some embodiments, the first nucleic acid can encode for an HPV 16 E6 peptide or a variant or fragment thereof. In some embodiments, the first nucleic acid can include SEQ. ID. NO. 1 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity. In some embodiments, the first nucleic acid can encode for SEQ. ID. NO. 25 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity.

[0107] In some embodiments, the second nucleic acid can encode for an HPV 16 E7 peptide or a variant or fragment thereof. In some embodiments, the second nucleic acid can include SEQ. ID. NO. 2 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity. In some embodiments, the second nucleic acid can encode for SEQ. ID. NO. 26 or variant having at least 90%’ (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity.

[0108] In some embodiments, the third nucleic acid can encode the S2 subdomain of the SARS-CoV-2 spike protein. In some embodiments, the third nucleic acid can include SEQ. ID. NO. 3 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity. In some embodiments, the third nucleic acid can encode for SEQ. ID. NO. 27 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity.

[0109] In some embodiments, the first nucleic acid, the second nucleic acid, and the third nucleic acid are linked. In some embodiments, the first nucleic acid, the second nucleic acid, the third nucleic acid, or a combination thereof are linked directly or via a peptide linker such as a glycine-serine linker, glycine-rich linker, or GSAT linker.

[0110] In some embodiments, the first nucleic acid, the second nucleic acid, the third nucleic acid, or a combination thereof are linked via F2A, P2A, T2A or E2A from Ewing's sarcoma activated transcript- 1 (EAT2).

[0111] In some embodiments, the first nucleic acid, the second nucleic acid, the third nucleic acid, or a combination thereof are linked via internal ribosome entry site (IRES) derived from Picornavirus, Aphthovirus, Kaposi's sarcoma-associated herpesvirus, Hepatitis A, Hepatitis C, Pestivirus, Cipavirus, Rhopalosiphum padivirus, etc.Attorney Docket No. 11538-009W01

[0112] In some embodiments, upon administration to a human subject, the composition can elicit a T-cell mediated immune response targeting HPV-infected cells.

[0113] In some embodiments, the composition can further include a fourth nucleic acid encoding one or more human HLA-A2.1 restricted E6-derived CD8 T-cell epitopes. In some embodiments, the third nucleic acid includes SEQ. ID. NO. 49 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity.

[0114] In some embodiments, the composition can further include a fifth nucleic acid encoding HLA-A2. In some embodiments, the fifth nucleic acid can include SEQ. ID. NO. 50 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity.

[0115] In some embodiments, upon administration to a human subject, the composition induces HLA-A2-specific CD8 T-cell immunity.

[0116] In some embodiments, the first nucleic acid, the second nucleic acid, and the third nucleic acid can include plasmid DNA, minicircle DNA, microRNA, mRNA, self-amplifying RNA, circle RNA, DNA launched self-amplifying RNA, or viral vector.

[0117] In some embodiments, the composition can further include one or more additional nucleic acids encoding for an HPV antigen from another HPV strain, one or more additional nucleic acids encoding for an HPV antigen other than an E6 or E7 peptide or a variant or fragment thereof, or a combination thereof.

[0118] In some embodiments, the composition can further include one or more additional nucleic acids encoding an HPV antigen from HPV 18, HPV 31, HPV 33, HPV 35, HPV 39, HPV 45, HPV 51, HPV 52, HPV 56, HPV 58, HPV 59, HPV 66, or a combination thereof.

[0119] In some embodiments, the composition can further include one or more additional nucleic acids encoding an HPV LI peptide or a variant or fragment thereof, an HPV E2 peptide or a variant or fragment thereof, or a combination thereof.

[0120] In some embodiments, the one or more additional nucleic acids can encode for an HPV 18 E6 peptide or a variant or fragment thereof, an HPV 31 E6 peptide or a variant or fragment thereof, an HPV 33 E6 peptide or a variant or fragment thereof, an HPV 35 E6 peptide or a variant or fragment thereof, an HPV 39 E6 peptide or a variant or fragment thereof, an HPV 45 E6 peptide or a variant or fragment thereof, an HPV 51 E6 peptide or a variant or fragment thereof, an HPV 52 E6 peptide or a variant or fragment thereof, an HPV 56 E6 peptide or a variant or fragment thereof, an HPV 58 E6 peptide or a variant or fragment thereof, an HPV 59 E6 peptide or a variant or fragment thereof, an HPV 66 E6 peptide or a variant or fragmentAttorney Docket No. 11538-009W01

[0121] thereof, an HPV 18 E7 peptide or a variant or fragment thereof, an HPV 31 E7 peptide or a variant or fragment thereof, an HPV 33 E7 peptide or a variant or fragment thereof, an HPV 35 E7 peptide or a variant or fragment thereof, an HPV 39 E7 peptide or a variant or fragment thereof, an HPV 45 E7 peptide or a variant or fragment thereof, an HPV 1 E7 peptide or a variant or fragment thereof, an HPV 52 E7 peptide or a variant or fragment thereof, an HPV 6 E7 peptide or a variant or fragment thereof, an HPV 8 E7 peptide or a variant or fragment thereof, an HPV 59 E7 peptide or a variant or fragment thereof, an HPV 66 E7 peptide or a variant or fragment thereof, an HPV 16 LI peptide or a variant or fragment thereof, an HPV 18 LI peptide or a variant or fragment thereof, an HPV 31 LI peptide or a variant or fragment thereof, an HPV 33 LI peptide or a variant or fragment thereof, an HPV 35 LI peptide or a varia t or fragment thereof, an HPV 39 LI peptide or a variant or fragment thereof, an HPV 45 LI peptide or a variant or fragment thereof, an HPV 51 LI peptide or a variant or fragment thereof, an HPV 52 LI peptide or a variant or fragment thereof, an HPV 56 LI peptide or a variant or fragment thereof, an HPV 58 LI peptide or a variant or fragment thereof, an HPV 59 LI peptide or a variant or fragment thereof, an HPV 66 LI peptide or a variant or fragment thereof, an HPV 16 E2 peptide or a variant or fragment thereof, an HPV 18 E2 peptide or a variant or fragment thereof, an HPV 31 E2 peptide or a variant or fragment thereof, an HPV 33 E2 peptide or a variant or fragment thereof, an HPV 35 E2 peptide or a variant or fragment thereof, an HPV 39 E2 peptide or a variant or fragment thereof, an HPV 45 E2 peptide or a variant or fragment thereof, an HPV 1 E2 peptide or a varia t or fragment thereof, an HPV E2 LI peptide or a variant or fragment thereof, an HPV 56 E2 peptide or a variant or fragment thereof, an HPV 58 E2 peptide or a variant or fragment thereof, an HPV 59 E2 peptide or a variant or fragment thereof, an HPV 66 E2 peptide or a variant or fragment thereof, or a combination thereof.

[0122] In some embodiments, the one or more additional nucleic acids can include SEQ. ID. NO. 4, SEQ. ID. NO. 5, SEQ. ID. NO. 6, SEQ. ID. NO. 7, SEQ. ID. NO. 8, SEQ. ID. NO. 9, SEQ. ID. NO. 10, SEQ. ID. NO. 11, SEQ. ID. NO. 12, SEQ. ID. NO. 13, SEQ. ID. NO. 14, SEQ. ID. NO. 15, SEQ. ID. NO. 16, SEQ. ID. NO. 17, SEQ. ID. NO. 18, SEQ. ID. NO. 19, SEQ. ID. NO. 20, SEQ. ID. NO. 21, SEQ. ID. NO. 22, SEQ. ID. NO. 23, SEQ. ID. NO. 24, or variants having at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, or a combination thereof.

[0123] In some embodiments, the one or more additional nucleic acids can encode for SEQ. ID. NO. 28, SEQ. ID. NO. 29, SEQ. ID. NO. 30, SEQ. ID. NO. 31, SEQ. ID. NO. 32, SEQ. ID. NO.Attorney Docket No. 11538-009W01

[0124] 33, SEQ. ID. NO. 34, SEQ. ID. NO. 35, SEQ. ID. NO. 36, SEQ. ID. NO. 37, SEQ. ID. NO. 38, SEQ. ID. NO. 39, SEQ. ID. NO. 40, SEQ. ID. NO. 41, SEQ. ID. NO. 42, SEQ. ID. NO. 43, SEQ. ID. NO. 44, SEQ. ID. NO. 45, SEQ. ID. NO. 46, SEQ. ID. NO. 47, SEQ. ID. NO. 48, or variants having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, or a combination thereof.

[0125] Described herein are nucleic acids including SEQ. ID. NO. 1 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, SEQ. ID. NO. 2 or variant having at least 90% (e.g. 90%, 91%’, 92%, 93%, 94%’, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, SEQ. ID. NO. 3 or variant having at least 90% (e.g.

[0126] 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, or a combination thereof. In some embodiments, the nucleic acid can include SEQ. ID. NO. 1 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, SEQ. ID. NO. 2 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, and SEQ. ID. NO. or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity 3.

[0127] Described herein are proteins including SEQ. ID. NO. 25 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, SEQ. ID. NO. 26 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, SEQ. ID. NO. 27 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, or a combination thereof.

[0128] Described herein are also fusion proteins including an E6 HPV portion including SEQ. ID. NO. 25 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%’, 99%, 99.8%>, or 99.9%) identity, an E7 HPV portion including SEQ. ID. NO. 26 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity, and a spike domain portion can include SEQ. ID. NO. 27 or variant having at least 90% (e.g. 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.8%, or 99.9%) identity.

[0129] Described herein are also cells including the nucleic acid described herein, the protein described herein, or the composition described herein. In some embodiments, the cell can include a dendritic cell, B cell, or a macrophage.

[0130] Delivery methodsAttorney Docket No. 11538-009WO1

[0131] Suitable nucleic acid delivery vehicles are well known in the art and can include, but are not limited to lipid-based (e.g., a liposome formulation, lipoplexes, or lipid nanoparticles (LNP)), viral-based, or physical methods such as injection, microinjection, electroporation, ultrasound, gene gun, hydrodynamic applications, or any combination thereof.

[0132] In some embodiments, the compositions described herein can include one or more nucleic acids described herein and a suitable delivery vehicle. Suitable nucleic acid delivery vehicles are known in the art and can include, but are not limited to lipid-based (e.g., a liposome formulation, lipoplexes, or lipid nanoparticles (LNP)), viral-based, or physical methods such as injection, microinjection, electroporation, ultrasound, gene gun, hydrodynamic applications, or any combination thereof. In some embodiments, the composition can include a nanoparticle, a lipid nanoparticle dispersion, a liposomal formulation, a lipid emulsion, vaccine, vector, or any combination thereof.

[0133] Nanoparticles

[0134] In some embodiments, the nanoparticle can be a lipid nanoparticle. In some embodiments, the nanoparticles can be a lipid-polycation complex, referred to as a cationic lipid nanoparticle. As a non-limiting example, the polycation may include a cationic peptide or a polypeptide such as, but not limited to, polylysine, polyornithine and / or polyarginine. In some embodiments, the lipid nanoparticle can include a non-cationic lipid such as, but not limited to, cholesterol or dioleoyl phosphatidylethanolamine (DOPE).

[0135] A lipid nanoparticle formulation may be influenced by, but not limited to, the selection of the cationic lipid component, the degree of cationic lipid saturation, the nature of the PEGylation, ratio of all components and biophysical parameters such as size. In one example by Semple et al. (Nature Biotech. 2010 28:172-176), the lipid nanoparticle can further include 57% cationic lipid, 7% dipalmitoylphosphatidylcholine, 34% cholesterol, and 1.5% PEG-c-DMA. As another example, changing the composition of the cationic lipid can more effectively deliver siRNA to various antigen presenting cells (Basha et al. Mol Ther. 2011 19:2186-2200).

[0136] In some embodiments, lipid nanoparticle formulations may comprise 35 to 45% cationic lipid, 40% to 50% cationic lipid, 50% to 60%’ cationic lipid and / or 55% to 65%’ cationic lipid. In some embodiments, the ratio of lipid to nucleic acid (e.g., mRNA) in lipid nanoparticles may be 5:1 to 20:1, 10:1 to 25:1, 15:1 to 30:1 and / or at least 30:1.

[0137] Lipid nanoparticle formulations typically comprise a lipid, in particular, an ionizable cationic lipid, and further comprise a neutral lipid, a sterol and a molecule capable of reducing particle aggregation, for example a PEG or PEG-modified lipid.Attorney Docket No. 11538-009W01

[0138] In some embodiments, a lipid nanoparticle formulation comprises at least one ionizable lipid, cationic lipid, or any combination thereof; a neutral lipid selected from DSPC, DPPC, POPC, DOPE and SM; (iii) a sterol, e.g., cholesterol; and (i v) a PEG-lipid, e.g., PEG-DMG or PEG-cDMA, in a molar ratio of 20-60% cationic lipid:5-25 % neutral lipid:25-55% sterol; 0.5-15%' PEG-lipid.

[0139] In some embodiments, a lipid nanoparticle formulation includes 25% to 75% on a molar basis of a cationic lipid selected from 2,2-dilinoleyl-4-dimethylaminoethyl-[l,3]-dioxolane (DLin-KC2-DMA), dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and di((Z)- non-2-en-l-yl) 9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), e.g., 35 to 65%, 45 to 65%, 60%, 57.5%, 50% or 40% on a molar basis.

[0140] In some embodiments, lipid nanoparticle formulations include 25-75% of a cationic lipid, 0.5-15% of the neutral lipid, 5-50% of the sterol, and 0.5-20% of the PEG or PEG-modified lipid on a molar basis.

[0141] In some embodiments, lipid nanoparticle formulations include 35-65% of a cationic lipid, 3-12% of the neutral lipid, 15-45% of the sterol, and 0.5-10% of the PEG or PEG-modified lipid on a molar basis.

[0142] In some embodiments, lipid nanoparticle formulations include 45-65% of a cationic lipid, 5-10% of the neutral lipid, 25-40% of the sterol, and 0.5-10% of the PEG or PEG-modified lipid on a molar basis.

[0143] In some embodiments, lipid nanoparticle formulations include 60% of a cationic lipid, 7.5% of the neutral lipid, 31% of the sterol, and 1.5% of the PEG or PEG-modified lipid on a molar basis.

[0144] In some embodiments, lipid nanoparticle formulations include 50% of a cationic lipid, 10% of the neutral lipid, 38.5% of the sterol, and 1.5% of the PEG or PEG-modified lipid on a molar basis.

[0145] In some embodiments, lipid nanoparticle formulations include 50% of a cationic lipid, 10% of the neutral lipid, 35% of the sterol, 4.5% or 5% of the PEG or PEG-modified lipid, and 0.5%’ of the targeting lipid on a molar basis.

[0146] In some embodiments, lipid nanoparticle formulations include 40% of a cationic lipid, 15% of the neutral lipid, 40% of the sterol, and 5% of the PEG or PEG-modified lipid on a molar basis.Attorney Docket No. 11538-009W01

[0147] In some embodiments, lipid nanoparticle formulations include 57.2% of a cationic lipid, 7.1% of the neutral lipid, 34.3% of the sterol, and 1.4% of the PEG or PEG-modified lipid on a molar basis.

[0148] In some embodiments, lipid nanoparticle formulations include 57.5% of a cationic lipid selected from the PEG lipid is PEG-cDMA (PEG-cDMA is further discussed in Reyes et al. (J. Controlled Release, 107, 276-287 (2005), the contents of which are herein incorporated by reference in their entirety), 7.5% of the neutral lipid, 31.5% of the sterol, and 3.5% of the PEG or PEG-modified lipid on a molar basis.

[0149] In some embodiments, lipid nanoparticle formulations including a lipid mixture in molar ratios of 20-70% cationic lipid:5-45% neutral lipid:20-55% cholesterol: 0.5-15% PEG-modified lipid. In some embodiments, lipid nanoparticle formulations including a lipid mixture in a molar ratio of 20-60% cationic lipid: 5-25% neutral lipid: 25-55% cholesterol: 0.5-15% PEG-modified lipid.

[0150] In some embodiments, the molar lipid ratio is 50 / 10 / 38.5 / 1.5 (mol % cationic lipid / neutral lipid, e.g., DSPC / Chol / PEG-modified lipid, e.g., PEG-DMG, PEG-DSG or PEG-DPG), 57.2 / 7.1 / 34.3 / 1.4 (mol % cationic lipid / neutral lipid, e.g., DPPC / Chol / PEG-modified lipid, e.g., PEG-cDMA), 40 / 15 / 40 / 5 (mol % cationic lipid / neutral lipid, e.g., DSPC / Chol / PEG- modified lipid, e.g., PEG-DMG), 50 / 10 / 35 / 4.5 / 0.5 (mol % cationic lipid / neutral lipid, e.g., DSPC / Chol / PEG-modified lipid, e.g., PEG-DSG), 50 / 10 / 35 / 5 (cationic lipid / neutral lipid, e.g., DSPC / Chol / PEG-modified lipid, e.g., PEG-DMG), 40 / 10 / 40 / 10 (mol % cationic lipid / neutral lipid, e.g., DSPC / Chol / PEG-modified lipid, e.g., PEG-DMG or PEG-cDMA), 35 / 15 / 40 / 10 (mol % cationic lipid / neutral lipid, e.g., DSPC / Chol / PEG-modified lipid, e.g., PEG-DMG or PEG- cDMA) or 52 / 13 / 30 / 5 (mol % cationic lipid / neutral lipid, e.g., DSPC / Chol / PEG-modified lipid, e.g., PEG-DMG or PEG-cDMA).

[0151] Non-limiting examples of lipid nanoparticle compositions and methods of making them are described, for example, in Semple et al. (2010) Nat. Biotechnol. 28:172-176; Jayarama et al. (2012), Angew. Chem. Int. Ed., 51: 8529-8533; and Maier et al. (2013) Molecular Therapy 21, 1570-1578 (the contents of each of which are incorporated herein by reference in their entirety).

[0152] In some embodiments, lipid nanoparticle formulations may comprise a cationic lipid, a PEG lipid and a structural lipid and optionally comprise a non-cationic lipid. As a non-limiting example, a lipid nanoparticle may comprise 40-60% of cationic lipid, 5-15% of a non-cationic lipid, 1-2% of a PEG lipid and 30-50% of a structural lipid. As another non-limiting example, the lipid nanoparticle may comprise 50% cationic lipid, 10% non-cationic lipid, 1.5% PEG lipidAttorney Docket No. 11538-009W01

[0153] and 38.5% structural lipid. As yet another non-limiting example, a lipid nanoparticle may comprise 55% cationic lipid, 10% non-cationic lipid, 2.5% PEG lipid and 32.5% structural lipid.

[0154] In some embodiments, the lipid nanoparticle formulations described herein may be 4 component lipid nanoparticles. The lipid nanoparticle may comprise a cationic lipid, a noncationic lipid, a PEG lipid and a structural lipid. As a non-limiting example, the lipid nanoparticle may comprise 40-60% of cationic lipid, 5-15% of a non-cationic lipid, 1-2% of a PEG lipid and 30-50% of a structural lipid. As another non-limiting example, the lipid nanoparticle may comprise 50% cationic lipid, 10% non-cationic lipid, 1.5% PEG lipid and 38.5% structural lipid. As yet another non-limiting example, the lipid nanoparticle may comprise 55% cationic lipid, 10% non-cationic lipid, 2.5% PEG lipid and 32.5% structural lipid.

[0155] In some embodiments, the lipid nanoparticle formulations described herein may comprise a cationic lipid, a non-cationic lipid, a PEG lipid and a structural lipid. As a non-limiting example, the lipid nanoparticle comprises 50% of the cationic lipid DLin-KC2-DMA, 10% of the non-cationic lipid DSPC, 1.5% of the PEG lipid PEG-DOMG and 38.5% of the structural lipid cholesterol. As a non-limiting example, the lipid nanoparticle comprises 50% of the cationic lipid DLin-MC3-DMA, 10% of the non-cationic lipid DSPC, 1.5% of the PEG lipid PEG-DOMG and 38.5% of the structural lipid cholesterol. As a non-limiting example, the lipid nanoparticle comprises 50% of the cationic lipid DLin-MC3-DMA, 10%’ of the non-cationic lipid DSPC, 1.5% of the PEG lipid PEG-DMG and 38.5% of the structural lipid cholesterol. As yet another non-limiting example, the lipid nanoparticle comprises 55% of the cationic lipid L319, 10% of the non-cationic lipid DSPC, 2.5% of the PEG lipid PEG-DMG and 32.5% of the structural lipid cholesterol.

[0156] In some embodiments, the nanoparticles may be such as those described in U. S. Patent No. 10,933,127, the contents of which is herein incorporated by reference in its entirety. In some embodiments, the nanoparticles may be such as those described in U. S. Patent No. 10,933,127, for example, nanoparticles including a compound according to Formula (I), (la), (II), (Ila), (lib), (lie), (lid), or (lie) described from column 101 to column 187.

[0157] In some embodiments, a nanoparticle (e.g., a lipid nanoparticle) has a mean diameter of 10-500 nm, 20-400 nm, 30-300 nm, 40-200 nm. In some embodiments, a nanoparticle (e.g., a lipid nanoparticle) has a mean diameter of 50-150 nm, 50-200 nm, 80-100 nm, or 80-200 nm.

[0158] The lipid nanoparticles (LNP) described herein may be made in a sterile environment. In some embodiments, the LNP formulation may be formulated in a nanoparticle such as a nucleic acid-lipid particle. As a non-limiting example, the lipid particle may comprise one orAttorney Docket No. 11538-009W01

[0159] more active agents or therapeutic agents; one or more cationic lipids comprising from 50 mol % to 85 mol % of the total lipid present in the particle; one or more non-cationic lipids comprising from 13 mol % to 40.5 mol % of the total lipid present in the particle; and one or more conjugated lipids that inhibit aggregation of particles comprising from 0.5 mol % to 2 mol % of the total lipid present in the particle.

[0160] The nanoparticle formulations may comprise a phosphate conjugate. The phosphate conjugate may increase in vivo circulation times and / or increase the targeted delivery of the nanoparticle. As a non-limiting example, the phosphate conjugates may include a compound of any one of the formulas described in International Application No. WO2013033438, the contents of which are herein incorporated by reference in its entirety.

[0161] The nanoparticle formulation may comprise a polymer conjugate. The polymer conjugate may be a water soluble conjugate. The polymer conjugate may have a structure as described in U. S. Patent Application No. 20130059360, the contents of which are herein incorporated by reference in its entirety. In some embodiments, polymer conjugates with the polynucleotides of the present disclosure may be made using the methods and / or segmented polymeric reagents described in U. S. Patent Application No. 20130072709, the contents of which are herein incorporated by reference in its entirety. In some embodiments, the polymer conjugate may have pendant side groups comprising ring moieties such as, but not limited to, the polymer conjugates described in U. S. Patent Publication No. US20130196948, the contents which are herein incorporated by reference in its entirety.

[0162] The nanoparticle formulations may comprise a conjugate to enhance the delivery of nanoparticles of the present disclosure in a subject.

[0163] In some embodiments, compositions comprising a nucleic acid described herein and a conjugate may have a degradable linkage. Non-limiting examples of conjugates include an aromatic moiety comprising an ionizable hydrogen atom, a spacer moiety, and a water-soluble polymer. As a non-limiting example, pharmaceutical compositions comprising a conjugate with a degradable linkage and methods for delivering such pharmaceutical compositions are described in U. S. Patent Publication No. US20130184443, the contents of which are herein incorporated by reference in their entirety.

[0164] Neutral Lipids

[0165] In some embodiments, a lipid nanoparticle formulation includes 0.5% to 15% on a molar basis of the neutral lipid, e.g., 3 to 12%, 5 to 10% or 15%, 10%, or 7.5% on a molar basis.

[0166] Examples of neutral lipids include, without limitation, DSPC, POPC, DPPC, DOPE and SM. InAttorney Docket No. 11538-009W01

[0167] some embodiments, the formulation includes 5% to 50% on a molar basis of the sterol (e.g., 15 to 45%, 20 to 40%, 40%, 38.5%, 35%, or 31% on a molar basis. A non-limiting example of a sterol is cholesterol. In some embodiments, a lipid nanoparticle formulation includes 0.5% to 20% on a molar basis of the PEG or PEG-modified lipid (e.g., 0.5 to 10%, 0.5 to 5%, 1.5%, 0.5%, 1.5%’, 3.5%>, or 5% on a molar basis. In some embodiments, a PEG or PEG modified lipid comprises a PEG molecule of an average molecular weight of 2,000 Da. In some embodiments, a PEG or PEG modified lipid comprises a PEG molecule of an average molecular weight of less than 2,000, for example around 1,500 Da, around 1,000 Da, or around 500 Da. Non-limiting examples of PEG-modified lipids include PEG-distearoyl glycerol (PEG-DMG) (also referred herein as PEG-C14 or C14-PEG), PEG-cDMA (further discussed in Reyes et al. J. Controlled Release, 107, 276-287 (2005 ) the contents of which are herein incorporated by reference in their entirety).

[0168] Zwitterionic Lipids

[0169] In some embodiments, the composition may be encapsulated in, linked to and / or associated with zwitterionic lipids. Non-limiting examples of zwitterionic lipids and methods of using zwitterionic lipids are described in U. S. Patent Publication No. US20130216607, the contents of which are herein incorporated by reference in their entirety. In some aspects, the zwitterionic lipids may be used in the liposomes and lipid nanoparticles described herein.

[0170] Cationic Lipids

[0171] Suitable cationic lipids may include, but are not limited to, 2-amino-3-[(9Z,12Z)-octadeca-9, 12-dien-l -yloxy]-2-{ [(9Z,2Z)-octadeca-9, 12-dien-l -yloxy]methyl}propan-l-ol (Compound 1 in US20130150625); 2-amino-3-[(9Z)-octadec-9-en-l-yloxy]-2-{[(9Z)-octadec-9- en-l-yloxyjmethyl}propan-l-ol (Compound 2 in US20130150625); 2-amino-3-[(9Z,12Z)-octadeca-9,12-dien-l-yloxy]-2-[(octyloxy)methyl]propan-l-ol (Compound 3 in US20130150625); and 2-(dimethylamino)-3-[(9Z,12Z)-octadeca-9,12-dien-l-yloxy]-2-{[(9Z,r2Z)-octadeca-9,12-dien-l-yloxyJmethyl}propan-l-ol (Compound 4 in US20130150625); or any pharmaceutically acceptable salt or stereoisomer thereof. As a non- limiting example, the cationic lipid may be selected from (20Z,23Z) — N, N-dimethylnonacosa-20,23-dien-10-amine, (r7Z,20Z)--N, N-diniemylhexacosa-17,20-dien-9-amine, (lZ,19Z)--N5N-dimethylpentacosa- 16, 19-dien-8-amine, (13Z,16Z) — N, N-dimethyldocosa-13,16-dien-5-amine, (12Z,15Z) — N, N- dimethylhenicosa-12,15-dien-4-amine, (14Z,17Z) — N, N-dimethyltricosa-14,17-dien-6-amine, ( 15Z, 18Z)--N, N-dimethyItetracosa- 15,18-dien-7-amine, (18Z,2 lZ)--N, N-dimethylheptacosa-18,21-dien-lO-amine, (15Z,18Z) — N, N-dimethyltetracosa-15,l 8-dien-5-amine, (14Z,17Z) —Attorney Docket No. 11538-009WO1

[0172] N, N-dimethyltricosa-14,17-dien-4-amine, (19Z,22Z) — N, N-dimeihyloctacosa-19,22-dien-9-amine, (18Z,21 Z)--N, N-dimethylheptacosa-18,21-dien-8 amine, (17Z,20Z)--N, N- dimethylhexacosa-17,20-dien-7-amine, (16Z,19Z) — N, N-dimethylpentacosa-16,19-dien-6-amine, (22Z,25Z) — N, N-dimethylhentriaconta-22,25-dien-10-amine, (21 Z,24Z) — N. N-dimethyltriaconta-21,24-dien-9-aniine, (18Z) — N. N-dinietylheptacos- 18-en- 10-aniine, ( 17Z) — N, N-di methylhexacos- 17-en-9-amine, (19Z,22Z) — N, N-di methyloctacosa- 19,22-dien-7 -amine, N, N-dimethylheptacosan-10-amine, (20Z,23Z) — N-ethyl-N-methylnonacosa-20,23-dien-10-amine, l-[( 1 lZ,14Z)-l-nonylicosa-l l,14-dien-l-yl]pyrrolidine, (20Z) — N, N-dimethylheptacos-20-en- 10-amine, ( 15Z)--N, N -dimethyl eptacos- 15 -en- 10-aniine, ( 14Z) — N, N-dimethylnonacos-14-en- 10-amine, ( 17Z) — N, N -dimethylnonacos- 17 -en- 10-amine, (24Z) — N, Nidi methyl tri triacon t-24-en- 10-amine, (20Z) — N, N-dimethylnonacos-20-en - 10-ami ne, (22Z) — N, N-dimethylhentriacont-22-en-10-amine, (16Z)---N, N-dimethylpentacos-16-en-8-amine, (12Z,15Z) — N, N-dimethyl-2-nonylhenicosa-12,15-dien-l -amine, (13Z,16Z) — N, N-dimethyl-3-nonyldocosa-13,16-dien-l amine, N, N-dimethyl-l-[(lS,2R)-2-octyicyclopropyl]eptadecan-8- amine, l-[(lS,2R)-2-hexylcyclopropyl]-N, N-dimethylnonadecan-10-amine, N, N-diniethyl-l-[(1 S,2R)-2-octyl cyclopropyl] nonadecan- 10-amine, N, N-dimethyl-21 - [( 1 S,2R)-2- octylcyclopropyl]henicosan-10-aniine, N, N-dimethyl-l-[(lS,2S)-2-{[(lR,2R)-2-pentylcycIopropyl]nietliyl}cyclopropyl]nonadecan-10-aniine, N, N-dinietliyl-l-[(lS,2R)-2- octylcyclopropyl]hexadecan-8-aniine, N, N-dimethyl-[(lR,2S)-2-undecyIcyclopropyl]tetradecan- 5-amine, N, N-dimethyl-3-{7-[(lS,2R)-2-octylcyclopropyl]heptyl}dodecan-l-amine, 1-[(1R,2S)-2-heptylcyclopropyl]-N, N-dimethyloctadecan-9-amine, l-[(lS,2R)-2-decylcyclopropyl]-N, N-dimethylpentadecan-6-amine, N, N-dimethyl-l-RlS,2R)-2-octylcyclopropyllpentadecan-8-amine, R — N, N-dimethyl-l-[(9Z,12Z)-octadeca-9,12-dien-l-yloxy]-3-(octyloxy)propan-2- amine, S — N, N-dimethyl-l-[(9Z,12Z)-octadeca-9,12-dien-l-yloxy]-3-(octyloxy)propan-2- amine, 1-{2-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-1-[(octyloxy)methyl]ethyl}pyrrolidine, (2S) — N, N -dimethyl- 1 - [ (9Z, 12Z)-octadeca-9, 12-di en- 1 -yloxy] -3- [(5Z)-oct-5 -en- 1 -yloxy]propan-2-amine, 1-{2-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-1-[(octyloxy)methyl]ethyl}azetidine, (2S)- 1 -(hexyloxy)-N, N-dimethyl-3 -R9Z, 12Z)-octadeca-9, 12- dien-l-yloxylpropan-2-amine, (2S)-l-(heptyloxy)-N, N-dimethyl-3-R9Z,12Z)-octadeca-9,12- dien-l-yloxylpropan-2-amine, N, N-dimethyl-l-(nonyloxy)-3-R9Z,12Z)-octadeca-9,r2-dien-l-yloxylpropan-2-amine, N, N-dimethyl-l-[(9Z)-octadec-9-en-l-yloxy]-3-(octyloxy)propan-2-amine; (2S)-N, N -dimethyl- 1 - [(6Z,9Z, 12Z)-octadeca-6,9, 12-trien- 1 -yloxy] -3-(octyloxy)propan- 2-amine, (2 S)- 1 - [ ( 11 Z, 14Z)-icosa- 11,14-dien- 1 -yloxy] -N, N-dimethyl-3 -(pentyl oxy)propan-2-Attorney Docket No. 11538-009W01

[0173] amine, (2S)-l-(hexyloxy)-3-[(llZ,14Z)-icosa-H,14-dien-l-yloxy]-N, N-dimetliylpropan-2- amine, l-[( 1 lZ,14Z)-icosa-l l,14-dien-l-yloxy]-N, N-dimethyl-3-(octyloxy)propan-2-amine, 1- [( 13Z, 16Z)-docosa- 13,16-dien- 1 -yloxy] -N, N-dimethyl-3-(octyloxy)propan-2-amine, (2S)- 1 - [( 13Z, 16Z)-docosa- 13,16-dien- 1 -yloxy] -3-(hexyloxy)-N, N-dimethylpropan-2-amine, (2S)- 1 -[( 13Z)-docos- 13-en- 1 -yloxy] -3-(hexyloxy)-N, N -dimethylpropan-2-amine, 1 - [( 13Z)-docos- 13- en-l-yloxy]-N, N-dimethyl-3-(octyloxy)propan-2-amine, l-[(9Z)-hexadec-9-en-l-yloxy]-N, N- dimethyl-3-(octyloxy)propan-2 -amine, (2R)-N, N-dimethyl-H(l-metoyloctyl)oxy]-3-[(9Z,12Z)-octadeca-9, 1 -dien- 1 -yloxy]propan-2-amine, ( 2 R )- 1 - [(3,7-dimethyloctyl)oxy] -N, N-dimetliyl-3- R9Z,12Z)-octadeca-9,12-dien-l-yloxylpropan-2-amine, N, N-dimethyI-l-(octyIoxy)-3-({8-RlS,25)-2-{[(rR,2R)-2-pentylcyclopropyl]methyl}cyclopropyl]octyl}oxy)propan-2-amine, N, N-dimethyl-1-1 [8-(2-oc1ylcyclopropyl)octyl]oxy}-3-(octyloxy)propan-2-amine and

[0174] (1 lE,20Z,23Z)--N, N-dimethylnonacosa-l l,20,2-trien-10-amine or a pharmaceutically acceptable salt or stereoisomer thereof. In some embodiments, the lipid may be a cationic lipid such as, but not limited to, DLin-DMA, DLin-D-DMA, DLin-MC3-DMA, DLin-KC2-DMA, DODMA and amino alcohol lipids. The amino alcohol cationic lipid may be the lipids described in and / or made by the methods described in U. S. Patent Publication No. US20130150625, herein incorporated by reference in its entirety. In some embodiments, the nanoparticles described herein may include an amine cationic lipid such as those described in International Patent Application No. WO2013059496, the contents of which are herein incorporated by reference in their entirety. In some embodiments, the cationic lipids may have an amino-amine or an aminoamide moiety.

[0175] In some embodiments, the cationic lipid may be a low molecular weight cationic lipid such as those described in U. S. Patent Application No. 20130090372, the contents of which are herein incorporated by reference in their entirety.

[0176] Ionizable Lipids

[0177] Exemplary ionizable lipids are described in the US patent publications Nos. U. S.

[0178] 2016 / 0311759, U. S. 2015 / 0376115, U. S. 2016 / 0111284, U. S. 2017 / 0210697, U. S.

[0179] 2015 / 0140070, U. S. 2013 / 0178541, U. S. 2013 / 0303587, U. S. 2015 / 0141678, U. S.

[0180] 2015 / 0239926, U. S. 2016 / 0376224, U. S. 2017 / 0119904, U. S. 2012 / 0149894, U. S.

[0181] 2015 / 0057373, U. S. 2013 / 0090372, U. S. 2013 / 0274523, U. S. 2013 / 0274504, U. S.

[0182] 2013 / 0274504, U. S. 2009 / 0023673, U. S. 2012 / 0128760, U. S. 2010 / 0324124, U. S.

[0183] 2014 / 0200257, U. S. 2015 / 0203446, U. S. 2018 / 0005363, U. S. 2014 / 0308304, U. S.

[0184] 2013 / 0338210, U. S. 2012 / 0101148, U. S. 2012 / 0027796, U. S. 2012 / 0058144, U. S.Attorney Docket No. 11538-009WO1

[0185] 2013 / 0323269, U. S. 2011 / 0117125, U. S. 2011 / 0256175, U. S. 2012 / 0202871, U. S.

[0186] 2011 / 0076335, U. S. 2006 / 0083780, U. S. 2013 / 0123338, U. S. 2015 / 0064242, U. S.

[0187] 2006 / 0051405, U. S. 2013 / 0065939, U. S. 2006 / 0008910, U. S. 2003 / 0022649, U. S.

[0188] 2010 / 0130588, U. S. 2013 / 0116307, U. S. 2010 / 0062967, U. S. 2013 / 0202684, U. S.

[0189] 2014 / 0141070, U. S. 2014 / 0255472, U. S. 2014 / 0039032, U. S. 2018 / 0028664, U. S.

[0190] 2016 / 0317458, U. S. 2013 / 0195920, U. S. 2022 / 0062175, U. S. 2021 / 0121411, U. S.

[0191] 2022 / 0009878, U. S. 2022 / 0040325, U. S. 2012 / 61657480, U. S. 2016 / 0074514, U. S.

[0192] 2013 / 0330401, U. S. 2019 / 0185410, U. S. 2012 / 61617468, U. S. 2019 / 0032087, U. S.

[0193] 2015 / 62184188, U. S. 2019 / 0127318, U. S. 2021 / 0002813, U. S. 2020 / 0345641, U. S.

[0194] 2014 / 61944336, U. S. 2012 / 61657480, U. S. 2021 / 0059953, U. S. 2022 / 0162521, U. S.

[0195] 2022 / 0235377, U. S. 2018 / 0085474, U. S. 2018 / 0000953, U. S. 2020 / 0129445, U. S.

[0196] 2021 / 0145982, U. S. 2021 / 0378980, U. S. 2020 / 0254086, U. S. 2021 / 0346306, and U. S.

[0197] 2018 / 0000953, the contents of all of which are incorporated herein by reference in their entirety..

[0198] In some embodiments, the nanoparticle comprises an ionizable lipid in a molar ratio of from 0% to 80%. In some embodiments, the ionizable lipid can be present in a molar ratio of at least 0%, (e.g., at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, or at least 80%). In some embodiments, the ionizable lipid can be present in a molar ratio of 80% or less, (e.g., 80%’ or less, 70% or less, 60%’ or less, 50% or less, 40% or less, 30% or less, 20% or less, 10% or less, 5% or less, 1% or less, or 0.5% or less).

[0199] The ionizable lipid can be present in a molar ratio ranging from any of the minimum values described above to any of the maximum values described above. For example, in some embodiments, the ionizable lipid can be present in a molar ratio of from 0% to 80% (e.g., from greater than 0% to 80%, from greater than 0% to 70%, from greater than 0% to 60%, from greater than 0% to 50%, from greater than 0% to 40%, from greater than 0% to 30%, from greater than 0% to 20%, from greater than 0%’ to 10%, from greater than 0% to 5%, from greater than 0% to 1%, from greater than 0% to 0.5%, from 1% to 30%, from 1% to 20%, from 1 % to 10%, from 1% to 5%, from 5% to 30%, from 5% to 20%, from 5% to 10%, from 10% to 30%, from 10%’ to 20%, from 20% to 30%, from 20% to 40%’, or from 30% to 40%).

[0200] Helper Lipids

[0201] In some embodiments, the nanoparticle comprises a helper lipid. In some embodiments, the helper lipid can be a non-cationic lipid. In some embodiments, the non-cationic lipid can include, but is not limited to, l,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1- palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (POPE), 1,2-distearoyl-sn-glycero-3-Attorney Docket No. 11538-009W01

[0202] phosphocholine (DSPC), 1-stearoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (SOPE), DPPC (1,2-dipalmitoyl-sn-glycero-3- phosphocholine), 1,2-dioleyl-sn-glycero-3-phosphotidylcholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (DPPE), 1,2-dimyristoyl-sn-glycero-3-phosphoethanolamine (DMPE), 1,2-dioleoyl-sn-glycero-3- phospho-(T-rac-glycerol) (DOPG), or combinations thereof. In one embodiment, the non-cationic lipid is 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE). In one embodiment, the non-cationic lipid is 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (POPE), In one embodiment, the non-cationic lipid is l,2-disteai‘oyl-5 / ?-glycero-3-phosphocholine (DSPC). In one embodiment, the non-cationic lipid is 1-stearoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (SOPE). While several non-cationic lipids are described here, additional non-cationic lipids can be used in combination with the compounds disclosed herein.

[0203] In some embodiments, the nanoparticle comprises a helper lipid in a molar ratio of from 0% to 20%. In some embodiments, the nanoparticle comprises a polyethylene glycol-lipid in a molar ratio of about 0%, 0.25%, 0.5%, 0.75%, 1%, 1.5%, 2%, 3%, 4%, 5%, 10%, 15%, or 20%.

[0204] Polyethylene Glycol-Lipid

[0205] In some embodiments, the nanoparticle includes a polyethylene glycol-lipid (PEG- lipid). PEG-lipid is incorporated to form a hydrophilic outer layer and stabilize the particles.

[0206] Nonlimiting examples of polyethylene glycol-lipids include PEG-modified lipids such as PEG- modified phosphatidylethanolamines, PEG-modified phosphatidic acids, PEG-modified ceramides, PEG- modified dialkylamines, PEG-modified diacylglycerols, and PEG-modified dialkylglycerols. Representative polyethylene glycol-lipids include DMG-PEG, DLPE-PEGs, DMPE -PEGs, DPPC -PEGs, and DSPE-PEGs. In one embodiment, the polyethylene glycol-lipid is 1,2-dimyristoyl-sn-glycerol, methoxypolyethylene glycol (DMG-PEG). In one embodiment, the polyethylene glycol-lipid is 1,2-dimyristoyl-sn-glycerol, methoxypolyethylene glycol-2000 (DMG-PEG2000). DMG-PEGXXXX means 1,2-dimyristoyl-sn-glycerol, methoxypolyethylene glycol-XXXX, wherein XXXX signifies the molecular weight of the polyethylene glycol moiety, e.g. DMG-PEG2000 or DMG-PEG5000.

[0207] In some embodiments, the nanoparticle comprises a polyethylene glycol-lipid in a molar ratio of from 0% to 5%. In some embodiments, the nanoparticle comprises a polyethylene glycol-lipid in a molar ratio of about 0%, 0.25%, 0.5%, 0.75%, 1%, 1.5%, 2%, 3%, 4%, or 5%. In one embodiment, the nanoparticle comprises a polyethylene glycol-lipid in a molar ratio of 0.75%.Attorney Docket No. 11538-009W01

[0208] In some embodiments, the ratio of PEG in the lipid nanoparticle formulations may be increased or decreased and / or the carbon chain length of the PEG lipid may be modified from C14 to C18 to alter the pharmacokinetics and / or biodistribution of the lipid nanoparticle formulations. As a non -limiting example, lipid nanoparticle formulations may contain 0.5% to 3.0%, 1.0%’ to 3.5%, 1.5%’ to 4.0%, 2.0%’ to 4.5%, 2.5%’ to 5.0% and / or 3.0% to 5.0% of the lipid molar ratio of PEG-c-DOMG (R-3-[((o-methoxy-poly(ethyleneglycol)2000)carbamoyl)]-l,2-dimyristyloxypropyl-3-amine) (also referred to herein as PEG-DOMG) as compared to the cationic lipid, DSPC and cholesterol. In some embodiments, the PEG-c-DOMG may be replaced with a PEG lipid such as, but not limited to, PEG-DSG (1,2-Distearoyl-sn-glycerol, methoxypolyethylene glycol), PEG-DMG (1,2-Dimyristoyl-sn-glycerol) and / or PEG-DPG (1,2- Dipalmitoyl-sn-glycerol, methoxypolyethylene glycol).

[0209] In some embodiments, the LNP formulations may contain PEG-c-DOMG at 3% lipid molar ratio. In some embodiments, the LNP formulations may contain PEG-c-DOMG at 1.5% lipid molar ratio.

[0210] In some embodiments, the pharmaceutical compositions may include at least one of the PEGylated lipids described in International Publication No. WO2012099755, the contents of which are herein incorporated by reference in their entirety.

[0211] In some embodiments, the LNP formulation may contain PEG-DMG 2000 (1,2- dimyristoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000). In some embodiments, the LNP formulation may contain PEG-DMG 2000, a cationic lipid known in the art and at least one other component. In some embodiments, the LNP formulation may contain PEG-DMG 2000, a cationic lipid known in the art, DSPC and cholesterol. As a non-limiting example, the LNP formulation may contain PEG-DMG 2000, DLin-DMA, DSPC and cholesterol. As another non-limiting example the LNP formulation may contain PEG-DMG 2000, DLin-DMA, DSPC and cholesterol in a molar ratio of 2:40: 10:48 (see e.g., Geall et al., Nonviral delivery of self-amplifying RNA (e.g., mRNA) vaccines, PNAS 2012; PMID:

[0212] 22908294, the contents of each of which are herein incorporated by reference in their entirety).

[0213] Sterols

[0214] In some embodiments, the nanoparticle includes a sterol. Sterols are well known to those skilled in the art and generally refers to those compounds having a perhydrocyclopentanophenanthrene ring system and having one or more OH substituents.

[0215] Examples of sterols include, but are not limited to, cholesterol, campesterol, ergosterol, sitosterol, and the like.Attorney Docket No. 11538-009W01

[0216] In some embodiments, the sterol is selected from a cholesterol-based lipid. In some embodiments, the one or more cholesterol-based lipids are selected from cholesterol, PEGylated cholesterol, DC -Choi (N, N-dimethyl-N- ethylcarboxamidochol esterol), l,4-bis(3-N-oleylamino-propyl)piperazine, or combinations thereof.

[0217] The sterol can be used to tune the particle permeability and fluidity base on its function in cell membranes. In one embodiment, the sterol is cholesterol.

[0218] In some embodiments, the nanoparticle comprises a sterol in a molar ratio of from 20% to 80%. In some embodiments, the nanoparticle comprises a sterol in a molar ratio of 25%, 30%, 35%, 40%, 45%, or 50%. In one embodiment, the nanoparticle comprises a sterol in a molar ratio of 40%.

[0219] The nanoparticle formulations may be a carbohydrate nanoparticle comprising a carbohydrate carrier and a nucleic acid sequence (e.g., mRNA) described herein. As a non-limiting example, the carbohydrate earner may include, but is not limited to, an anhydride - modified phytoglycogen or glycogen-type material, phtoglycogen octenyl succinate, phytoglycogen beta-dextrin, anhydride-modified phytoglycogen beta-dextrin. (See e.g., International Publication No. W02012109121; the contents of which are herein incorporated by reference in their entirety).

[0220] Nanoparticle formulations of the present disclosure may be coated with a surfactant or polymer in order to improve the delivery of the particle. In some embodiments, the nanoparticle may be coated with a hydrophilic coating such as, but not limited to, PEG coatings and / or coatings that have a neutral surface charge. The hydrophilic coatings may help to deliver nanoparticles with larger payloads such as, but not limited to, RNA (e.g., mRNA) within the central nervous system. As a non-limiting example nanoparticles comprising a hydrophilic coating and methods of making such nanoparticles are described in U. S. Patent Publication No. US20130183244, the contents of which are herein incorporated by reference in their entirety.

[0221] In some embodiments, the lipid nanoparticles of the present disclosure may be hydrophilic polymer particles. Non-limiting examples of hydrophilic polymer particles and methods of making hydrophilic polymer particles are described in U. S. Patent Publication No. US20130210991, the contents of which are herein incorporated by reference in their entirety.

[0222] In some embodiments, the lipid nanoparticles of the present di sclosure may be hydrophobic polymer particles.

[0223] In some embodiments, an immune response may be elicited by delivering a lipid nanoparticle which may include a nanospecies, a polymer and an immunogen. (U. S. PublicationAttorney Docket No. 11538-009W01

[0224] No. 20120189700 and International Publication No. W02012099805; each of which is herein incorporated by reference in their entirety). The polymer may encapsulate the nanospecies or partially encapsulate the nanospecies. The immunogen may be a recombinant protein, a modified RNA and / or a polynucleotide described herein. In some embodiments, the lipid nanoparticle may be formulated for use in a vaccine such as, but not limited to, against a pathogen.

[0225] Lipid nanoparticles may be engineered to alter the surface properties of particles so the lipid nanoparticles may penetrate the mucosal barrier. Mucus is located on mucosal tissue such as, but not limited to, oral (e.g., the buccal and esophageal membranes and tonsil tissue), ophthalmic, gastrointestinal (e.g., stomach, small intestine, large intestine, colon, rectum), nasal, respiratory (e.g., nasal, pharyngeal, tracheal and bronchial membranes), genital (e.g., vaginal, cervical and urethral membranes). Nanoparticles larger than 10-200 nm which are preferred for higher drug encapsulation efficiency and the ability to provide the sustained delivery of a wide array of drugs have been thought to be too large to rapidly diffuse through mucosal barriers. Mucus is continuously secreted, shed, discarded or digested and recycled so most of the trapped particles may be removed from the mucosa tissue within seconds or within a few hours. Large polymeric nanoparticles (200 nm-500 nm in diameter) which have been coated densely with a low molecular weight polyethylene glycol (PEG) diffused through mucus only 4 to 6-fold lower than the same particles diffusing in water (Lai et al. PNAS 2007 104(5): 1482-487; Lai et al. Adv Drug Deliv Rev. 2009 61(2): 1 8-171; each of which is herein incorporated by reference in their entirety). The transport of nanoparticles may be determined using rates of permeation and / or fluorescent microscopy techniques including, but not limited to, fluorescence recovery after photobleaching (FRAP) and high resolution multiple particle tracking (MPT). As a non-limiting example, compositions which can penetrate a mucosal barrier may be made as described in U. S. Pat. No. 8,241,670 or International Patent Publication No. WO2013110028, the contents of each of which are herein incorporated by reference in its entirety.

[0226] The lipid nanoparticle engineered to penetrate mucus may comprise a polymeric material (i.e. a polymeric core) and / or a polymer-vitamin conjugate and / or a tri-block co-polymer. The polymeric material may include, but is not limited to, polyamines, polyethers, polyamides, polyesters, polycarbamates, polyureas, polycarbonates, poly(styrenes), polyimides, polysulfones, polyurethanes, polyacetylenes, polyethylenes, polyethyleneimines, polyisocyanates, polyacrylates, polymethacrylates, polyacrylonitriles, and polyarylates. The polymeric material may be biodegradable and / or biocompatible. Non-limiting examples of biocompatible polymers are described in International Patent Publication No. WO2013116804, the contents of which areAttorney Docket No. 11538-009WO1

[0227] herein incorporated by reference in their entirety. The polymeric material may additionally be irradiated. As a non-limiting example, the polymeric material may be gamma irradiated (see e.g., International App. No. WO201282165, herein incorporated by reference in its entirety). Nonlimiting examples of specific polymers include poly(caprolactone) (PCL), ethylene vinyl acetate polymer (EVA), poly(lactic acid) (PLA), poly(L-lactic acid) (PLLA), poly(glycolic acid) (PGA), poly(lactic acid-co-glycolic acid) (PLGA), poly(L -lactic acid-co-glycolic acid) (PLLGA), poly(D,L-lactide) (PDLA), poly(L -lactide) (PLLA), poly(D, L-lactide-co-caprolactone), poly(D, L-lactide-co-caprolactone-co-glycolide), poly(D, L-lactide-co-PEO-co-D, L -lactide), poly(D, L-lactide-co-PPO-co-D, L-lactide), polyalkyl cyanoacralate, polyurethane, poly-L-lysine (PLL), hydroxypropyl methacrylate (HPMA), polyethyleneglycol, poly-L-glutamic acid, poly(hydroxy acids), polyanhydrides, polyorthoesters, poly(ester amides), polyamides, poly(ester ethers), polycarbonates, polyalkylenes such as polyethylene and polypropylene, polyalkylene glycols such as polyethylene glycol) (PEG), polyalkylene oxides (PEG), polyalkylene terephthalates such as polyethylene terephthalate), polyvinyl alcohols (PVA), polyvinyl ethers, polyvinyl esters such as poly( vinyl acetate), polyvinyl halides such as poly(vinyl chloride) (PVC), polyvinylpyrrolidone, polysiloxanes, polystyrene (PS), polyurethanes, derivatized celluloses such as alkyl celluloses, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, nitro celluloses, hydroxypropylcellulose, carboxymethylcellulose, polymers of acrylic acids, such as poly(methyl(meth)acrylate) (PMMA), poly(ethyl(meth)acrylate), poly(butyl(meth)acrylate), poly(isobutyl(meth)acrylate), poly(hexyl(meth)acrylate), poly(isodecyl(meth)acrylate), poly(lauryl(meth)acrylate), poly(phenyl(meth)acrylate), poly(methyl acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate), poly(octadecyl acrylate) and copolymers and mixtures thereof, polydioxanone and its copolymers, polyhydroxyalkanoates, polypropylene fumarate, polyoxymethylene, poloxamers, poly(ortho)esters, poly(butyric acid), poly(valeric acid), poly(lactide-co-caprolactone), PEG- PLGA-PEG and trimethylene carbonate, polyvinylpyrrolidone. The lipid nanoparticle may be coated or associated with a co-polymer such as, but not limited to, a block co-polymer (such as a branched polyether-polyamide block copolymer described in International Publication No. WO2013012476, herein incorporated by reference in its entirety), and (polyethylene glycol))- (poly(propylene oxide))-(poly(ethylene glycol)) triblock copolymer (see e.g., U. S. Publication 20120121718 and U. S. Publication 20100003337 and U. S. Pat. No. 8,263,665, the contents of each of which is herein incorporated by reference in their entirety). The co-polymer may be a polymer that is generally regarded as safe (GRAS) and the formation of the lipid nanoparticleAttorney Docket No. 11538-009W01

[0228] may be in such a way that no new chemical entities are created. For example, the lipid nanoparticle may comprise poloxamers coating PLGA nanoparticles without forming new chemical entities which are still able to rapidly penetrate human mucus (Yang et al. Angew. Chem. Int. Ed. 2011 50:2597-2600; the contents of which are herein incorporated by reference in their entirety). A non-limiting scalable method to produce nanoparticles which can penetrate human mucus is described by Xu et al. (see, e.g. J Control Release 2013, 170(2):279-86; the contents of which are herein incorporated by reference in their entirety).

[0229] The vitamin of the polymer- vitamin conjugate may be vitamin E. The vitamin portion of the conjugate may be substituted with other suitable components such as, but not limited to, vitamin A, vitamin E, other vitamins, cholesterol, a hydrophobic moiety, or a hydrophobic component of other surfactants (e.g., sterol chains, fatty acids, hydrocarbon chains and alkylene oxide chains).

[0230] The lipid nanoparticle engineered to penetrate mucus may include surface altering agents such as, but not limited to, polynucleotides, anionic proteins (e.g., bovine serum albumin), surfactants (e.g., cationic surfactants such as for example dimethyldioctadecylammonium bromide), sugars or sugar derivatives (e.g., cyclodextrin), nucleic acids, polymers (e.g., heparin, polyethylene glycol and poloxamer), mucolytic agents (e.g., N-acetylcysteine, mug wort, bromelain, papain, clerodendrum, acetylcysteine, bromhexine, carbocisteine, eprazinone, mesna, ambroxol, sobrerol, domiodol, letosteine, stepronin, tiopronin, gelsolin, thymosin β4 dornase alfa, neltenexine, erdosteine) and various DNases including rhDNase. The surface altering agent may be embedded or enmeshed in the particle's surface or disposed (e.g., by coating, adsorption, covalent linkage, or other process) on the surface of the lipid nanoparticle, (see e.g., U. S.

[0231] Publication 20100215580 and U. S. Publication 20080166414 and US20130164343; the contents of each of which are herein incorporated by reference in their entirety).

[0232] In some embodiments, the mucus penetrating lipid nanoparticles may comprise at least one polynucleotide described herein. The polynucleotide may be encapsulated in the lipid nanoparticle and / or disposed on the surface of the particle. The polynucleotide may be covalently coupled to the lipid nanoparticle. Formulations of mucus penetrating lipid nanoparticles may comprise a plurality of nanoparticles.

[0233] In some embodiments, the compositions can be formulated as a solid lipid nanoparticle. A solid lipid nanoparticle (SLN) may be spherical with an average diameter between 10 to 1000 nm. SLN possess a solid lipid core matrix that can solubilize lipophilic molecules and may be stabilized with surfactants and / or emulsifiers. In some embodiments, the lipid nanoparticle mayAttorney Docket No. 11538-009W01

[0234] be a self-assembly lipid-polymer nanoparticle (see Zhang et al., ACS Nano, 2008, 2 (8), pp 1696-1702; the contents of which are herein incorporated by reference in their entirety). As a non-limiting example, the SLN may be the SLN described in International Patent Publication No. WO2013105101, the contents of which are herein incorporated by reference in their entirety. As another non-limiting example, the SLN may be made by the methods or processes described in International Patent Publication No. W02013105101, the contents of which are herein incorporated by reference in their entirety.

[0235] In some embodiments, the compositions of the present disclosure may be encapsulated in a nanoparticle. Nanoparticles may be formulated by methods described herein and known in the art such as, but not limited to, International Pub Nos. W02010005740, W02010030763, W02010005721, W02010005723, WO2012054923, U. S. Publication Nos. US20110262491, US20100104645, US20100087337, US20100068285, US20110274759, US20100068286, US20120288541, US20130123351 and US20130230567 and U. S. Pat. Nos. 8,206,747, 8,293,276, 8,318,208 and 8,318,211; the contents of each of which are herein incorporated by reference in their entirety. In some embodiments, polymer nanoparticles may be identified by the methods described in US Pub No. US20120140790, the contents of which are herein incorporated by reference in their entirety.

[0236] In some embodiments, the nanoparticle may be formulated for sustained release. As used herein, “sustained release” refers to a pharmaceutical composition or compound that conforms to a release rate over a specific period of time. The period of time may include, but is not limited to, hours, days, weeks, months and years. As a non-limiting example, the sustained release nanoparticle may comprise a polymer and nucleic acid sequence of the present disclosure (see International Pub No. 2010075072 and US Pub No. US20100216804, US20110217377 and US20120201859, the contents of each of which are incorporated herein by reference in their entirety). In another non-limiting example, the sustained release formulation may comprise agents which permit persistent bioavailability such as, but not limited to, crystals, macromolecular gels and / or particulate suspensions (see U. S. Patent Publication No US20130150295, the contents of each of which are incorporated herein by reference in their entirety).

[0237] In some embodiments, the nanoparticles of the present disclosure may comprise a polymeric matrix. As a non-limiting example, the nanoparticle may comprise two or more polymers such as, but not limited to, polyethylenes, polycarbonates, polyanhydrides, polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers,Attorney Docket No. 11538-009W01

[0238] polyesters, poly(orthoesters), polycyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polycyanoacrylates, polyureas, polystyrenes, polyamines, polylysine, polyethylene imine), poly(serine ester), poly(L-lactide- co-L-lysine), poly(4-hydroxy-L-proline ester) or combinations thereof.

[0239] In some embodiments, the nanoparticle comprises a diblock copolymer. In some embodiments, the diblock copolymer may include PEG in combination with a polymer such as, but not limited to, polyethylenes, polycarbonates, polyanhydrides, polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers, polyesters, poly(orthoesters), polycyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polycyanoacrylates, polyureas, polystyrenes, polyamines, polylysine, polyethylene imine), poly(serine ester), poly(L-lactide-co-L -lysine), poly(4-hydroxy-L -proline ester) or combinations thereof. In yet another embodiment, the diblock copolymer may be a high-X di block copolymer such as those described in International Patent Publication No. WO2013120052, the contents of which are incorporated herein by reference in their entirety.

[0240] As a non-limiting example, the nanoparticle comprises a PLGA-PEG block copolymer (see U. S. Publication No. US20120004293 and U. S. Pat. No. 8,236,330, each of which is herein incorporated by reference in their entirety). In another non-limiting example, the therapeutic nanoparticle is a stealth nanoparticle comprising a diblock copolymer of PEG and PLA or PEG and PLGA (see U. S. Pat. No. 8,246,968 and International Publication No. WO2012166923, the contents of each of which are herein incorporated by reference in their entirety). In yet another non-limiting example, the nanoparticle is a stealth nanoparticle or a target-specific stealth nanoparticle as described in U. S. Patent Publication No. US20130172406, the contents of which are herein incorporated by reference in their entirety.

[0241] In some embodiments, the nanoparticle may comprise a multiblock copolymer (see e.g., U. S. Pat. Nos. 8,263,665 and 8,287,910 and U. S. Patent Pub. No. US20130195987, the contents of each of which are herein incorporated by reference in their entirety).

[0242] In yet another non-limiting example, the lipid nanoparticle comprises the block copolymer PEG-PLGA-PEG (see e.g., the thermosensitive hydrogel (PEG-PLGA-PEG) was used as a TGF-beta1 gene delivery vehicle in Lee et al. Thermosensitive Hydrogel as a Tgf-β1 Gene Delivery Vehicle Enhances Diabetic Wound Healing. Pharmaceutical Research, 2003 20(12): 1995-2000; as a controlled gene delivery system in Li et al. Controlled Gene Delivery System Based on Thermosensitive Biodegradable Hydrogel. Pharmaceutical Research 2003Attorney Docket No. 11538-009W01

[0243] 20(6): 884-888; and Chang et al., Non-ionic amphiphilic biodegradable PEG-PLGA-PEG copolymer enhances gene delivery efficiency in rat skeletal muscle. J Controlled Release. 2007 118:245-253, the contents of each of which are herein incorporated by reference in their entirety). The nucleic acid (e.g., mRNA) vaccines of the present disclosure may be formulated in lipid nanoparticles comprising the PEG-PLGA-PEG block copolymer.

[0244] In some embodiments, the nanoparticle may comprise a multiblock copolymer (see e.g., U. S. Pat. Nos. 8,263,665 and 8,287,910 and U. S. Patent Pub. No. US20130195987, the contents of each of which are herein incorporated by reference in their entirety).

[0245] In some embodiments, the block copolymers described herein may be included in a polyion complex comprising a non-polymeric micelle and the block copolymer, (see e.g., U. S. Publication No. 20120076836, the contents of which are herein incorporated by reference in their entirety).

[0246] In some embodiments, the nanoparticle may comprise at least one acrylic polymer. Acrylic polymers include but are not limited to, acrylic acid, methacrylic acid, acrylic acid and methacrylic acid copolymers, methyl methacrylate copolymers, ethoxy ethyl methacrylates, cyanoethyl methacrylate, amino alkyl methacrylate copolymer, poly(acrylic acid),

[0247] poly (methacrylic acid), polycyanoacrylates and combinations thereof.

[0248] In some embodiments, the nanoparticles may comprise at least one poly(vinyl ester) polymer. The poly(vinyl ester) polymer may be a copolymer such as a random copolymer. As a non-limiting example, the random copolymer may have a structure such as those described in International Application No. WO2013032829 or U. S. Patent Publication No US20130121954, the contents of each of which are herein incorporated by reference in their entirety. In some embodiments, the poly( vinyl ester) polymers may be conjugated to the polynucleotides described herein.

[0249] In some embodiments, the nanoparticle may include at least one diblock copolymer. The diblock copolymer may be, but it not limited to, a poly(lactic) acid-poly(ethylene)glycol copolymer (see, e.g., International Patent Publication No. WO2013044219, the contents of which are herein incorporated by reference in their entirety). As a non-limiting example, the nanoparticle may be used to treat cancer (see International publication No. WO2013044219, the contents of which are herein incorporated by reference in their entirety).

[0250] In some embodiments, the nanoparticles may include at least one cationic polymer described herein and / or known in the art.Attorney Docket No. 11538-009W01

[0251] In some embodiments, the nanoparticles may include at least one amine-containing polymer such as, but not limited to polylysine, polyethylene imine, poly(amidoamine) dendrimers, poly(beta-amino esters) (see, e.g., U. S. Pat. No. 8,287, 849, the contents of which are herein incorporated by reference in their entirety) and combinations thereof.

[0252] In some embodiments, the nanoparticles may comprise at least one degradable polyester which may contain polycationic side chains. Degradable polyesters include, but are not limited to, poly(serine ester), poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), and combinations thereof. In some embodiments, the degradable polyesters may include a PEG conjugation to form a PEGylated polymer.

[0253] In some embodiments, the compositions may be formulated in colloid nanocarriers as described in U. S. Patent Publication No. US20130197100, the contents of which are herein incorporated by reference in their entirety.

[0254] In some embodiments, the nanoparticle may be optimized for oral administration. The nanoparticle may comprise at least one cationic biopolymer such as, but not limited to, chitosan or a derivative thereof. As a non-limiting example, the nanoparticle may be formulated by the methods described in U. S. Publication No. 20120282343, the contents of which are herein incorporated by reference in their entirety.

[0255] In some embodiments, LNPs comprise the lipid KL52 (an amino-lipid disclosed in U. S. Application Publication No. 2012 / 0295832, the contents of which are herein incorporated by reference in their entirety. Activity and / or safety (as measured by examining one or more of ALT / AST, white blood cell count and cytokine induction, for example) of LNP administration may be improved by incorporation of such lipids. LNPs comprising KL52 may be administered intravenously and / or in one or more doses. In some embodiments, administration of LNPs comprising KL52 results in equal or improved mRNA and / or protein expression as compared to LNPs comprising MC3.

[0256] In some embodiments, the lipid nanoparticle may be a limit size lipid nanoparticle described in International Patent Publication No. WO2013059922, the contents of which are herein incorporated by reference in their entirety. The limit size lipid nanoparticle may comprise a lipid bilayer surrounding an aqueous core or a hydrophobic core; where the lipid bilayer may comprise a phospholipid such as, but not limited to, diacylphosphatidylcholine, a diacylphosphatidylethanolamine, a ceramide, a sphingomyelin, a dihydrosphingomyelin, a cephalin, a cerebroside, a C8-C20 fatty acid diacylphosphatidylcholine, and l-palmitoyl-2-oleoyl phosphatidylcholine (POPC). In some embodiments, the limit size lipid nanoparticle mayAttorney Docket No. 11538-009W01

[0257] comprise a polyethylene glycol-lipid such as, but not limited to, DLPE-PEG, DMPE-PEG, DPPC-PEG and DSPE-PEG.

[0258] In some embodiments, the compositions may be formulated in a nanoparticle comprising an inner core comprising a non-cellular material and an outer surface comprising a cellular membrane. The cellular membrane may be derived from a cell or a membrane derived from a virus. As a non-limiting example, the nanoparticle may be made by the methods described in International Patent Publication No. WO2013052167, the contents of which are herein incorporated by reference in their entirety. As another non-limiting example, the nanoparticle described in International Patent Publication No. WO2013052167, the contents of which are herein incorporated by reference in their entirety, may be used to deliver the compositions described herein.

[0259] In some embodiments, the compositions may be formulated in porous nanoparticle-supported lipid bilayers (protocells). Protocells are described in International Patent Publication No. WO2013056132, the contents of which are herein incorporated by reference in their entirety.

[0260] In some embodiments, the compositions described herein may be formulated in polymeric nanoparticles as described in or made by the methods described in U. S. Pat. Nos. 8,420,123 and 8,518,963 and European Patent No. EP2073848B1, the contents of each of which are herein incorporated by reference in their entirety. As a non-limiting example, the polymeric nanoparticle may have a high glass transition temperature such as the nanoparticles described in or nanoparticles made by the methods described in U. S. Pat. No. 8,518,963, the contents of which are herein incorporated by reference in their entirety. As another non-limiting example, the polymer nanoparticle for oral and parenteral formulations may be made by the methods described in European Patent No. EP2073848B1, the contents of which are herein incorporated by reference in their entirety.

[0261] In some embodiments, the compositions described herein may be formulated in nanoparticles used in imaging. 'The nanoparticles may be liposome nanoparticles such as those described in U. S. Patent Publication No US20130129636, herein incorporated by reference in its entirety. As a non-limiting example, the liposome may comprise gadolinium(III)2-{4,7-bis- carboxymethyl-10-[(N, N-distearylamidomethyl-N'-amido-methyl]-l,4,7,10-tetra-azacyclododec- 1-yl} -acetic acid and a neutral, fully saturated phospholipid component (see, e.g., U. S. Patent Publication No US20130129636, the contents of which are herein incorporated by reference in their entirety).Attorney Docket No. 11538-009W01

[0262] In some embodiments, the nanoparticles which may be used in the present disclosure are formed by the methods described in U. S. Patent Application No. US20130130348, the contents of which are herein incorporated by reference in their entirety.

[0263] In some embodiments, the compositions of the present disclosure may be formulated in a swellable nanoparticle. The swellable nanoparticle may be, but is not limited to, those described in U. S. Pat. No. 8,440,251, the contents of which are herein incorporated by reference in their entirety.

[0264] The compositions of the present disclosure may be formulated in polyanhydride nanoparticles such as, but not limited to, those described in U. S. Pat. No. 8,449,916, the contents of which are herein incorporated by reference in their entirety.

[0265] The nanoparticles and microparticles of the present disclosure may be geometrically engineered to modulate macrophage and / or the immune response. In some embodiments, the geometrically engineered particles may have varied shapes, sizes and / or surface charges in order to incorporate the polynucleotides of the present disclosure for targeted delivery. Other physical features the geometrically engineering particles may have include, but are not limited to, fenestrations, angled arms, asymmetry and surface roughness, charge which can alter the interactions with cells and tissues. As a non-limiting example, nanoparticles of the present disclosure may be made by the methods described in International Publication No W02013082111, the contents of which are herein incorporated by reference in their entirety.

[0266] In some embodiments, the nanoparticles of the present disclosure may be water soluble nanoparticles such as, but not limited to, those described in International Publication No.

[0267] WO2013090601, the contents of which are herein incorporated by reference in their entirety. The nanoparticles may be inorganic nanoparticles which have a compact and zwitterionic ligand in order to exhibit good water solubility. The nanoparticles may also have small hydrodynamic diameters (HD), stability with respect to time, pH, and salinity and a low level of non-specific protein binding.

[0268] In some embodiments, the nanoparticles of the present disclosure may be developed by the methods described in U. S. Patent Publication No. US20130172406, the contents of which are herein incorporated by reference in their entirety.

[0269] In some embodiments, the nanoparticles of the present disclosure are stealth nanoparticles or target-specific stealth nanoparticles such as, but not limited to, those described in U. S. Patent Publication No. US20130172406, the contents of which are herein incorporated by reference in their entirety. The nanoparticles of the present disclosure may be made by theAttorney Docket No. 11538-009W01

[0270] methods described in U. S. Patent Publication No. US20130172406, the contents of which are herein incorporated by reference in their entirety.

[0271] In some embodiments, the stealth or target-specific stealth nanoparticles may comprise a polymeric matrix. The polymeric matrix may comprise two or more polymers such as, but not limited to, polyethylenes, polycarbonates, polyanhydrides, polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers, polyesters, poly(orthoesters), polycy anoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polycy anoacrylates, polyureas, polystyrenes, polyamines, polyesters, polyanhydrides, polyethers, polyurethanes, polymethacrylates, polyacrylates, polycyanoacrylates or combinations thereof.

[0272] In some embodiments, the nanoparticle may be a nanoparticle-nucleic acid hybrid structure having a high-density nucleic acid layer. As a non-limiting example, the nanoparticle- nucleic acid hybrid structure may made by the methods described in U. S. Patent Publication No. US20130171646, the contents of which are herein incorporated by reference in their entirety. The nanoparticle may comprise a nucleic acid such as, but not limited to, polynucleotides described herein and / or known in the art.

[0273] At least one of the nanoparticles of the present disclosure may be embedded in the core a nanostructure or coated with a low density porous 3-D structure or coating which is capable of carrying or associating with at least one payload within or on the surface of the nanostructure. Non-limiting examples of the nanostructures comprising at least one nanoparticle are described in International Patent Publication No. WO2013123523, the contents of which are herein incorporated by reference in their entirety.

[0274] In some embodiments, compositions may be delivered using smaller LNPs. Such particles may comprise a diameter from below 0.1 m up to 100 nm such as, but not limited to, less than 0.1 pm, less than 1.0 pm, less than 5 pm, less than 10 pm, less than 15 pm, less than 20 pm, less than 25 pm, less than 30 pm, less than 35 pm, less than 40 pm, less than 50 pm, less than 55 pm, less than 60 pm, less than 65 pm, less than 70 pm, less than 75 pm, less than 80 pm, less than 85 pm, less than 90 pm, less than 95 pm, less than 100 pm, less than 125 pm, less than 150 pm, less than 175 pm, less than 200 pm, less than 225 pm, less than 250 pm, less than 275 pm, less than 300 pm, less than 325 pm, less than 350 pm, less than 375 pm, less than 400 pm, less than 425 pm, less than 450 pm, less than 475 pm, less than 500 pm, less than 525 pm, less than 550 pm, less than 575 pm, less than 600 pm, less than 625 pm, less than 650 pm, less than 675 pm, less than 700 pm, less than 725 pm, less than 750 pm, less than 775 pm, less thanAttorney Docket No. 11538-009W01

[0275] 800 nm, less than 825 pm, less than 850 pm, less than 875 pm, less than 900 pm, less than 925 pm, less than 950 pm, less than 975 pm, or less than 1000 pm.

[0276] In some embodiments, compositions may be delivered using smaller LNPs, which may comprise a diameter from 1 nm to 100 nm, from 1 nm to 10 nm, 1 nm to 20 nm, from 1 nm to 30 nm, from 1 nm to 40 nm, from 1 nm to 50 nm, from 1 nm to 60 nm, from 1 nm to 70 nm, from 1 nm to 80 nm, from 1 nm to 90 nm, from 5 nm to from 100 nm, from 5 nm to 10 nm, 5 nm to 20 nm, from 5 nm to 30 nm, from 5 nm to 40 nm, from 5 nm to 50 nm, from 5 nm to 60 nm, from 5 nm to 70 nm, from 5 nm to 80 nm, from 5 nm to 90 nm, from 10 to 50 nm, from 20 to 50 nm, from 30 to 50 nm, from 40 to 50 nm, from 20 to 60 nm, from 30 to 60 nm, from 40 to 60 nm, from 20 to 70 nm, from 30 to 70 nm, from 40 to 70 nm, from 50 to 70 nm, from 60 to 70 nm, from 20 to 80 nm, from 30 to 80 nm, from 40 to 80 nm, from 50 to 80 nm, from 60 to 80 nm, from 20 to 90 nm, from 30 to 90 nm, from 40 to 90 nm, from 50 to 90 nm, from 60 to 90 nm and / or from 70 to 90 nm.

[0277] In some embodiments, such LNPs are synthesized using methods comprising microfluidic mixers. Examples of microfluidic mixers may include, but are not limited to, a slit interdigital micromixer including, but not limited to those manufactured by Microinnova (Allerheiligen bei Wildon, Austria) and / or a staggered herringbone micromixer (SHM) (Zliigaltsev, I. V. et al., Bottom-up design and synthesis of limit size lipid nanoparticle systems with aqueous and triglyceride cores using millisecond microfluidic mixing have been published (Langmuir. 2012. 28:3633-40; Belliveau, N. M. et al., Microfluidic synthesis of highly potent limit-size lipid nanoparticles for in vivo delivery of siRNA. Molecular Therapy-Nucleic Acids.

[0278] 2012. 1:e37; Chen, D. et al., Rapid discovery of potent siRNA-containing lipid nanoparticles enabled by controlled microfluidic formulation. J Am Chem Soc. 2012. 134(16):6948- 1, the contents of each of which are herein incorporated by reference in their entirety). In some embodiments, methods of LNP generation comprising SHM, further comprise the mixing of at least two input streams wherein mixing occurs by microstructure-induced chaotic advection (MICA). According to this method, fluid streams flow through channels present in a herringbone pattern causing rotational flow and folding the fluids around each other. This method may also comprise a surface for fluid mixing wherein the surface changes orientations during fluid cycling. Methods of generating LNPs using SHM include those disclosed in U. S. Application Publication Nos. 2004 / 0262223 and 2012 / 0276209, the contents of each of which are herein incorporated by reference in their entirety.Attorney Docket No. 11538-009W01

[0279] In some embodiments, the compositions of the present disclosure may be formulated in lipid nanoparticles created using a micromixer such as, but not limited to, a Slit Interdigital Microstructured Mixer (SIMM-V2) or a Standard Slit Interdigital Micro Mixer (SSIMM) or Caterpillar (CPMM) or Impinging-jet (IJMM) from the Institut fur Mikrotechnik Mainz GmbH, Mainz Germany).

[0280] In some embodiments, the compositions of the present disclosure may be formulated in lipid nanoparticles created using microfluidic technology (see, e.g., Whitesides, George M. The Origins and the Future of Microfluidics. Nature, 2006442: 368-373; and Abraham et al. Chaotic Mixer for Microchannels. Science, 2002295: 647-651; each of which is herein incorporated by reference in its entirety). As a non-limiting example, controlled microfluidic formulation includes a passive method for mixing streams of steady pressure-driven flows in micro channels at a low Reynolds number (see, e.g., Abraham et al. Chaotic Mixer for Microchannels. Science, 2002295: 647-651, the contents of which are herein incorporated by reference in their entirety).

[0281] In some embodiments, the compositions of the present disclosure may be formulated in lipid nanoparticles created using a micromixer chip such as, but not limited to, those from Harvard Apparatus (Holliston, Mass.) or Dolomite Microfluidics (Royston, UK). A micromixer chip can be used for rapid mixing of two or more fluid streams with a split and recombine mechanism.

[0282] In some embodiments, the compositions of the disclosure may be formulated in lipid nanoparticles having a diameter from 10 to 100 nm such as, but not limited to, 10 to 20 nm, 10 to 30 nm, 10 to 40 nm, 10 to 50 nm, 10 to 60 nm, 10 to 70 nm, 10 to 80 nm, 10 to 90 nm, 20 to 30 nm, 20 to 40 nm, 20 to 50 nm, 20 to 60 nm, 20 to 70 nm, 20 to 80 nm, 20 to 90 nm, 20 to 100 nm, 30 to 40 nm, 30 to 50 nm, 30 to 60 nm, 30 to 70 nm, 30 to 80 nm, 30 to 90 nm, 30 to 100 nm, 40 to 50 nm, 40 to 60 nm, 40 to 70 nm, 40 to 80 nm, about 40 to about 90 nm, about 40 to 100 nm, 50 to 60 nm, 50 to 70 nm, 50 to 80 nm, 50 to 90 nm, 50 to 100 nm, 60 to 70 nm, 60 to 80 nm, 60 to 90 nm, 60 to 100 nm, 70 to 80 nm, 70 to 90 nm, 70 to 100 nm, 80 to 90 nm, 80 to 100 nm, and / or 90 to 100 nm.

[0283] In some embodiments, the lipid nanoparticles may have a diameter from 10 to 500 nm. In some embodiments, the lipid nanoparticle may have a diameter greater than 100 nm, greater than 150 nm, greater than 200 nm, greater than 250 nm, greater than 300 nm, greater than 350 nm, greater than 400 nm, greater than 450 nm, greater than 500 nm, greater than 550 nm, greater than 600 nm, greater than 650 nm, greater than 700 nm, greater than 750 nm, greater than 800 nm, greater than 850 nm, greater than 900 nm, greater than 950 nm or greater than 1000 nm.Attorney Docket No. 11538-009W01

[0284] Described herein are also composition including an effective amount of a nanoparticle described herein and a pharmaceutically acceptable carrier. In some aspects, the pharmaceutical compositions can include a pharmaceutically acceptable carrier and a nanoparticle including a single chain trimer nucleic acid (e.g., mRNA) encoding a first T cell epitope, a P2-microglobulin, and a first MHC heavy chain sequence encapsulated in the nanoparticle. In some aspects, the pharmaceutical composition can include a pharmaceutically acceptable carrier and a lipid nanoparticle including a single chain trimer nucleic acid (e.g., mRNA) encoding a first T cell epitope, a p2-microglobulin, and a first MHC heavy chain sequence encapsulated in the lipid nanoparticle.

[0285] Described herein are also composition including an effective amount of a nanoparticle described herein and a pharmaceutically acceptable carrier. In some aspects, the pharmaceutical compositions can include a pharmaceutically acceptable carrier and a nanoparticle including a single chain nucleic acid dimer (e.g., mRNA) encoding a T cell epitope, and a primary MHC heavy chain sequence encapsulated in the nanoparticle. In some aspects, the pharmaceutical composition can include a pharmaceutically acceptable carrier and a lipid nanoparticle including a single chain nucleic acid dimer (e.g., mRNA) encoding aT cell epitope, and a primary MHC heavy chain sequence encapsulated in the lipid nanoparticle.

[0286] Liposomes, lipoplexes, or lipid nanoparticles may be used to improve the efficacy of polynucleotides directed protein production as these formulations may be able to increase cell transfection by the RNA (e.g., mRNA) polynucleotide; and / or increase the translation of encoded protein. One such example involves the use of lipid encapsulation to enable the effective systemic delivery of polyplex plasmid DNA (Heyes et al., Mol Ther. 2007 15: 713-720; the contents of which are incorporated herein by reference in their entirety). The liposomes, lipoplexes, or lipid nanoparticles may also be used to increase the stability of the polynucleotide.

[0287] Liposomes are artificially-prepared vesicles which may primarily be composed of a lipid bilayer and may be used as a delivery vehicle for the administration of nutrients and pharmaceutical formulations. Liposomes can be of different sizes such as, but not limited to, a multilamellar vesicle (MLV) which may be hundreds of nanometers in diameter and may contain a series of concentric bilayers separated by narrow aqueous compartments, a small unicellular vesicle (SUV) which may be smaller than 50 nm in diameter, and a large unilamellar vesicle (LUV) which may be between 50 and 500 nm in diameter. Liposome design may include, but is not limited to, opsonins or ligands in order to improve the attachment of liposomes to unhealthyAttorney Docket No. 11538-009W01

[0288] tissue or to activate events such as, but not limited to, endocytosis. Liposomes may contain a low or a high pH in order to improve the delivery of the pharmaceutical formulations.

[0289] The formation of liposomes may depend on the physicochemical characteristics such as, but not limited to, the pharmaceutical formulation entrapped and the liposomal ingredients, the nature of the medium in which tire lipid vesicles are dispersed, the effective concentration of the entrapped substance and its potential toxicity, any additional processes involved during the application and / or delivery of the vesicles, the optimization size, polydispersity and the shelf-life of tire vesicles for tire intended application, and the batch-to-batch reproducibility and possibility of large-scale production of safe and efficient liposomal products.

[0290] In some embodiments, pharmaceutical compositions described herein may include, without limitation, liposomes such as those formed from l,2-dioleyloxy-N, N-dimethylaminopropane (DODMA) liposomes, DiLa2 liposomes from Marina Biotech (Bothell, Wash.), 1,2-dilinoleyloxy-3-dimethylaminopropane (DLin-DMA), 2,2-dilinoleyl-4-(2- dimethylaminoethyl)-[l,3]-dioxolane (DLin-KC2-DMA), and MC3 (US20100324120; herein incorporated by reference in its entirety) and liposomes which may deliver small molecule drugs such as, but not limited to, DOXIL® from Janssen Biotech, Inc. (Horsham, Pa.).

[0291] In some embodiments, pharmaceutical compositions described herein may include, without limitation, liposomes such as those formed from the synthesis of stabilized plasmid-lipid particles (SPLP) or stabilized nucleic acid lipid particle (SNALP) that have been previously described and shown to be suitable for oligonucleotide delivery in vitro and in vivo (see Wlieeler et al. Gene Therapy. 1999 6:271-281; Zhang et al. Gene Therapy. 1999 6:1438-1447; Jeffs et al. Pharm Res. 2005 22:362-372; Morrissey et al., Nat Biotechnol. 2005 23:1002-1007; Zimmermann et al., Nature. 2006441:111-114; Heyes et al. J Contr Rel. 2005 107:276-287; Semple et al. Nature Biotech. 201028: 172-176; Judge et al. J Clin Invest. 2009 119:661-673; deFougerolles Hum Gene Ther. 2008 19:125-132; U. S. Patent Publication No US20130122104; all of which are incorporated herein in their entireties). The original manufacture method by Wheeler et al. was a detergent dialysis method, which was later improved by Jeffs et al. and is referred to as the spontaneous vesicle formation method. The liposome formulations are composed of 3 to 4 lipid components in addition to the polynucleotide. As an example a liposome can contain, but is not limited to, 55% cholesterol, 20% disteroylphosphatidyl choline (DSPC), 10% PEG-S-DSG, and 1 % l,2-dioleyloxy-N, N-dimethylaminopropane (DODMA), as described by Jeffs et al. As another example, certain liposome formulations may contain, but are not limited to, 48% cholesterol, 20% DSPC, 2% PEG-c-DMA, and 30% cationic lipid, where the cationic lipid canAttorney Docket No. 11538-009W01

[0292] be l,2-distearloxy-N N-dimethylaminopropane (DSDMA), DODMA, DLin-DMA, or 1,2-dilinolenyloxy-3-dimethylaminopropane (DLenDMA), as described by Heyes et al.

[0293] In some embodiments, liposome formulations may comprise from about 25.0% cholesterol to about 40.0% cholesterol, from about 30.0% cholesterol to about 45.0% cholesterol, from about 35.0% cholesterol to about 50.0% cholesterol and / or from about 48.5% cholesterol to about 60% cholesterol. In some embodiments, formulations may comprise a percentage of cholesterol selected from the group consisting of 28.5%, 31.5%, 33.5%, 36.5%, 37.0%, 38.5%, 39.0%’ and 43.5%. In some embodiments, formulations may comprise from about 5.0% to about 10.0% DSPC and / or from about 7.0% to about 15.0% DSPC.

[0294] In some embodiments, the compositions may be formulated in liposomes such as, but not limited to, DiLa2 liposomes (Marina Biotech, Bothell, Wash.), SMARTICLES® (Marina Biotech, Bothell, Wash.), neutral DOPC (l,2-dioleoyl-sn-glycero-3-phosphocholine) based liposomes (e.g., siRNA delivery for ovarian cancer (Landen et al. Cancer Biology & Therapy 20065(12) 1708-1713); herein incorporated by reference in its entirety) and hyaluronan-coated liposomes (Quiet Therapeutics, Israel).

[0295] In some embodiments, the compositions may be formulated in a lipid vesicle, which may have crosslinks between functionalized lipid bilayers.

[0296] In some embodiments, the compositions may be formulated in a lipid-polycation complex. The formation of the lipid-polycation complex may be accomplished by methods known in the art and / or as described in U. S. Pub. No. 20120178702, herein incorporated by reference in its entirety. As a non-limiting example, the polycation may include a cationic peptide or a polypeptide such as, but not limited to, polylysine, polyornithine and / or polyarginine. In some embodiments, the compositions may be formulated in a lipid-polycation complex, which may further include a non-cationic lipid such as, but not limited to, cholesterol or dioleoyl phosphatidylethanolamine (DOPE).

[0297] In some embodiments, the composition can be formulated as a lipoplex, such as, without limitation, the ATUPLEX™ system, the DACC system, the DBTC system and other siRNA -lipoplex technology from Silence Therapeutics (London, United Kingdom), STEMFECT™ from STEMGENT® (Cambridge, Mass.), and polyethylenimine (PEI) or protamine-based targeted and non-targeted delivery of nucleic acids acids (Aleku et al. Cancer Res. 2008 68:9788-9798; Strumberg et al. Int J Clin Pharmacol Ther 201250:76-78; Santel et al., Gene Ther 2006 13:1222-1234; Santel et al., Gene Ther 2006 13:1360-1370; Gutbier et al., Pulm Pharmacol. Ther. 201023:334-344; Kaufmann et al. Microvasc Res 2010 80:286-293 Weide et al. JAttorney Docket No. 11538-009W01

[0298] Immunother. 2009 32:498-507; Weide et al. J Immunother. 2008 31:180-188; Pascolo Expert Opin. Biol. Ther. 4:1285-1294; Fotin-Mleczek et al., 2011 J. Immunother. 34:1-15; Song et al., Nature Biotechnol. 2005, 23:709-717; Peer et al., Proc Natl Acad Sci USA. 2007 6; 104:4095-4100; deFougerolles Hum Gene Ther. 2008 19:125-132, the contents of each of which are incorporated herein by reference in their entirety).

[0299] In some embodiments, such formulations may also be constructed or compositions altered such that they passively or actively are directed to different cell types in vivo, including but not limited to hepatocytes, immune cells, tumor cells, endothelial cells, antigen presenting ceils, and leukocytes (Akinc et al. Mol Ther. 2010 18:1357-1364; Song et al., Nat Biotechnol.

[0300] 2005 23:709-717; Judge et al., J Clin Invest. 2009 119:661-673; Kaufmann et al., Microvasc Res 201080:286-293; Santel et al., Gene Ther 2006 13:1222-1234; Santel et al., Gene Ther 2006 13:1360-1370; Gutbier et al., Pulm Pharmacol. Ther. 201023:334-344; Basha et al., Mol. Ther.

[0301] 2011 19:2186-2200; Fenske and Cullis, Expert Opin Drug Deliv. 20085:25-44; Peer et al., Science. 2008 319:627-630; Peer and Lieberman, Gene Ther. 2011 18:1127-1133, the contents of each of which are incorporated herein by reference in their entirety). One example of passive targeting of formulations to liver cells includes the DLin-DMA, DLin-KC2-DMA and DLin- MC3-DMA-based lipid nanoparticle formulations, which have been shown to bind to apolipoprotein E and promote binding and uptake of these formulations into hepatocytes in vivo (Akinc et al. Mol Ther. 2010 18:1357-1364, the contents of which are incorporated herein by reference in their entirety). Formulations can also be selectively targeted through expression of different ligands on their surface as exemplified by, but not limited by, folate, transferrin, N- acetylgalactosamine (GalNAc), and antibody targeted approaches (Kolhatkar et al., Curr Drug Discov Technol. 2011 8:197-206; Musacchio and Torchilin, Front Biosci. 2011 16:1388-1412; Yu et al., Mol Membr Biol. 201027:286-298; Patil et al., Grit Rev Ther Drug Carrier Syst. 2008 25:1-61; Benoit et al., Biomacromolecules. 2011 12:2708-2714; Zhao et al., Expert Opin Drug Deliv. 2008 5:309-319; Akinc et al., Mol Ther. 2010 18: 1357-1364; Srinivasan et al., Methods Mol Biol. 2012 820:105-116; Ben-Arie et al., Methods Mol Biol. 2012757:497-507; Peer 2010 J Control Release. 20:63-68; Peer et al., Proc Natl Acad Sci USA. 2007 104:4095-4100; Kim et al., Methods Mol Biol. 2011 721:339-353; Subramanya et al., Mol Ther. 2010 18:2028-2037; Song et al., Nat Biotechnol. 2005 23:709-717; Peer et al., Science. 2008 319:627-630; Peer and Lieberman, Gene Ther. 2011 18:1127-1133, the contents of each of which are incorporated herein by reference in their entirety).Attorney Docket No. 11538-009W01

[0302] In some embodiments, the composition of the present disclosure can be formulated for controlled release and / or targeted delivery. As used herein, “controlled release” refers to a pharmaceutical composition or compound release profile that conforms to a particular pattern of release to effect a therapeutic outcome. In some embodiments, the compositions may be encapsulated into a delivery agent described herein and / or known in the art for controlled release and / or targeted delivery. As used herein, the term “encapsulate” means to enclose, surround or encase. As it relates to the formulation of the compounds of the disclosure, encapsulation may be substantial, complete or partial. The term “substantially encapsulated” means that at least greater than 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.9 or greater than 99.999% of the pharmaceutical composition or compound of the disclosure may be enclosed, surrounded or encased within the delivery agent. “Partially encapsulation” means that less than 10, 10, 20, 30, 4050 or less of the pharmaceutical composition or compound of the disclosure may be enclosed, surrounded or encased within the delivery agent. Advantageously, encapsulation may be determined by measuring the escape or the activity of the pharmaceutical composition or compound of the disclosure using fluorescence and / or electron micrograph. For example, at least 1, 5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or greater than 99.99% of the pharmaceutical composition or compound of the disclosure are encapsulated in the delivery agent.

[0303] In some embodiments, the controlled release formulation may include, but is not limited to, tri-block co-polymers. As a non-limiting example, the formulation may include two different types of tri-block co-polymers (U. S. Patent Nos. 9,901,554 and 9,795,679, the contents of each of which are incorporated herein by reference in their entirety).

[0304] In some embodiments, the compositions may be encapsulated into a lipid nanoparticle or a rapidly eliminated lipid nanoparticle and the lipid nanoparticles or a rapidly eliminated lipid nanoparticle may then be encapsulated into a polymer, hydrogel and / or surgical sealant described herein and / or known in the art. As a non-limiting example, the polymer, hydrogel or surgical sealant may be PLGA, ethylene vinyl acetate (EVAc), poloxamer, GELSITE® (Nanotherapeutics, Inc. Alachua, Fla.), HYLENEX® (Halozyme Therapeutics, San Diego Calif.), surgical sealants such as fibrinogen polymers (Ethicon Inc. Cornelia, Ga.), TISSELL® (Baxter International, Inc Deerfield, 111.), PEG-based sealants, and COSEAL® (Baxter International, Inc Deerfield, Ill.).

[0305] In some embodiments, the compositions described herein formulated for controlled release and / or targeted delivery may also include at least one degradable polyester which mayAttorney Docket No. 11538-009W01

[0306] contain polycationic side chains. Degradable polyesters include, but are not limited to, poly(serine ester), poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), and combinations thereof. In some embodiments, the degradable polyesters may include a PEG conjugation to form a PEGylated polymer.

[0307] In some embodiments, the compositions described herein formulated for controlled release and / or targeted delivery may also include at least one PEG and / or PEG related polymer derivatives as described in U. S. Pat. No. 8,404,222, the contents of which are incorporated herein by reference in their entirety.

[0308] In some embodiments, the compositions described herein formulated for controlled release delivery may be the controlled release polymer system described in US20130130348, the contents of which are incorporated herein by reference in their entirety.

[0309] In some embodiments, the synthetic nanocarriers may be formulated for targeted release. In some embodiments, the synthetic nanocarrier is formulated to release the polynucleotides at a specified pH and / or after a desired time interval. As a non-limiting example, the synthetic nanoparticle may be formulated to release the RNA (e.g., mRNA) vaccines after 24 hours and / or at a pH of 4.5 (see International Publication Nos. W02010138193 and W02010138194 and U. S. Pub Nos. US20110020388 and US20110027217, each of which is herein incorporated by reference in their entireties).

[0310] In some embodiments, the synthetic nanocarriers may be formulated for controlled and / or sustained release of the nucleic acids described herein. As a non-limiting example, the synthetic nanocarriers for sustained release may be formulated by methods known in the art, described herein and / or as described in International Pub No. W02010138192 and US Pub No.

[0311] 20100303850, each of which is herein incorporated by reference in their entirety.

[0312] In some embodiments, the synthetic nanocarrier may be formulated for use as a vaccine. As a non-limiting example, the synthetic nanocarrier may include but is not limited to nanocarriers described in International Publication No. WO2011150264, WO2011150249, WO2012024621, WO201202629, WO2012024632 and U. S. Publication No. US20110293701, U. S. Publication No. US20110293723, US20120064110, US20120058153 and US20120058154 the contents of each of which are herein incorporated by reference in their entirety.

[0313] The vaccine dosage form may be selected by methods described herein, known in the art and / or described in International Publication No. WO2011150258 and U. S. Publication No.

[0314] US20120027806, the contents of each of which are herein incorporated by reference in their entirety).Attorney Docket No. 11538-009W01

[0315] In some embodiments, the compositions may be formulated in colloid nanocarriers as described in U. S. Patent Publication No. US20130197100, the contents of which are herein incorporated by reference in their entirety.

[0316] In some embodiments, the compositions of the disclosure may be formulated for delivery using the drug encapsulating microspheres described in International Patent Publication No. WO2013063468 or U. S. Pat. No. 8,440,614, the contents of each of which are herein incorporated by reference in their entirety. The microspheres may comprise a compound of the formula (I), (II), (III), (IV), (V) or (VI) as described in International Patent Publication No. WO2013063468, the contents of which are herein incorporated by reference in their entirety. In some embodiments, the amino acid, peptide, polypeptide, lipids (APPL) are useful in delivering the RNA (e.g., mRNA) polynucleotides of the disclosure to cells (see International Patent Publication No. WO2013063468, the contents of which are herein incorporated by reference in their entirety).

[0317] In some embodiments, the compositions may be delivered, localized and / or concentrated in a specific location using the delivery methods described in International Patent Publication No. W02013063530, the contents of which are herein incorporated by reference in their entirety. As a non-limiting example, a subject may be administered an empty polymeric particle prior to, simultaneously with or after delivering the compositions described herein to the subject. The empty polymeric particle undergoes a change in volume once in contact with the subject and becomes lodged, embedded, immobilized or entrapped at a specific location in the subject.

[0318] In some embodiments, the compositions may be formulated in an active substance release system (see, e.g., U. S. Patent Publication No. US20130102545, the contents of which are herein incorporated by reference in their entirety). The active substance release system may comprise 1) at least one nanoparticle bonded to an oligonucleotide inhibitor strand which is hybridized with a catalytically active nucleic acid and 2) a compound bonded to at least one substrate molecule bonded to a therapeutically active substance (e.g., polynucleotides described herein), where the therapeutically active substance is released by the cleavage of the substrate molecule by the catalytically active nucleic acid.

[0319] In some embodiments the compositions may be associated with a cationic or polycationic compounds, including protamine, nucleoline, spermine or spermidine, or other cationic peptides or proteins, such as poly-L-lysine (PLL), polyarginine, basic polypeptides, cell penetrating peptides (CPPs), including HIV-binding peptides, HIV-1 Tat (HIV), Tat-derived peptides, Penetratin, VP22derived or analog peptides, Pestivirus Ems, HSV, VP22(Herpes simplex), MAP,Attorney Docket No. 11538-009W01

[0320] KALA or protein transduction domains (PTDs), PpT620, prolin-rich peptides, arginine-rich peptides, lysine -rich peptides, MPG-peptide(s), Pep-1, L-oligomers, Calcitonin peptide(s), Antennapedia-derived peptides (particularly from Drosophila antennapedia), pAntp, plsl, FGF, Lactoferrin, Transportan, Buforin-2, Bac715-24, SynB, SynB(l), pVEC, hCT-derived peptides, SAP, histones, cationic polysaccharides, for example chitosan, polybrene, cationic polymers, e.g. polyethyleneimine (PEI), cationic lipids, e.g. DOTMA: [l-(2,3-sioleyloxy)propyl)]-N, N, N- trimethyl ammonium chloride, DMRIE, di-C14-amidine, DOTIM, SAINT, DC -Choi, BGTC, CTAP, DOPC, DODAP, DOPE: Dioleyl phosphatidylethanol-amine, DOSPA, DODAB, DOIC, DMEPC, DOGS: Dioctadecylamidoglicylspemiin, DIMRI: Dimyristooxypropyl dimethyl hydroxyethyl ammonium bromide, DOTAP: dioleoyloxy-3-(trimethylammonio)propane, DC-6- 14: O, O-ditetradecanoyl-N-.alpha.-trimethylammonioacetyl)diethanolamine chloride, CLIP 1: rac-[(2,3-dioctadecyloxypropyl)(2 -hydroxyethyl)] -dimethylammonium chloride, CLIP6: rac- [2(2,3-dihexadecyloxypropyloxymethyloxy)ethyl]-trimethylammonium, CLIP9: rac-[2(2,3-dihexadecyloxypropyloxysuccinyloxy)ethyl]-trimethylammonium, oligofectamine, or cationic or polycationic polymers, e.g. modified polyaminoacids, such as beta-aminoacid-polymers or reversed polyamides, etc., modified polyethylenes, such as PVP (poly(N-ethyl-4-vinylpyridinium bromide)), etc., modified acrylates, such as pDMAEMA (poly(dimethylaminoethyl methylacrylate)), etc., modified amidoamines such as pAMAM (poly(amidoamine)), etc., modified polybetaminoester (PBAE), such as diamine end modified 1,4 butanediol diacrylate-co-5-amino-l-pentanol polymers, etc., dendrimers, such as polypropylamine dendrimers or pAMAM based dendrimers, etc., polyimine(s), such as PEI: poly(ethyleneimiiie), poly(propyleneimine), etc., polyallylamine, sugar backbone based polymers, such as cyclodextrin based polymers, dextran based polymers, chitosan, etc., silan backbone based polymers, such as PMOXA-PDMS copolymers, etc., blockpolymers consisting of a combination of one or more cationic blocks (e.g. selected from a cationic polymer as mentioned above) and of one or more hydrophilic or hydrophobic blocks (e.g. polyethyleneglycole), etc.

[0321] In other embodiments, the composition is not associated with a cationic or polycationic compound.

[0322] Vaccines

[0323] In some embodiments, the composition can comprise a vaccine. In some embodiments, vaccines can be formulated in a nanoparticle described herein. In some embodiments, vaccines can be formulated in a lipid nanoparticle described herein. In some embodiments, vaccines canAttorney Docket No. 11538-009W01

[0324] be formulated in a lipid-polycation complex described herein, referred to as a cationic lipid nanoparticle. The vaccines of the disclosure can be formulated using one or more liposomes, lipoplexes, or lipid nanoparticles described herein. In some embodiments, pharmaceutical compositions of vaccines can include liposomes described herein. In some embodiments, the vaccines may be formulated in a lipid vesicle, which may have crosslinks between functionalized lipid bilayers. In some embodiments, the vaccines may be formulated in a lipid-polycation complex.

[0325] Methods of Administration

[0326] The compositions described herein can be administered to a subject by any suitable method and technique presently or prospectively known to those skilled in the art to treat or prevent HSV. For example, the active components described herein can be formulated in a physiologically- or pharmaceutically- acceptable form and administered by any suitable route known in the art including, for example, oral and parenteral routes of administering. As used herein, the term “parenteral” includes subcutaneous, intradermal, intravenous, intramuscular, intraperitoneal, and intrasternal administration, such as by injection. Administration of the active components of their compositions can be a single administration, or at continuous and distinct intervals as can be readily determined by a person skilled in the art.

[0327] “Excipients” include any and all solvents, diluents or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired. General considerations in formulation and / or manufacture can be found, for example, in Remington's Pharmaceutical Sciences, Sixteenth Edition, E. W. Martin (Mack Publishing Co., Easton, Pa., 1980), and Remington: The Science and Practice of Pharmacy, 21st Edition (Lippincott Williams & Wilkins, 2005).

[0328] Exemplary excipients include, but are not limited to, any non-toxic, inert solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type. Some examples of materials which can serve as excipients include, but are not limited to, sugars such as lactose, glucose, and sucrose; starches such as corn starch and potato starch; cellulose and its derivatives such as sodium carboxymethyl cellulose, ethyl cellulose, and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients such as cocoa butter and suppository waxes; oils such as peanut oil, cottonseed oil; safflower oil; sesame oil; olive oil; corn oil and soybean oil; glycols such as propylene glycol; esters such as ethyl oleate and ethyl laurate; agar; detergents such as Tween 80; buffering agents such as magnesium hydroxide and aluminumAttorney Docket No. 11538-009W01

[0329] hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; and phosphate buffer solutions, as well as other non-toxic compatible lubricants such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, releasing agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the composition, according to the judgment of the formulator. As would be appreciated by one of skill in this art, the excipients may be chosen based on what the composition is useful for. For example, with a pharmaceutical composition, the choice of the excipient will depend on the route of administration, the agent being delivered, time course of delivery of the agent, etc., and can be administered to humans and / or to animals, orally, rectally, parenterally, intracisternally, intravaginally, intranasally, intraperitoneally, topically (as by powders, creams, ointments, or drops), buccally, or as an oral or nasal spray. In some embodiments, the active compounds disclosed herein are administered topically.

[0330] Exemplary diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, etc., and combinations thereof.

[0331] Exemplary granulating and / or dispersing agents include potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross- linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, etc., and combinations thereof.

[0332] Exemplary surface active agents and / or emulsifiers include natural emulsifiers (e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g. bentonite [aluminum silicate] and Veegum [magnesium aluminum silicate]), long chain amino acid derivatives, high molecular weight alcohols (e.g. stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g. carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxy vinyl polymer), carrageenan, cellulosic derivatives (e.g.Attorney Docket No. 11538-009W01

[0333] carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g. polyoxyethylene sorbitan monolaurate [Tween 20], polyoxyethylene sorbitan [Tween 60], polyoxyethylene sorbitan monooleate [Tween 80], sorbitan monopalmitate [Span 40], sorbitan monostearate [Span 60], sorbitan tristearate [Span 65], glyceryl monooleate, sorbitan monooleate [Span 80]), polyoxyethylene esters (e.g. polyoxyethylene monostearate [Myrj 45], polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and Solutol), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g. Cremophor), polyoxyethylene ethers, (e.g. polyoxyethylene lauryl ether [Brij 30]), poly(vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic F 68, Poloxamer 188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, etc. and / or combinations thereof. Exemplary binding agents include starch (e.g. cornstarch and starch paste), gelatin, sugars (e.g. sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc. ), natural and synthetic gums (e.g. acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly( vinyl -pyrrolidone), magnesium aluminum silicate (Veegum), and larch arabogalactan), alginates, polyethylene oxide, polyethylene glycol, inorganic calcium salts, silicic acid, polymethacrylates, waxes, water, alcohol, etc., and / or combinations thereof.

[0334] Exemplary preservatives include antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, alcohol preservatives, acidic preservatives, and other preservatives.

[0335] Exemplary antioxidants include alpha tocopherol, ascorbic acid, ascorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and sodium sulfite.

[0336] Exemplary chelating agents include ethylenediaminetetraacetic acid (EDTA) and salts and hydrates thereof (e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like), citric acid and salts and hydrates thereof (e.g., citric acid monohydrate), fumaric acid and salts and hydrates thereof, malic acid and salts and hydrates thereof, phosphoric acid and salts and hydrates thereof, and tartaric acid and saltsAttorney Docket No. 11538-009W01

[0337] and hydrates thereof. Exemplary antimicrobial preservatives include benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and thimerosal.

[0338] Exemplary antifungal preservatives include butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and sorbic acid.

[0339] Exemplary alcohol preservatives include ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.

[0340] Exemplary acidic preservatives include vitamin A, vitamin C, vitamin E, beta- carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid. Other preservatives include tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluene (BITT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, GlydantPlus, Phenonip, methylparaben, Germall 115, Germaben II, NeoIone, Kathon, and Euxyl. In certain embodiments, the preservative is an anti¬ oxidant. In other embodiments, the preservative is a chelating agent.

[0341] Exemplary buffering agents include citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen- free water, isotonic saline, Ringer's solution, ethyl alcohol, etc., and combinations thereof.

[0342] Exemplary lubricating agents include magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, etc., and combinations thereof.Attorney Docket No. 11538-009W01

[0343] Exemplary natural oils include almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, chamomile, canola, caraway, carnauba, castor, cinnamon, cocoa buter, coconut, cod liver, coffee, corn, coton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea buckthorn, sesame, shea butter, silicone, soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut, and wheat germ oils. Exemplary synthetic oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and combinations thereof.

[0344] Additionally, the composition may further comprise a polymer. Exemplary polymers contemplated herein include, but are not limited to, cellulosic polymers and copolymers, for example, cellulose ethers such as methylcellulose (MC), hydroxyethylcellulose (HEC), hydroxypropyl cellulose (HPC), hydroxypropyl methyl cellulose (HPMC), methylhydroxyethylcellulose (MHEC), methylhydroxypropylcellulose (MHPC), carboxymethyl cellulose (CMC) and its various salts, including, e.g., the sodium salt, hydroxyethylcarboxymethylcellulose (HECMC) and its various salts, carboxymethylhydroxyethylcellulose (CMHEC) and its various salts, other polysaccharides and polysaccharide derivatives such as starch, dextran, dextran derivatives, chitosan, and alginic acid and its various salts, carageenan, various gums, including xanthan gum, guar gum, gum arabic, gum karaya, gum ghatti, konjac and gum tragacanth, glycosaminoglycans and proteoglycans such as hyaluronic acid and its salts, proteins such as gelatin, collagen, albumin, and fibrin, other polymers, for example, polyhydroxyacids such as polylactide, polyglycolide, polyl(lactide-co-glycolide) and poly(.epsilon.-caprolactone-co-glycolide)-, carboxyvinyl polymers and their salts (e.g., carbomer), polyvinylpyrrolidone (PVP), polyacrylic acid and its salts, polyacrylamide, polyacrylic acid / acrylamide copolymer, polyalkylene oxides such as polyethylene oxide, polypropylene oxide, polyethylene oxide- propylene oxide), and a Pluronic polymer, polyoxy¬ ethylene (polyethylene glycol), polyanhydrides, polyvinylalchol, polyethyleneamine and polypyrridine, polyethylene glycol (PEG) polymers, such as PEGylated lipids (e.g., PEG-stearate, l,2-Distearoyl-sn-glycero-3-Phosphoethanolamine-N-[Methoxy(Polyethylene glycol)-1000], l,2-Distearoyl-sn-glycero-3-Phosphoethanolamine-N-[Methoxy(Polyethylene glycol)-Attorney Docket No. 11538-009W01

[0345] 2000], and l,2-Distearoyl-sn-glycero-3-Phosphoethanolamine-N-[Methoxy(Polyethylene glycol)-5000]), copolymers and salts thereof.

[0346] Additionally, the composition may further comprise an emulsifying agent. Exemplary emulsifying agents include, but are not limited to, a polyethylene glycol (PEG), a polypropylene glycol, a polyvinyl alcohol, a poly-N-vinyl pyrrolidone and copolymers thereof, poloxamer nonionic surfactants, neutral water-soluble polysaccharides (e.g., dextran, Ficoll, celluloses), non-cationic poly(meth)acrylates, non-cationic polyacrylates, such as poly (meth) acrylic acid, and esters amide and hydroxy alkyl amides thereof, natural emulsifiers (e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g. bentonite [aluminum silicate] and Veegum [magnesium aluminum silicate]), long chain amino acid derivatives, high molecular weight alcohols (e.g. stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g. carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxy vinyl polymer), carrageenan, cellulosic derivatives (e.g. carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g. polyoxyethylene sorbitan monolaurate [Tween 20], polyoxyethylene sorbitan [Tween 60], polyoxyethylene sorbitan monooleate [Tween 80], sorbitan monopalmitate [Span 40], sorbitan monostearate [Span 60], sorbitan tristearate [Span 65], glyceryl monooleate, sorbitan monooleate [Span 80]), polyoxyethylene esters (e.g. polyoxyethylene monostearate [Myrj 45], polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and Solutol), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g. Cremophor), polyoxyethylene ethers, (e.g. polyoxyethylene lauryl ether [Brij 30]), poly( vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic F 68, Poloxamer 188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, etc. and / or combinations thereof. In certain embodiments, the emulsifying agent is cholesterol.

[0347] Liquid compositions include emulsions, microemulsions, solutions, suspensions, syrups, and elixirs. In addition to the active compound, the liquid composition may contain inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (inAttorney Docket No. 11538-009W01

[0348] particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Besides inert diluents, the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents.

[0349] Injectable compositions, for example, injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be an injectable solution, suspension, or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents for pharmaceutical or cosmetic compositions that may be employed are water, Ringer's solution, U. S. P. and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. Any bland fixed oil can be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables. In certain embodiments, the particles are suspended in a carrier fluid comprising 1% (w / v) sodium carboxymethyl cellulose and 0.1% (v / v) Tween 80. The injectable composition can be sterilized, for example, by filtration through a bacteria-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.

[0350] Compositions for rectal or vaginal administration may be in the form of suppositories which can be prepared by mixing the particles with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol, or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the particles.

[0351] Solid compositions include capsules, tablets, pills, powders, and granules. In such solid compositions, the particles are mixed with at least one excipient and / or a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, c) humectants such as glycerol, d) disintegrating agents such as agar- agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as paraffin, f) absorption accelerators such as quaternary ammonium compounds, g) wetting agents such as, for example, cetyl alcohol and glycerol monostearate, h) absorbents such as kaolin and bentonite clay, and i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, andAttorney Docket No. 11538-009W01

[0352] mixtures thereof. In the case of capsules, tablets, and pills, the dosage form may also comprise buffering agents. Solid compositions of a similar type may also be employed as fillers in soft and hard- filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.

[0353] Tablets, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They may optionally contain opacifying agents and can also be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes. Solid compositions of a similar type may also be employed as fillers in soft and hard- filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.

[0354] Compositions for topical or transdermal administration include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants, or patches. The active compound is admixed with an excipient and any needed preservatives or buffers as may be required.

[0355] The ointments, pastes, creams, and gels may contain, in addition to the active compound, excipients such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc, and zinc oxide, or mixtures thereof.

[0356] Powders and sprays can contain, in addition to the active compound, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates, and polyamide powder, or mixtures of these substances. Sprays can additionally contain customary propellants such as chlorofluorohydrocarbon s.

[0357] Transdermal patches have the added advantage of providing controlled delivery of a compound to the body. Such dosage forms can be made by dissolving or dispensing the nanoparticles in a proper medium. Absorption enhancers can also be used to increase the flux of the compound across the skin. The rate can be controlled by either providing a rate controlling membrane or by dispersing the particles in a polymer matrix or gel.

[0358] The compounds can be incorporated microparticles, nanoparticles, or combinations thereof that provide controlled release of the compounds and / or additional active agents. For example, the compounds can be incorporated into polymeric microparticles, which provide controlled release of the drug(s). Release of the drug(s) is controlled by diffusion of the drug(s) out of the microparticles and / or degradation of the polymeric particles by hydrolysis and / orAttorney Docket No. 11538-009W01

[0359] enzymatic degradation. Suitable polymers include ethylcellulose and other natural or synthetic cellulose derivatives.

[0360] Polymers, which are slowly soluble and form a gel in an aqueous environment, such as hydroxypropyl methylcellulose or polyethylene oxide, may also be suitable as materials for drug containing microparticles. Other polymers include, but are not limited to, polyanhydrides, poly(ester anhydrides), polyhydroxy acids, such as polylactide (PLA), polyglycolide (PGA), poly(lactide-co-glycolide) (PLGA), poly-3-hydroxybutyrate (PUB) and copolymers thereof, poly-4-hydroxybutyrate (P4HB) and copolymers thereof, poly caprolactone and copolymers thereof, and combinations thereof.

[0361] Alternatively, the compound can be incorporated into microparticles prepared from materials which are insoluble in aqueous solution or slowly soluble in aqueous solution, but are capable of degrading within the GI tract by means including enzymatic degradation, surfactant action of bile acids, and / or mechanical erosion. As used herein, the term “slowly soluble in water” refers to materials that are not dissolved in water within a period of 30 minutes. Preferred examples include fats, fatty substances, waxes, wax-like substances and mixtures thereof.

[0362] Suitable fats and fatty substances include fatty alcohols (such as lauryl, myristyl stearyl, cetyl or cetostearyl alcohol), fatty acids and derivatives, including but not limited to fatty acid esters, fatty acid glycerides (mono-, di- and tri-glycerides), and hydrogenated fats. Specific examples include, but are not limited to hydrogenated vegetable oil, hydrogenated cottonseed oil, hydrogenated castor oil, hydrogenated oils available under the trade name Sterotex®, stearic acid, cocoa butter, and stearyl alcohol. Suitable waxes and wax-like materials include natural or synthetic waxes, hydrocarbons, and normal waxes. Specific examples of waxes include beeswax, glycowax, castor wax, carnauba wax, paraffins and candelilla wax. As used herein, a wax-like material is defined as any material, which is normally solid at room temperature and has a melting point of from about 30 to 300° C.

[0363] In some cases, it may be desirable to alter the rate of water penetration into the microparticles. To this end, rate-controlling (wicking) agents may be formulated along with the fats or waxes listed above. Examples of rate-controlling materials include certain starch derivatives (e.g., waxy maltodextrin and drum dried corn starch), cellulose derivatives (e.g., hydroxypropylmethyl-cellulose, hydroxypropylcellulose, methylcellulose, and carboxymethylcellulose), alginic acid, lactose and talc. Additionally, a pharmaceutically acceptable surfactant (for example, lecithin) may be added to facilitate the degradation of such microparticles.Attorney Docket No. 11538-009W01

[0364] Proteins, which are water insoluble, such as zein, can also be used as materials for the formation of drug containing microparticles. Additionally, proteins, polysaccharides and combinations thereof, which are water-soluble, can be formulated with drug into microparticles and subsequently cross-linked to form an insoluble network. For example, cyclodextrins can be complexed with individual drug molecules and subsequently cross-linked.

[0365] Encapsulation or incorporation of drug into earner materials to produce drug-containing microparticles can be achieved through known pharmaceutical formulation techniques. In the case of formulation in fats, waxes or wax-like materials, the carrier material is typically heated above its melting temperature and the drug is added to form a mixture comprising drug particles suspended in the carrier material, drug dissolved in the carrier material, or a mixture thereof. Microparticles can be subsequently formulated through several methods including, but not limited to, the processes of congealing, extrusion, spray chilling or aqueous dispersion. In a preferred process, wax is heated above its melting temperature, drug is added, and the molten wax-drug mixture is congealed under constant stirring as the mixture cools. Alternatively, the molten wax-drug mixture can be extiuded and spheronized to form pellets or beads. These processes are known in the art.

[0366] For some carrier materials it may be desirable to use a solvent evaporation technique to produce drug -containing microparticles. In this case drug and carrier material are co-dissolved in a mutual solvent and microparticles can subsequently be produced by several techniques including, but not limited to, forming an emulsion in water or other appropriate media, spray drying or by evaporating off the solvent from the bulk solution and milling the resulting material.

[0367] In some embodiments, drug(s) in a particulate form is homogeneously dispersed in a water-insoluble or slowly water soluble material. To minimize the size of the drug particles within the composition, the drug powder itself may be milled to generate fine particles prior to formulation. The process of jet milling, known in the pharmaceutical art, can be used for this purpose. In some embodiments, drug in a particulate form is homogeneously dispersed in a wax or wax like substance by heating the wax or wax like substance above its melting point and adding the drug particles while stirring the mixture. In this case a pharmaceutically acceptable surfactant may be added to the mixture to facilitate the dispersion of the drug particles.

[0368] The particles can also be coated with one or more modified release coatings. Solid esters of fatty acids, which are hydrolyzed by lipases, can be spray coated onto microparticles or drug particles. Zein is an example of a naturally water-insoluble protein. It can be coated onto drugAttorney Docket No. 11538-009W01

[0369] containing microparticles or drug particles by spray coating or by wet granulation techniques. In addition to naturally water-insoluble materials, some substrates of digestive enzymes can be treated with cross-linking procedures, resulting in the formation of non-soluble networks. Many methods of cross-linking proteins, initiated by both chemical and physical means, have been reported. One of the most common methods to obtain cross-linking is the use of chemical cross¬ linking agents. Examples of chemical cross-linking agents include aldehydes (gluteraldehyde and formaldehyde), epoxy compounds, carbodiimides, and genipin. In addition to these cross¬ linking agents, oxidized and native sugars have been used to cross-link gelatin. Cross-linking can also be accomplished using enzymatic means; for example, transglutaminase has been approved as a GRAS substance for cross-linking seafood products. Finally, cross-linking can be initiated by physical means such as thermal treatment, UV irradiation and gamma irradiation.

[0370] To produce a coating layer of cross-linked protein surrounding drug containing microparticles or drug particles, a water-soluble protein can be spray coated onto the microparticles and subsequently cross-linked by the one of the methods described above.

[0371] Alternatively, drug-containing microparticles can be microencapsulated within protein by coacervation-phase separation (for example, by the addition of salts) and subsequently cross¬ linked. Some suitable proteins for this purpose include gelatin, albumin, casein, and gluten.

[0372] Polysaccharides can also be cross-linked to form a water-insoluble network. For many polysaccharides, this can be accomplished by reaction with calcium salts or multivalent cations, which cross-link the main polymer chains. Pectin, alginate, dextran, amylose and guar gum are subject to cross-linking in the presence of multivalent cations. Complexes between oppositely charged polysaccharides can also be formed; pectin and chitosan, for example, can be complexed via electrostatic interactions.

[0373] In certain embodiments, it may be desirable to provide continuous delivery of one or more compounds to a patient in need thereof. For intravenous or intraarterial routes, this can be accomplished using drip systems, such as by intravenous administration. For topical applications, repeated application can be done or a patch can be used to provide continuous administration of the compounds over an extended period of time.

[0374] The compounds described herein can be incorporated into injectable / implantable solid or semi-solid implants, such as polymeric implants. In one embodiment, the compounds are incorporated into a polymer that is a liquid or paste at room temperature, but upon contact with aqueous medium, such as physiological fluids, exhibits an increase in viscosity to form a semi¬ solid or solid material. Exemplary polymers include, but are not limited to, hydroxyalkanoic acidAttorney Docket No. 11538-009W01

[0375] polyesters derived from the copolymerization of at least one unsaturated hydroxy fatty acid copolymerized with hydroxyalkanoic acids. The polymer can be melted, mixed with the active substance and cast or injection molded into a device. Such melt fabrication require polymers having a melting point that is below the temperature at which the substance to be delivered and polymer degrade or become reactive. The device can also be prepared by solvent casting where the polymer is dissolved in a solvent and the drug dissolved or dispersed in the polymer solution and the solvent is then evaporated. Solvent processes require that the polymer be soluble in organic solvents. Another method is compression molding of a mixed powder of the polymer and the drug or polymer particles loaded with the active agent.

[0376] Alternatively, the compounds can be incorporated into a polymer matrix and molded, compressed, or extruded into a device that is a solid at room temperature. For example, the compounds can be incorporated into a biodegradable polymer, such as polyanhydrides, polyhydroalkanoic acids (PHAs), PLA, PGA, PLGA, polycaprolactone, polyesters, polyamides, polyorthoesters, polyphosphazenes, proteins and polysaccharides such as collagen, hyaluronic acid, albumin and gelatin, and combinations thereof and compressed into solid device, such as disks, wafers, or extruded into a device, such as rods.

[0377] The release of the compounds from the implant can be varied by selection of the polymer, the molecular weight of the polymer, and / or modification of the polymer to increase degradation, such as the formation of pores and / or incorporation of hydrolyzable linkages. Methods for modifying the properties of biodegradable polymers to vary the release profile of the compounds from the implant are well known in the art.

[0378] In some embodiments, the compounds or pharmaceutical compositions can be administered locally. In some embodiments, the compounds are incorporated in a delivery system such as gels, nanoparticles, microparticles, or implants such as (e.g., rods, discs, wafers, orthopedic implants) for sustained release. In some embodiments, the compounds can be administered using a local delivery implantable system comprising the compounds incorporated within a gel, nanoparticles, microparticles, or an implant. In some embodiments, the pharmaceutical compositions comprise a delivery system such as gels, nanoparticles, microparticles, or implants such as (e.g., rods, discs, wafers, orthopedic implants) for sustained release of paroxetine or a pharmaceutically acceptable salt or derivative thereof.

[0379] The active ingredient may be administered in such amounts, time, and route deemed necessary in order to achieve the desired result. The exact amount of the active ingredient will vary from subject to subject, depending on the species, age, and general condition of the subject,Attorney Docket No. 11538-009W01

[0380] the severity of the infection, the particular active ingredient, its mode of administration, its mode of activity, and the like. The active ingredient, whether the active compound itself, or the active compound in combination with an agent, is preferably formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the active ingredient will be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective dose level for any particular subject will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the active ingredient employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific active ingredient employed; the duration of the treatment; drugs used in combination or coincidental with the specific active ingredient employed; and like factors well known in the medical arts.

[0381] The active ingredient may be administered by any route. In some embodiments, the active ingredient is administered via a variety of routes, including oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, interdemial, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and / or drops), mucosal, nasal, bucal, enteral, sublingual; by intratracheal instillation, bronchial instillation, and / or inhalation; and / or as an oral spray, nasal spray, and / or aerosol. In general, the most appropriate route of administration will depend upon a variety of factors including the nature of the active ingredient (e.g., its stability in the environment of the gastrointestinal tract), the condition of the subject (e.g., whether the subject is able to tolerate oral administration), etc.

[0382] The exact amount of an active ingredient required to achieve a therapeutically or prophylactically effective amount will vary from subject to subject, depending on species, age, and general condition of a subject, severity of the side effects or disorder, identity of the particular compound(s), mode of administration, and the like. The amount to be administered to, for example, a child or an adolescent can be determined by a medical practitioner or person skilled in the art and can be lower or the same as that administered to an adult.

[0383] Useful dosages of the compositions disclosed herein can be determined by comparing their in vitro activity, and in vivo activity in animal models. Methods for the extrapolation of effective dosages in mice, and other animals, to humans are known to the art.

[0384] The dosage ranges for the administration of the compositions are those large enough to produce the desired effect in which the symptoms or disorder are affected. The dosage shouldAttorney Docket No. 11538-009W01

[0385] not be so large as to cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. Generally, the dosage will vary with the age, condition, sex and extent of the disease in the patient and can be determined by one of skill in the art. The dosage can be adjusted by the individual physician in the event of any counterindications. Dosage can vary, and can be administered in one or more dose administrations daily, for one or several days.

[0386] Compositions described herein are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily¬ usage of compositions may be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective, prophylactically effective, or appropriate imaging dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.

[0387] In some embodiments, the compositions may be administered at dosage levels sufficient to deliver 0.0001 mg / kg to 100 mg / kg, 0.001 mg / kg to 0.05 mg / kg, 0.005 mg / kg to 0.05 mg / kg, 0.001 mg / kg to 0.005 mg / kg, 0.05 mg / kg to 0.5 mg / kg, 0.01 mg / kg to 50 mg / kg, 0.1 mg / kg to 40 mg / kg, 0.5 mg / kg to 30 mg / kg, 0.01 mg / kg to 10 mg / kg, 0.1 mg / kg to 10 mg / kg, or 1 mg / kg to 25 mg / kg, of subject body weight per day, one or more times a day, per week, per month, etc. to obtain the desired therapeutic and / or prophylactic effect (see, e.g., the range of unit doses described in International Publication No WO2013078199, the contents of which are herein incorporated by reference in their entirety). The desired dosage may be delivered three times a day, two times a day, once a day, every other day, every third day, every week, every two weeks, every three weeks, every four weeks, every 2 months, every three months, every 6 months, etc. In some embodiments, the desired dosage may be delivered using multiple administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations). When multiple administrations are employed, split dosing regimens such as those described herein may be used. In exemplary embodiments, compositions may be administered at dosage levels sufficient to deliver 0.0005 mg / kg to 0.01 mg / kg, e.g., about 0.0005 mg / kg to about 0.0075 mg / kg, e.g., about 0.0005 mg / kg, about 0.001 mg / kg, about 0.002 mg / kg, about 0.003 mg / kg, about 0.004 mg / kg or about 0.005 mg / kg.Attorney Docket No. 11538-009W01

[0388] In some embodiments, the compositions may be administered once or twice (or more) at dosage levels sufficient to deliver 0.025 mg / kg to 0.2.50 mg / kg, 0.025 mg / kg to 0.500 mg / kg, 0.025 mg / kg to 0.750 mg / kg, or 0.025 mg / kg to 1.0 mg / kg.

[0389] In some embodiments, the compositions may be administered twice (e.g., Day 0 and Day 7, Day 0 and Day 14, Day 0 and Day 21, Day 0 and Day 28, Day 0 and Day 60, Day 0 and Day- 90, Day 0 and Day 120, Day 0 and Day 150, Day 0 and Day 180, Day 0 and 3 months later, Day 0 and 6 months later, Day 0 and 9 months later, Day 0 and 12 months later, Day 0 and 18 months later, Day 0 and 2 years later, Day 0 and 5 years later, or Day 0 and 10 years later) at a total dose of or at dosage levels sufficient to deliver a total dose of 0.0100 mg, 0.025 mg, 0.050 mg, 0.075 mg, 0.100 mg, 0.125 mg, 0.150 mg, 0.175 mg, 0.200 mg, 0.225 mg, 0.250 mg, 0.275 mg, 0.300 mg, 0.325 mg, 0.350 mg, 0.375 mg, 0.400 mg, 0.425 mg, 0.450 mg, 0.475 mg, 0.500 mg, 0.525 mg, 0.550 mg, 0.575 mg, 0.600 mg, 0.625 mg, 0.650 mg, 0.675 mg, 0.700 mg, 0.725 mg, 0.750 mg, 0.775 mg, 0.800 mg, 0.825 mg, 0.850 mg, 0.875 mg, 0.900 mg, 0.925 mg, 0.950 mg, 0.975 mg, or 1.0 mg. Higher and lower dosages and frequency of administration are encompassed by the present disclosure. For example, a composition described herein may be administered three or four times.

[0390] In some embodiments, the compositions may be administered twice (e.g., Day 0 and Day 7, Day 0 and Day 14, Day 0 and Day 21, Day 0 and Day 28, Day 0 and Day 60, Day 0 and Day-90, Day 0 and Day 120, Day 0 and Day 150, Day 0 and Day 180, Day 0 and 3 months later, Day 0 and 6 months later, Day 0 and 9 months later, Day 0 and 12 months later, Day 0 and 18 months later, Day 0 and 2 years later, Day 0 and 5 year's later, or Day 0 and 10 years later) at a total dose of or at dosage levels sufficient to deliver a total dose of 0.010 mg, 0.025 mg, 0.100 mg or 0.400 mg.

[0391] In some embodiments, the composition (e.g., vaccine) for use in a method of vaccinating a subject is administered to the subject as a single dosage of between 10 pg / kg and 400 pg / kg of the nucleic acid vaccine (in an effective amount to vaccinate the subject). In some embodiments, the composition (e.g., vaccine) for use in a method of vaccinating a subject is administered to the subject as a single dosage of between 10 pg and 400 pg of the nucleic acid vaccine (in an effective amount to vaccinate the subject). In some embodiments, a composition (e.g., vaccine) for use in a method of vaccinating a subject is administered to the subject as a single dosage of 25-1000 pg (e.g., a single dosage of each nucleic acid present in the composition). In some embodiments, a composition (e.g., vaccine) is administered to the subject as a single dosage of 25, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950Attorney Docket No. 11538-009W01

[0392] or 1000 pg. For example, a composition (e.g., vaccine) may be administered to a subject as a single dose of 25-100, 25-500, 50-100, 50-500, 50-1000, 100-500, 100-1000, 250-500, 250-1000, or 500-1000 pg. In some embodiments, a composition (e.g., vaccine) for use in a method of vaccinating a subject is administered to the subject as two dosages, the combination of which equals 25-1000 pg of the composition (e.g., vaccine).

[0393] A composition (e.g., vaccine pharmaceutical composition) described herein can be formulated into a dosage form described herein, such as an intranasal, intratracheal, or injectable (e.g., intravenous, intraocular, intravitreal, intramuscular, intradermal, intracardiac, intraperitoneal, and subcutaneous).

[0394] Methods of Use

[0395] Described herein are methods of treating or preventing HPV in a subject, the method including administering to the subject a therapeutically effective amount of the compositions described herein or the nucleic acids described herein.

[0396] Described herein are methods of treating HPV -related cervical intraepithelial neoplasia (CIN) (e.g., CIN 1-3, CIN 2-3) in a subject, the method including administering to the subject a therapeutically effective amount of the compositions described herein or the nucleic acids described herein.

[0397] Described herein are methods for reducing a risk of recurrence of a pre-cancerous or cancerous growth in a subject infected with HPV who has been treated for the growth, the method including administering to the subject a therapeutically effective amount of the compositions described herein or the nucleic acids described herein.

[0398] Described herein are methods of treating cervical cancer in a subject, the method including administering to the subject a therapeutically effecti ve amount of the compositions described herein or the nucleic acids described herein.

[0399] Described herein are methods of treating an HPV-related cancer in a subject, the method including administering to the subject a therapeutically effective amount of the compositions described herein or the nucleic acids described herein.

[0400] Described herein the methods of treating recurrent respiratory papillomatosis (RRP) in a subject, the method comprising administering to the subject a therapeutically effective amount of the compositions described herein or the nucleic acids described herein.

[0401] In some embodiments, the methods can further include administering an additional active agent. In some embodiments, the additional active agent.Attorney Docket No. 11538-009W01

[0402] As used herein, an “active agent” refers to therapeutic agents, diagnostic agents, or prophylactic agents. As discussed herein, the therapeutic agents can be released from the disclosed compounds, compositions, and systems in a biologically active form.

[0403] In some embodiments, the methods described herein can further include administering an immune checkpoint inhibitor (CPI) to the subject. Suitable immune checkpoint inhibitors include, but are not limited to, PD-1 inhibitors (e.g., pembrolizumab, nivolumab, cemiplimab), PD-L1 inhibitors (e.g., atezolizumab, durvalumab, avelumab), CTLA-4 inhibitors (e.g., ipilimumab, tremelimumab), and LAG-3 inhibitors (e.g., relatlimab).

[0404] In some embodiments, the methods described herein can further include administering an immune response modifier to the subject. Suitable immune response modifiers can include, but are not limited to TLR agonists such as TLR7 agonists (e.g., imiquimod, resiquimod, vesatolimod), TLR8 agonists (e.g., selgantolimod), TLR3 agonists (e.g., poly(I: C), poly-lCLC), TLR4 agonists (e.g., monophosphoryl lipid A, GLA-SE), TLR9 agonists (e.g., CpG oligodeoxynucleotides, tilsotolimod); STING agonists (e.g., cyclic di nucleotides, ADU-S100); RIG-I agonists; interferons (e.g., interferon-alpha, interferon-gamma); interleukins (e.g., IL-2, IL- 12, IL-15); and colony-stimulating factors (e.g., GM-CSF).

[0405] Reference will now be made in detail to specific aspects of the disclosed materials, compounds, compositions, articles, and methods, examples of which are illustrated in the accompanying Examples and Figures.

[0406] All of the compositions and methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this disclosure have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and methods and in the steps or in the sequence of steps of the methods described herein without departing from the concept, spirit and scope of the disclosure. More specifically, it will be apparent that certain agents which are both chemically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the disclosure as defined by the appended claims.

[0407] By way of non-limiting illustration, examples of certain embodiments of the present disclosure are given below.Attorney Docket No. 11538-009W01

[0408] EXAMPLES

[0409] Described herein are mRNA-based vaccine compositions for the treatment of HPV- related CIN1-3 and cancers. These vaccines encode mRNA for several antigens derived from high-risk HPV strains and the SARS-CoV-2 spike protein, with the goal of eliciting both an immune response and therapeutic effects.

[0410] The vaccine compositions can include mRNA that encodes for the HPV 16 E6 and E7 proteins or variants or fragments thereof, which are believed to be important for the persistence of HPV infections and the development of cervical cancer. Additionally, the vaccine compositions can include mRNA that encodes for the S2 subdomain of the SARS-CoV-2 spike protein, which is incorporated to stimulate spike-specific memory T cells. These memory T cells entrance the specific T cell response to HPV antigens, particularly in the context of the lesion sites, improving immune infiltration and targeting infected cells. In some embodiments, these can be linked so as to produce upon translation a fusion protein comprising a first portion comprising an HPV 16 E6 protein or a variant or fragment thereof, a second portion comprising an HPV 16 E7 protein or a variant or fragment thereof, and a third portion comprising the S2 subdomain of the SARS-CoV-2 spike protein.

[0411] The vaccine compositions can optionally further include mRNA(s) that encode for one or more additional HPV antigens from other high-risk HPV (HR-HPV) strains, such as HPV 18, 31, and / or other high-risk strains (HPV 33, 35, 51, 52), to create apan-HPV therapeutic vaccine effective against a broad spectrum of HR-HPV strains. Such vaccines can provide an effective immune response against all major high-risk HPV types, thereby offering therapeutic benefits for both CIN2-3 and cervical cancer.

[0412] The vaccine can be used as a standalone treatment for HPV -related CIN1-3 or in combination with other therapies, such as imiquimod or checkpoint inhibitors (CPI) for both GIN and cervical cancer treatment.

[0413] Accordingly, described herein are vaccine compositions that include nucleic acids (e.g., mRNA) encoding the following: (1) the E6 protein of HPV (e.g., the E6 protein of HPV 16), containing specific mutations (e.g., F9V, C70G, and I135T) that inhibit its oncogenic potential. These mutations prevent E6 from promoting the degradation of tumor suppressor proteins such as p53, which play a crucial role in cellular tumor suppression; (2) the E7 protein of HPV (e.g., the E7 protein of HPV 16), engineered with mutations (e.g., H2P, C24G, and E26G) that disable its ability to bind to the retinoblastoma protein (Rb) and disrupt cell cycle regulation, effectively reducing its oncogenic activity; and (3) a subdomain of SARS-CoV-2 spike protein (e.g., the S2Attorney Docket No. 11538-009W01

[0414] subdomain of SARS-CoV-2 spike protein), which enhances the activation of spike-specific memory T cells, which can enhance the immune response against the tumor and infected cells.

[0415] In some embodiments, these can be linked so as to produce upon translation a fusion protein comprising a first portion comprising an HPV 16 E6 protein or a variant or fragment thereof, a second portion comprising an HPV 16 E7 protein or a variant or fragment thereof, and a third portion comprising the S2 subdomain of the SARS-CoV-2 spike protein.

[0416] Optionally, the composition can further include nucleic acids encoding additional antigens, such as one or more the following:

[0417] HPV antigens from Other High-Risk HPV Strains: These include HPV 18, HPV 31, and other high-risk strains (HPV 33, 35, 51, 52), with the goal of eliciting broad immunity against multiple HPV types that contribute to CIN and cervical cancer; and / or

[0418] HPV antigens other than E6 and E7: These include LI and E2, with the goal of induction of neutralizing antibodies for preventing reinfection and board T cell immunity against HPV persistent infection due to high expression of E2 and / or LI viral proteins.

[0419] The vaccine composition can deliver the nucleic acids (e.g., mRNA) into cells within the body of a subject, where it is translated into the respective proteins (e.g., HPV E6, HPV E7, and SARS-CoV-2 Spike S2). This induces an immune response, including the activation of CD4+ T cells (helper T cells) and CD8+ T cells (cytotoxic T cells). The CD4+ T cells assist in coordinating the immune response, while CD8+ T cells target and destroy infected or transformed cells expressing the HPV E6 and E7 antigens.

[0420] The inclusion of the S2 subdomain of the SARS-CoV-2 spike protein in the vaccine is particularly important for the activation of memory T cells. These memory T cells, especially memory CD4 T cells, can promote HPV-specific CD8 T cell activation, infiltrating into the lesion sites or tumor tissues, and formation of HPV-specific memory T cells that can provide persistent long-term effect to HPV-related diseases.

[0421] The vaccine compositions described herein can offer many advantages:

[0422] The vaccine can induce a targeted immune response against key HPV oncoproteins (E6 and E7), which are directly responsible for CIN, cervical cancer, and other HPV associated cancers’ progression. The inclusion of antigens from multiple high-risk HPV types provides a broad-spectrum vaccine that is effective against a variety of HPV strains, reducing the likelihood of treatment failure due to strain variation. The incorporation of SARS-CoV-2 S2 subdomain in the vaccine enhances the ability of memory T cells to infiltrate lesion sites, increasing the efficiency of immune-mediated destruction of HPV-infected cells. The vaccines described hereinAttorney Docket No. 11538-009W01

[0423] can be administered alone or in combination with other therapies such as imiquimod (a topical immune response modifier) or checkpoint inhibitors (including blocker for PD1-PDL1, CTLA4 etc.), offering potential synergy in treatment outcomes.: The vaccines described herein can also encodes viral proteins that are facilitate entry of host cells, such as LI, L2 etc, both T cell and antibodies responses will be important to reach functional cure of HPV infection and related disease and more importantly to prevent reinfection / relapse.

[0424] The vaccines described herein can be administered via multiple routes such as intradermal, intramuscular injection. The optimal dosing schedule and number of doses can be determined via clinical testing, but it is anticipated that the vaccines will be administered as a series of injections to achieve the desired immune response.

[0425] The vaccines described herein can be administered to subjects in need thereof for a variety of potential applications:

[0426] The vaccines described herein can be used to treat patients with HPV -related CIN1-3, by targeting and eliminating the infected cells and preventing progression to cervical cancer.

[0427] The vaccines described herein may also be used as an adjunct therapy for HPV-related cancers, including cervical carcinoma, head and neck tumor and other related cancers, particularly when combined with immune checkpoint inhibitors or other therapies.

[0428] The vaccines described herein, in particular the broad spectrum compositions described herein including additional High-Risk HPVs, may provide an effective solution to combating HPV-related diseases, not just for CIN and cervical cancer but also for other HPV-associated cancers.

[0429] The vaccines described herein can be used to treat patients with RRP caused by HPV infections in the respiratory tract, which may cause respiratory diseases such as hoarseness or voice changes, difficulty breathing and coughing etc, also it involves benign growths in the larynx and other parts of the airway. Figure 4 illustrates the design, production, and validation of an example HPV vaccine described herein.

[0430] The vaccine compositions described herein represent a promising approach to the treatment of HPV-related diseases, including CIN1-3 and cervical cancer. By utilizing mRNA technology to encode for key HPV oncoproteins and incorporating a SARS-CoV-2 spike protein subdomain to enhance immune responses, these vaccines offers significant potential as a therapeutic option, particularly when combined with other treatments like imiquimod and checkpoint inhibitors.Attorney Docket No. 11538-009W01

[0431] Design of pan-mRNA-5 and pan-mRNA-6 HPV multivalent therapeutic vaccines and representative data of Pan-mRNA-5 in vitro and in vivo.

[0432] Pan-mRNA-5 encodes oncoproteins E6 and E7 from HPV types 31, 52, and 18, while pan-mRNA-6 encodes E6 and E7 from HPV types 1, 35, and 33. All oncoproteins contain inactivating mutations to eliminate transforming activity while maintaining immunogenicity. Constructs are designed as polyproteins with removed internal stop codons and codon-optimized sequences for enhanced expression. See Figure 1.

[0433] In vitro validation of pan-mRNA-5 therapeutic vaccine is shown in Figure 2.

[0434] C57BL / 6 mice (n=5 per group) were immunized intradermally with 5 pg pan-mRNA- 5 / LNP on days 0 and 14. Seven days after the final immunization (day 21), splenocytes were harvested and antigen-specific T cell responses were measured by IFN-y ELISPOT assay using HPV31-E6 and HPV18-E7 peptide pools. Data represent mean + SEM spot-forming units (SFU) per 106splenocytes. Statistical analysis was performed using unpaired t-test. ***P < 0.001 compared to control. See Figure 3.

[0435] Table 1. List of example nucleotide sequences suitable for the preparation of vaccines described herein.

[0436] _ Example Nucleotide Sequences for the Preparation of HPV Vaccines _ SEQ. ID. NO. 1 i Encoding for HPV-16 E6 _ ATGCACCAGAAACGGACGGCCATGGTCCAGGATCCGCAGGAGAGGCCTAGGAAG CTTCCACAACTCTGTACTGAGTTACAGACAACCATCCATGACATAATACTGGAATG TGTATACTGCAAGCAGCAGCTACTGAGACGGGAAGTCTACGACTTCGCTTTTCGG GACCTATGTATCGTGTATAGAGACGGTAACCCCTACGCGGTGGGAGATAAGTGCC TGAAGTTCTATTCGAAGATCAGTGAGTACCGTCACTACTGTTACAGCCTCTAcGGT ACAACCCTGGAACAGCAATACAATAAACCCCTGTGTGACCTTCTCATCCGGTGCA TCAATTGCCAGAAGCCTCTCTGTCCAGAGGAAAAACAGCGACATCTGGACAAGAA ACAAAGGTTCCACAATACTCGAGGGCGCTGGACGGGGAGATGCATGTCATGCTGC AGATCATCCCGCACTAGACGCGAAACCCAGCTC _

[0437] SEQ. ID. NO. 2 | Encoding for HPV-16 E7 _ ATGCCCGGCGACACCCCTACTTTGCACGAGTATATGCTGGATTTACAACCTGAGAC AACAGATCTTTATGGGTACGGACAACTGAACGACTCTAGCGAGGAAGAAGATGA GATTGATGGCCCAGCCGGCCAGGCCGAGCCGGATAGGGCACATTATAACATTGTT ACCTTTTGCTGTAAATGtGACAGTACACrGCGCTrGTGCGrGCAGAGCACCCACGT GGATATCAGGACATTGGAGGACCTCCTGATGGGCACCCTGGGAATTGTCTGCCCC ATTTGTTCCCAGAAACCA _

[0438] SEQ. ID. NO. 3 _ i Encoding for S2 Subdomain of SARS-CoV-2 Spike Protein _ CTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGA CCGTGCTGCCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCT GTTAGCCGGAACaATCACCAGCGGCTGGACTTTCGGCGCTGGAGCCGCTCTGCAG ATCCCCTrCGCtATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAA CGTGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGC

[0439]

[0440] AAGATCCAGGACAGCCTGAGCAGCACCGCTAGCGCCCTGGGCAAGCTGCAGGACAtorney Docket No. 11538-009W01

[0441] GTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAGC AACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTC CCGAGGCCGAGGTGCAGATCGACCGGCTGATCACTGGCCGGCTGCAGAGCCTGCA GACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGCGCCAAC CTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAG SEQ. ID. NO. 4 Encoding for pan-mRNA5 (HPV31-E6 / E7-HPV52-E6-E7- HPV18-E6-E7) ATGGTCAAGAATCCCGCCGAGCGGCCCAGAAAGCTGCACGAACTTAGCAGCGCCC TGGAAATCCCCTACGACGAGCTGAGACTGAACTGCGTGTACTGTAAAGGCCAGCT GACCGAGACAGAGGTGCTGGACTTCGCCITTACCGACCTGACCATCGTGTACAGG GACGACACACCTrACGGCGTGGGCACCAAGTGCCTGCGGTTCTACAGCAAGGTGT CCGAGTTTCGGTGGTACAGATACTCTGTGTACGGCACCACACTCGAGAAGCTCAC AAACAAGGGCATCTGCGATCTGCTCATCCGCTGCATCACCTGTCAGAGGCCCCTGT GTCCTGAGGAAAAGCAGAGGCACCTGGACAAGAAGAAGCGCTTTCACAATACCG GCGGCAGATGGACCGGCAGATGCATCGTTTGTTGGCGGAGGCCCAGAACCGAGAC ACAAGTCATGCCTGGCGAAACACCCACTCTGCAGGATIACGTGCTGGATCTGCAG CCCGAGGCCACCGATCTGTATGGCTATGGACAGCTGCCCGACAGCAGCGACGAGG AAGATGTGATCGATTCTCCTGCCGGCCAGGCCAAGCCTGACACCAGCAACTACAA TATCGTGACCTTCTGCTGTCAGTGCGAGAGCACCCTGAGACTGTGTGTGCAGAGC ACACAGGTGGACATCCGGATCCTGCAAGAGCTGCTGATGGGCTCCTTCGGCATCG TGTGCCCTAACTGCAGCACCAGACTGATGGTCGAGGACCCCGCCACCAGACCTAG AACACTGCATGAACTCTGTGAAGTGCTGGAAGAGAGCGTGCACGAGATTCGGCTG CAGTGTGTCCAGTGCAAGAAAGAACTGCAGCGGCGGGAAGTGTACAAGTTCCTGT TCACCGACCTGCGGATTGTCTACAGAGACAACAATCCATACGGCGTCGGGATTAT GTGTCTGCGCTnCTGTCCAAGATCTCCGAGTACAGACACTACCAGTACAGCCTGT ACGGAAAGACCCTCGAGGAAAGAGTGCGGAAGCCCCTGAGCGAAATCACCATCC GGTGCATTATTTGTCAGACCCCTCTGTGCCCAGAAGAAAAAGAAAGACACGTGAA CGCTAACAAGCGCTTCCATAACACCATGGGCCGGTGGACTGGAAGGTGCTCTGAA TGTTGGCGGCCCAGGCCTGTGACACAGGTGATGCCCGGCGATAAGGCCACCATCA AGGACTACATCCTGGACCTCCAGCCTGAGACAACCGACCTGCATGGATACGGCCA ACTGGGCGACTCTAGCGACGAAGAGGATACCGATGGCGTGGACCGTCCAGATGG ACAAGCCGAGCAGGCCACCAGCAAlTAlTACATrGTGACCTACTGTCACTCCTGTG ATAGCACACTGAGGCTGTGCATCCACTCCACCGCCACAGATCTGAGAACCCTGCA ACAGATGCTGCTGGGGACCCTGCAGGTTGTCTGTCCTGGTTGTGCCAGACTGATGG CCAGAGTGGAAGATCCCACCAGACGGCCCTACAAGCTGCCTGATCTGTGCACCGA GCTGAACACCAGCCTGCAGGACATCGAGATCACCTGTGTGTACTGCAAGACCGTG CTGGAACTGACCGAGGTGTTCGAGTTCGCCTTCAAGGACCTGTTCGTGGTGTACCG GGACAGCATTCCTCATGCCGCCGGACACAAGTGCATCGACTTCTACAGCCGGATC AGAGAGCTGCGGCACrACAGCGATAGCGTGI’ACGGCGACACCCTGGAAAAGCTG ACCAACACCGGCCTGTACAACCTGCTGATCCGGTGCCTGAGATGCCAGAAGCCTC TGAACCCTGCCGAGAAGCTGAGACACCTGAACGAGAAGCGGCGGTTCCACAACA CAGCCGGCCACTATAGAGGCCAGTGCCACAGCTGCTGCAACCGGGCCAGACAAG AGAGACTTCAGCGGCGGAGAGAAACCCAAGTGATGCCTGGACCTAAGGCCACAC TGCAGGACATCGTGCTGCACCTGGAACCTCAGAACGAGATCCCCGTGGATCTGCT CGGACATGGCCAGCTGAGCGATAGCGAGGAAGAGAACGACGAGATCGACGGCGT GAACCACCAGCATCTGCCTGCCAGAAGGGCCGAACCACAGAGACACACCATGCT GTGCATGTGCTGCAAGTGCGAGGCCAGAATCGAGCTGGTGGTGGAAAGCAGCGCC GACGATCTGAGAGCCTrCCAGCAGCTGTI’CCTGAACACCCTGAGClTCGTGTGTCC

[0442]

[0443] TTGGTGCGCCTCTCAGCAGAtorney Docket No. 11538-009W01

[0444] SEQ. ID. NO, 5 Encoding for pan-mRNA6 (HPV51-E7 / E6-HPV35-E7-E6- _ HPV33-E7-E6) _ ATGCCCGGAAATGTGCCCCAGCTGAAGGACGTGGTCCTGCATCTGACACCCCAGA CAGAGATCGACCTGCAAGGCTATGGCCAGTTCGACAGCTCTGAGGAAGAGGACG AGGTCGACAACATGCGGGATCAGITGCC TGAGCGGAGAGCCGGAC AGGCC ACC T GTTATAGAATCGAGGCCCCTTGCTGCCGGTGCAGCTCTGTTGTTCAGCTGGCTGTG GAATCCAGCGAGGACAACCTGAGAGTGGTGCAGCAAATGTTGATGGGCGAGCTGT CCCTTGTGTGTCCCTGCTGTGCCAACAACATGGTGGAAGATAAGAGAGAGAGGCC CAGGACTCTGCATGAGCTGTGCGAAGCCCTGAACGTGTCCATGCACAATATCCAG GTCGTGTGCGTCTACTGCAAGAAAGAGCTGTGCAGAGCCGACGTGTACAACGTGG CCTTCACCGAGATCAAGATCGTGTATCGGGACAACAACCCCTATGCCGTGGGCAA GCAGTGCCTGCTGTTTTACTCCAAGATCCGGGAATATCGGCGGTACAGCAGATCC GTGTACGGAACAACTCTGGAAGCCATCACCAAGAAGTCTCTGTACGATCTGCTGA TTAGGTGCCACCGGTGCCAGAGGCCACTGGGACCTGAAGAGAAACAGAAACTGG TGGACGAGAAGAAAAGGTTCCACGAAACCGCCGGAAGGTGGACAGGCCAGTGTG CTAATTGCTGGCAGCGGACCCGGCAGCGGAATGAGACTCAAGTTATGCCTGGCGA GATCACCACACTGCAGGACTACGTGCTGGACCTGGAACCTGAGGCCACCGATCTG TATGGCTACGGCCAGCTGTGCGACAGCAGCGAGGAAGAAGAGGATACCATCGAC GGACCTGCCGGACAGGCCAAGCCTGACACCAGCAACTACAACATCGTGACCAGCT GCTGCAAGTGCGAGGCCACACTGAGACTGTGTGTGCAGAGCACCCACATCGACAT CCGGAAGCTGGAAGATCTGCTGATGGGCACCTTCGGCATCGTGTGTCCTGGCrGT AGCCAGAGAGCTATGGTGCAGGACCCTGCCGAAAGACCCTACAAGCTGCACGACC TGTGCAACGAGGTGGAAGAGAGCATCCACGAGATCTGCCTGAACTGCGTGTACTG CAAGCAAGAGCTGCAGCGGAGCGAGGTGTACGACTTCGCCTGCTACGATCTGTGC ATCGTGTACAGAGAGGGCCAGCCTTACGGCGTGGGCATGAAGTGCCTGAAGTTCT ACAGCAAGATCAGCGAGTACCGGTGGTACAGATACAGCGTGTACGGCGAGACAC TGGAAAAGCAGTGCAACAAGCAGCTGTGCCATCTGCTGATCCGGTGCATCACCTG TCAGAAACCrCTGrGCCCCGrGGAAAAACAGCGGCACCrGGAAGAGAAGAAGCG GTTCCAC AA TACCGGCGGCAGATGGACCGGC AGATGC ATGTC TTGC TGGAAGCCC ACCAGACGGGAAACCGAAGTTATGCCAGGCCACAAGCCTACACTGAAAGAGTAT GTCCTGGATCTGTACCCTGAGCCTACAGACCTGTACGGCTACGGCCAGCTGTCTGA TAGCTCCGACGAGGACGAAGGCCTGGACAGACCTGATGGACAGGCTCAGCCTGCC ACCGCCGATTACTACATCGTGACATGCTGCCACACCTGTAACACCACCGTGCGGCT GTGTGTGAATAGCACCGCCAGCGACCTGAGGACC ATCCAGCAACTGC TC ATGGGC ACCGTGAACATTGTG TGCCCCAC A TGCGC AC AGCTGA TGGTGC AGGACACCGAAG AAAAGCCCCGGACACTGCACGATCTGTGTCAGGCTCTGGAAACCACCATCCACAA CATCGAGCTGCAGTGCGTGGAATGCAAGAACCCTCTGCAGCGGAGCGAGGTGTAC GACTTTGCCTTTGCTGATCTGACAGTGGTGTACAGAGAGGGCAACCCCTTCGGCAT CGGCAAGCTGTGTCTGAGATTCCTGAGCAAGATCAGCGAGTACCGCCACTACAAC TACTCCGTGTATGGACACACACTGGAACAGACCGTGAAGAAGCCCCTCAACGAGA TCCTGATTCGGTGTATCATCTGCCAGCGACCACTGTGCCCTCAAGAGAAGAAACG GCACGTGGACCTGAACAAGAGGTTTCACAACACCTCCGGACGCTGGGCCGGAAGA TGTGCTGC1TGTTGGCGCTCTAGACGGCGGGAAACAGCCCTG _

[0445] SEQ. ID. NO. 6 _ i Encoding for HPV-31-E6 _ ATGGTCAAGAATCCCGCCGAGCGGCCCAGAAAGCTGCACGAACTTAGCAGCGCCC TGGAAATCCCCTACGACGAGCTGAGACTGAACTGCGTGTACTGTAAAGGCCAGCT GACCGAGACAGAGGTGCTGGACTTCGCCTTTACCGACCTGACCATCGTGTACAGG GACGACACACCTTACGGCGTGGGCACCAAGTGCCTGCGGTTCTACAGCAAGGTGT CCGAGTTTCGGTGGTACAGATACTCTGTGTACGGCACCACACTCGAGAAGCTCAC

[0446]

[0447] AAACAAGGGCATCTGCGATCTGCTCATCCGCTGCATCACCTGTCAGAGGCCCCTGTAtorney Docket No. 11538-009W01

[0448] GTCCTGAGGAAAAGCAGAGGCACCTGGACAAGAAGAAGCGCTTTCACAATACCG GCGGCAGATGGACCGGCAGATGCATCGTTTGTTGGCGGAGGCCCAGAACCGAGAC ACAAGTC SEQ. ID. NO. 7 Encoding for HPV -31-E7 ATGCCTGGCGAAACACCCACTCTGCAGGATTACGTGCTGGATCTGCAGCCCGAGG CCACCGATCTGTATGGCTATGGACAGCTGCCCGACAGCAGCGACGAGGAAGATGT GATCGATTCTCCTGCCGGCCAGGCCAAGCCTGACACCAGCAACTACAATATCGTG ACC1TCTGCTGTCAGTGCGAGAGCACCCTGAGACTGTGTGTGCAGAGCACACAGG TGGACATCCGGATCCTGCAAGAGCTGCTGATGGGCTCCTTCGGCATCGTGTGCCCT AACTGCAGCACCAGACTG SEQ. ID. NO. 8 Encoding for HPV-52-E6 ATGGTCGAGGACCCCGCCACCAGACCTAGAACACTGCATGAACTCTGTGAAGTGC TGGAAGAGAGCGTGCACGAGATTCGGCTGCAGTGTGTCCAGTGCAAGAAAGAACT GCAGCGGCGGGAAGTGTACAAGTTCCTGTTCACCGACCTGCGGATTGTCTACAGA GACAACAATCCATACGGCGTCGGGATTATGTGTCTGCGCTTTCTGTCCAAGATCTC CGAGTACAGACACTACCAGTACAGCCTGTACGGAAAGACCCTCGAGGAAAGAGT GCGGAAGCCCCTGAGCGAAATCACCATCCGGTGCA1TATTTGTCAGACCCCTCTGT GCCCAGAAGAAAAAGAAAGACACGTGAACGCTAACAAGCGCTTCCATAACACCA TGGGCCGGTGGACTGGAAGGTGCTCTGAATGTTGGCGGCCCAGGCCTGTGACACA GGTG SEQ. ID. NO. 9 Encoding for HPV-52-E7 ATGCCCGGCGATAAGGCCACCATCAAGGACTACATCCTGGACCTCCAGCCTGAGA CAACCGACCTGCATGGATACGGCCAACTGGGCGACTCTAGCGACGAAGAGGATAC CGATGGCGTGGACCGTCCAGATGGACAAGCCGAGCAGGCCACCAGCAATTATTAC AITGTGACCTACTGTCACTCCTGTGATAGCACACTGAGGCTGTGCATCCACTCCAC CGCCACAGATCTGAGAACCCTGCAACAGATGCTGCTGGGGACCCTGCAGGTTGTC TGTCCTGGTTGTGCCAGACTG SEQ. ID. NO. 10 Encoding for HPV -I8-E6 ATGGCCAGAGTGGAAGATCCCACCAGACGGCCCTACAAGCTGCCTGATCTGTGCA CCGAGCTGAACACCAGCCTGCAGGACATCGAGATCACCTGTGTGTACTGCAAGAC CGTGCTGGAACTGACCGAGGTGTrCGAGTTCGCClTCAAGGACCTGnCGTGGTGT ACCGGGAC AGC ATTCCTC ATGCC GCCGGAC AC A AGTGC ATC GACTTCTAC A GCCG GATCAGAGAGCTGCGGCACTACAGCGATAGCGTGTACGGCGACACCCTGGAAAA GCTGACCAACACCGGCCTGTACAACCTGCTGATCCGGTGCCTGAGATGCCAGAAG CCTCTGAACCCTGCCGAG AAGCTGAG AC ACCTGAACGAGAAGC G GCG GTTCC AC A ACACAGCCGGCCACTATAGAGGCCAGTGCCACAGCTGCTGCAACCGGGCCAGAC AAGAGAGACTTCAGCGGCGGAGAGAAACCCAAGTG SEQ. ID. NO. 11 Encoding for HPV-18-E7 ATGCCTGGACCTAAGGCCACACTGCAGGACATCGTGCTGCACCTGGAACCTCAGA ACGAGATCCCCGTGGATCTGCTCGGACATGGCCAGCTGAGCGATAGCGAGGAAGA GAACGACGAGATCGACGGCGTGAACCACCAGCATCTGCCTGCCAGAAGGGCCGA ACCACAGAGACACACCATGCTGTGCATGTGCTGCAAGTGCGAGGCCAGAATCGAG CTGGTGGTGGAAAGCAGCGCCGACGATCTGAGAGCCTTCCAGCAGCTGTTCCTGA ACACCCTGAGCTTCGTGTGTCCTTGGTGCGCCTCTCAGCAG SEQ. ID. NO. 12 Encoding for HPV-51-E6 ATGGTGGAAGATAAGAGAGAGAGGCCCAGGACTCTGCATGAGCTGTGCGAAGCC CTGAACGTGTCCATGCACAATATCCAGGTCGTGTGCGTCTACTGCAAGAAAGAGC TGTGCAGAGCCGACGTGTACAACGTGGCCn’CACCGAGATCAAGATCGTGTATCG

[0449]

[0450] GGACAACAACCCCTATGCCGTGGGCAAGCAGTGCCTGCTGrnTACTCCAAGATCAtorney Docket No. 11538-009W01

[0451] CGGGAATATCGGCGGTACAGCAGATCCGTGTACGGAACAACTCTGGAAGCCATCA CCAAGAAGTCTCTGTACGATCTGCTGATTAGGTGCCACCGGTGCCAGAGGCCACT GGGACCTGAAGAGAAACAGAAACTGGTGGACGAGAAGAAAAGGTTCCACGAAAC CGCCGGAAGGTGGACAGGCCAGTGTGCTAATTGCTGGCAGCGGACCCGGCAGCG GAATGAGACTCAAGTT SEQ. ID. NO. 13 Encoding for HPV-51-E7 ATGCCCGGAAATGTGCCCCAGCTGAAGGACGTGGTCCTGCATCTGACACCCCAGA CAGAGATCGACCTGCAAGGCTATGGCCAGTTCGACAGCTCTGAGGAAGAGGACG AGGTCGACAACATGCGGGATCAG1TGCCTGAGCGGAGAGCCGGACAGGCCACCT GTTATAGAATCGAGGCCCCnTGCTGCCGGTGCAGCTCTGTTGTTCAGCTGGCTGTG GAATCCAGCGAGGACAACCTGAGAGTGGTGCAGCAAATGTTGATGGGCGAGCTGT CCCTTGTGTGTCCCTGCTGTGCCAACAAC SEQ. ID. NO. 14 Encoding for HPV-35-E6 ATGGTGCAGGACCCTGCCGAAAGACCCTACAAGCTGCACGACCTGTGCAACGAGG TGGAAGAGAGCATCCACGAGATCTGCCTGAACTGCGTGTACTGCAAGCAAGAGCT GCAGCGGAGCGAGGTGTACGACTTCGCCTGCTACGATCTGTGCATCGTGTACAGA GAGGGCCAGCCTTACGGCGTGGGCATGAAGTGCCTGAAGTTCTACAGCAAGATCA GCGAGTACCGGTGGTACAGATACAGCGTGTACGGCGAGACACTGGAAAAGCAGT GCAACAAGCAGCTGTGCCATCTGCTGATCCGGTGCATCACCTGTCAGAAACCTCT GTGCCCCGTGGAAAAACAGCGGCACCTGGAAGAGAAGAAGCGGTTCCACAATAC CGGCGGCAGATGGACCGGCAGATGCATGTCTTGCTGGAAGCCCACCAGACGGGA AACCGAAGTT SEQ. ID. NO. 15 Encoding for HPV-35-E7 ATGCCTGGCGAGATCACCACACTGCAGGACTACGTGCTGGACCTGGAACCTGAGG CCACCGATCTGTATGGCTACGGCCAGCTGTGCGACAGCAGCGAGGAAGAAGAGG ATACCATCGACGGACCTGCCGGACAGGCCAAGCCTGACACCAGCAACTACAACAT CGTGACCAGCTGCTGCAAGTGCGAGGCCACACTGAGACTGTGTGTGCAGAGCACC CACATCGACATCCGGAAGCTGGAAGATCTGCTGATGGGCACCTTCGGCATCGTGT GTCCTGGCTGTAGCCAGAGAGCT SEQ. ID. NO. 16 Encoding for HPV-33-E6 ATGGTGCAGGACACCGAAGAAAAGCCCCGGACACTGCACGATCTGTGTCAGGCTC TGGAAACCACCATCCACAACATCGAGCTGCAGTGCGTGGAATGCAAGAACCCTCT GCAGCGGAGCGAGGTGTACGACTTrGCCrn’GCTGATCTGACAGTGGTGTACAGA GAGGGCAACCCCn’CGGCATCGGCAAGCTGTGTCTGAGATTCCTGAGCAAGATCA GCGAGTACCGCCACTACAACTACTCCGTGTATGGACACACACTGGAACAGACCGT GAAGAAGCCCCTCAACGAGATCCTGATTCGGTGTATCATCTGCCAGCGACCACTG TGCCCTCAAGAGAAGAAACGGCACGTGGACCTGAACAAGAGGTTTCACAACACCT CCGGACGCTGGGCCGGAAGATGTGCTGC1TGTTGGCGCTCTAGACGGCGGGAAAC AGCCCTG SEQ. ID. NO. 17 Encoding for HPV-33-E7 ATGCCAGGCCACAAGCCTACACTGAAAGAGTATGTCCTGGATCTGTACCCTGAGC CTACAGACCTGTACGGCTACGGCCAGCTGTCTGATAGCTCCGACGAGGACGAAGG CCTGGACAGACCTGATGGACAGGCTCAGCCTGCCACCGCCGATTACTACATCGTG ACATGCTGCCACACCTGTAACACCACCGTGCGGCTGTGTGTGAATAGCACCGCCA GCGACCTGAGGACCATCCAGCAACTGCTCATGGGCACCGTGAACATTGTGTGCCC CACATGCGCACAGCTG SEQ. ID. NO. 18 Encoding for HPV-16-L1

[0452] ATGTCTCTrrGGCTGCCTAGTGAGGCCACTGTCTAClTGCCTCCTGTCCCAGTATCT

[0453]

[0454] AAGGTrGTAAGCACGGATGAATATGTTGCACGCACAAACATATAITATCATGCAGAtorney Docket No. 11538-009W01

[0455] GAACATCCAGACTACrrGCACfFrGGACATCCCTATmCCTATrAAAAAACCTAAC AATAACAAAATATIAGTTCCTAAAGTATCAGGATTACAATACAGGGTATTTAGAA TAC ATTTACCTGACCCCAA TAAGTTTGGT IT TCCTGAC ACCTC AIT TTATAATCCAG ATACACAGCGGCTGGTTTGGGCCTGTGTAGGTGTTGAGGTAGGTCGTGGTCAGCC ATTAGGTGTGGGCATTAGTGGCCATCCTTTATTAAATAAATTGGATGACACAGAA AATGCTAGTGCTTATGCAGCAAATGCAGGTGTGGATAATAGAGAATGTATATCTA TGGATTACAAACAAACACAATTGTGTTTAATTGGTTGCAAACCACCTATAGGGGA ACACTGGGGCAAAGGATCCCCATGTACCAATGTTGCAGTAAATCCAGGTGATTGT CCACXTkTTAGAGTTAATAAACACAGTTATTCAGGATGGTGATATGGTTGATACTG GCITrGGTGCTATGGACTrTACTACATTACAGGCTAACAAAAGTGAAGTrCCACTG GATATTTGTACATCTATTTGCAAATATCCAGATTATATTAAAATGGTGTCAGAACC ATATGGCXJACAGCTTATTTTTTTATTTACGAAGGGAACAAATGTTTGTTAGACATT TATTTAATAGGGCTGGTACTGTTGGTGAAAATGTACCAGACGATTTATACATTAAA GGCTCTGGGTCTACTGCAAATTTAGCCAGTTCAAATTATTTTCCTACACCTAGTGG TTCTATGGTTACCTCTG ATGCCC AA AT ATTC A ATAAACCTT ATTGGTT AC A ACG AG CACAGGGCCACAATAATGGCATTTGTTGGGGIAACCAACTAITIVrrACTGTTGTT GATACTACACGCAGTACAAATATGTCATTATGTGCTGCCATATCTACTTCAGAAAC TACATATAAAAATACTAACTTTAAGGAGTACCTACGACATGGGGAGGAATATGAT TTACAGTTTATTTTTCAACTGTGCAAAATAACCTTAACTGCAGACGTTATGACATA CATACATTCTATGAATTCCACTATTTTGGAGGACTGGAATTTTGGTCTACAACCTC CCCCAGGAGGCACACTAGAAGATACTTATAGGTTTGTAACATCCCAGGCAATTGC TTGTCAAAAACATACACCTCCAGCACCTAAAGAAGATCCCCTTAAAAAATACACT TTTTGGGAAGTAAATTTAAAGGAAAAGTTTTCTGCAGACCTAGATCAGTTTCCTTT AGGACGCAAATITTTACTACAAGCAGGATTGAAGGCCAAACCAAAATTTACATTA GGAAAACGAAAAGCTACACCCACCACCTCATCTACCTCTACAACTGCTAAACGCA AAAAACGTAAGCTG _

[0456] SEQ. ID. NO. 19 _ i Encoding for HPV -31-L1 _ ATGTCTCTGTGGCGGCCTAGCGAGGCTACAGTCTACTTACCACCTGTCCCAGTGTC TAAAGTTGTAAGCACGGATGAATATGTAACACGAACCAACATATATTATCACGCA GGCAGTGCTAGGCTGCTTACAGTAGGCCATCCATATTATTCCATACCTAAATCTGA CAATCCTAAAAAAATAGTTGTACCAAAGGTGTCAGGATTACAATATAGGGTATTT AGGGTrCGTrTACCAGArCCAAACAAATTTGGATITCCTGATACA'rCT'nTTATA / 'k TCCTGAAACTCAACGCTTAGTTTGGGCCTGTGTTGGTTTAGAGGTAGGTCGCGGGC: AGCCATTAGGTGTAGGTATTAGTGGTCATCCATTACTAAATAAATTTGATGACACT GAAAACTCTAATAGATATGCCGGTGGTCCTGGCACTGATAATAGGGAATGTATAT CAATGGATTATAAACAAACACAGCTGTGTTTACTTGGTTGCAAACCACCTATTGGA GAGC ATTGGGGTA A AGGTA GTCCTTGTA GTA AT A ATGCT ATTACCCCTGGTG ATTG TCCTCCATTAGAATTAAAAAATTCAGTTATACAAGATGGGGATATGGTTGATACA GGCTTTGGAGCTATGGATTITACTGCTTTACAAGACACTAAAAGTAATGTTCCTrT GGACATrrGTAATTCTATrTGTAAArATCCAGAlTATCTrAAAA'rGGn’GCTGAGC CATATGGCGATACATTATTTTTTTATTTACGTAGGGAACAAATGTTTGTAAGACAT TTTTTTAATAGATCAGGCGCGGTTGGTGAATCGGTTCCTAATGACTTATATATTAA AGGCTCCGGTTCAACAGCTACTTTAGCTAACAGTACATACTTTCCTACACCTAGCG GCTCCATGGTTACTTCAGATGCACAAATTTTTAATAAACCATATTGGATGCAACGT GCTC AGGGAC ACA AT A ATGGTATITGITGGGGC A ATC AGITATITGIT ACTGTGGT AGATACCACACGTAGTACCAA'rATG'rCTGrGTGTGCTGCAATrGCAAACAGTGAT ACTAC\AITrAAAAGrAGrAATrTrAAAGAGTA'rTrAAGACATGGTGAGGAATTTG ATTTACAATTTATAITrCAGTrATGCAAAATAACATTGTCTGCAGACATAATGACA TATATTCACAGTATGAATCCTGCTATTTTGGAAGATTGGAATTTTGGATTGACCAC

[0457]

[0458] ACCTCCCTCAGGTTCTTTAGAGGATACCTATAGGTTTGTAACCTCACAGGCCATTAAtorney Docket No. 11538-009W01

[0459] CATGTCAAAAAACTGCCCCCCAAAAGCCCAAGGAAGATCCATTTAAAGATTATGT ATXTTGGGAGGTTAATTTAAAAGAAAAGTTTTCTGCAGATTrAGATCAGTTTCCAC TGGGTCGCAAAnTITATrACAGGCAGGATATAGGGCACGTCCTAAATTTAAAGC AGGTAAACGTAGTGCACCCTCAGCATCTACCACTACACCAGCAAAACGTAAAAAA ACTAAAAAG SEQ. ID. NO. 20 Encoding for HPV-52-L1 ATGTCCGTGTGGCGGCCTAGTGAGGCCACTGTGTACCTGCCTCCTGTACCTGTCTC TAAGG1TGTAAGCACTGATGAGTATGTGTCTCGCACAAGCATCTATIATTATGCAG GCAGlTCTCGAlTACTAACAGTAGGACATCCCTATmTCTATrAAAAACACCAGT AGTGGTAATGGTAAAAAGGTnTAGTI’CCCAAGGTGTCTGGCCTGCAATACAGGG TATTTAGAATTAAATTGCXGGACXCTAATAAATTCGGTTTTCCAGATACATCTTITT ATAACCCAGAAACCCAAAGGTTGGTGTGGGCCTGTACAGGCTTGGAAATTGGTAG GGGACAGCCTTTAGGTGTGGGCATTAGTGGGCATCCTTTATTAAACAAGTTTGATG ATACTGAAACCAGTAACAAATATGCTGGTAAACCTGGTATAGATAATAGGGAATG TTT ATCT ATGG ATT ATAAGC AG ACTC AGTTATGC ATTTT AGGATGC AA ACCTCCTA TAGGTGAACATTGGGGTAAGGGAACCCCTTGTAATAATAATTCAGGAAATCCTGG GGATTGTCCTCCCCTACAGCTCATTAACAGTGTAATACAGGATGGGGACATGGTA GATACAGGATTXGGTTGCATGGATTTTAATACCTTGCAAGCTAGTAAAAGTGATGT GCCCATTGATATATGTAGCAGTGTATGTAAGTATCCAGATTATTTGCAAATGGCTA GCGAGCCATATGGTGACAGTTTGTTCTTTTTTCTTAGACGTGAGCAAATGTTTGTT AGACACTTTTTTAATAGGGCCGGTACCTTAGGTGACCCTGTGCCAGGTGATTTATA TATACAAGGGTCTAACTCTGGCAATACTGCCACTGTACAAAGCAGTGCTTTTTTTC CTACTCCTAGTGGTTCTATGGTAACCTCAGAATCCCAATTATTTAATAAACCGTAC TGGTTACAACGTGCGCAGGGCCACAATAATGGCATATGTTGGGGCAATCAGTTGT TTGTCACAGTXGTGGATACCACTCGTAGCACTAACATGACTTTATGTGCTGAGGTT AAAAAGGAAAGCACATATAAAAATGAAAATTTTAAGGAATACCTTCGTCATGGCG AGGAATTTGATTTACAATTTATTTTTCAATTGTGCAAAATTACATTAACAGCTGAT GTTATGACATAYATTCATAAGATGGATGCCACTATTTTAGAGGACTGGCAATTTGG CCTTACCCCACCACCGTCTGCATCTTTGGAGGACACATACAGATTTGTCACTTCTA CTGCTATAACTTGTCAAAAAAACACACCACCTAAAGGAAAGGAAGATCCTTTAAA GGACTATATGTTTTGGGAGGTGGATTTAAAAGAAAAGTTTTCTGCAGATTTAGATC AGTTTCCTTTAGGTAGRAAGTTTITGTTACAGGCAGGGCTACAGGCTAGGCCCAAA CTAAAACGCCCTGCATCATCGGCCCCACGTACCTCCACAAAGAAGAAAAAGGTTA AAAGG SEQ. ID. NO. 21 Encoding for HPV -18-L1 ATGGCTTTGTGGCGGCCTAGTGACAATACCGTATACCTTCCACCTCCTTCTGTGGC AAGAGTTGTAAATACTGATGATTATGTGACTCGCACAAGCATATTTTATCATGCTG GC AGCTCT AG ATTATTA ACTGTTGGTA ATCC ATATTTTAGGGTTCCTGCAGGTGGT GGC A AT A AGC AGG Al ATI’CCT A AGGTITCTGCATACC A AT ATAG AGTATTI C GGGT GCAGTTACCTGACCCAAATAAATTTGGITrACCTGATAATAGTATTrATAATCCTG AAACACAACGTTTAGTGTGGGCCTGTGCTGGAGTGGAAATTGGCCGTGGTCAGCC TTTAGGTGTTGGCCTTAGTGGGCATCCATTTTATAATAAATTAGATGACACTGAAA GTTCCCATGCCGCTACGTCTAATGTTTCTGAGGACGTTAGGGACAATGTGTCTGTA GATTATAAGCAGACACAGTTATGTATTTTGGGCTGTGCCCCTGCTATTGGGGAACA CTGGGCTAAAGGCACTGCTTGTAAATCGCGTCCTTTATCACAGGGCGATTGCCCCC CTTT AG AACTTA AGAAC AC AGTTTTGG A AGATGGTG AT ATGGT AG ATACTGGAT A

[0460] T’GG'l 'GCC ATGG ACT TTAGT AC A TTGC AAGAT ACT A AA'TGTG AGGTACC ATTGG AT ATTTGTCAGTCrATTTGTAAATATCCTGATTAriTACAAATG'rCTGCAGATCCTTAT GGGGATTCCATGTTTTTTTGCTTACGGCGTGAGCAGCTTTTTGCTAGGCATTTTTGG

[0461]

[0462] AATAGGGCAGGTACTATGGGTGACACTGTGCCTCAATCCTTATATATTAAAGGCAAtorney Docket No. 11538-009W01

[0463] CAGGTATGCGTGCTTCACCTGGCAGCTGTGTGTATTCTCCCTCTCCAAGTGGCTCT ATTGTTACCTCTGACTCCCAGTrGTrTAATAAACCA'rATrGG'n’ACATAAGGCACA GGGTCATAACAATGGTATCTGCTGGCATAATCAATTATTTGTTACTGTGGTAGATA CCACTCGTAGTACCAATTTAACAATATGTGCTTCTACACAGTCTCCTGTACCTGGG CAATATGATGCTACCAAATTTAAGCAGTATAGCAGACATGTTGAAGAATATGATT TGCAGTTTATTTTTCAGTTATGTACTATTACTTTAACTGCAGATGTTATGTCCTATA TTCATAGTATGAATAGCAGTATTTTAGAGGATTGGAACTTTGGTGTTCCCCCCCCG CCAACTACTAGTTTGGTGGATACATATCGTTTTGTACAATCTGTTGCTATTACCTGT CAAAAGGATGCTGCACCAGCTGAAAATAAGGArCCCrATGATAAGTTAAAGTTTT GGAATGTGGATTTAAAGGAAAAGTTTTCTITGGACTTAGATCAATATCCCCTTGGA CGTAAATTTTTGGTTCAGGCTGGATTGCGTCGCAAGCCCACCATAGGCCCTCGTAA ACGTTCTGCTCCATCTGCCACTACGTCTTCTAAACCTGCCAAGCGTGTGCGTGTAC GTGCCAGAAAG _

[0464] SEQ. ID. NO. 22 | Encoding for HPV-51-L1 _

[0465] ATGGC ATTGTGGC GC ACC A ATGAC A GC A AGGTGTATTTGCC ACCTGC ACCTGTGTC TCGAATrGTGAATACAGAAGAATATATCACACGCACCGGCATATATrACTATGCA GGCAGTTCCAGACTCATAACATTAGGACATCCCTATTTTCCAATACCTAAAACCTC AACGCGTGCTGCTATTCCTAAAGTATCTGCATTTCAATACAGGGTATTTAGGGTAC AGTTACCAGATCCTAACAAGTTTGGACTTCCGGATCCAAATTTATATAATCCAGAC ACAGATAGGTTGGTGTGGGGTTGTGTGGGCGTTGAGGTGGGCAGAGGACAGCCCC TTGGTGTTGGCCTTAGTGGTCATCCCTTATTTAATAAATATGATGACACAGAAAAT TCACGCATAGCAAATGGCAATGCACAACAAGATGTTAGAGATAACACATCTGTTG ACAACAAACAGACTCAGTTATGTATAATAGGCTGTGCTCCACCTATTGGTGAACA CTGGGGTAT1GGCACTACATGCAAAAACACAGCTGTACCTCCAGGAGACTGCCCC CCCCTGGAACTTGTATCCTCTGTCATTCAGGATGGCGATATGATTGATACAGGGTT TGGGGCTATGGATTTCGCTGCCCTACAGGCCACCAAATCAGACGTCCCTTTGGATA TTTCACAGTCTGTTTGTAAATATCCTGATTATTTGAAAATGTCTGCAGACACATAT GGTAATTCCATGTTTTTTCATTTACGCAGGGAGCAAATTTTTGCTAGGCACTATTA TAATAAACTTGGTAGTGTTGGGGAAGACATTCCTAACAATTATTATATTAAGGGTA GTGGTA ATGGCC GTG ACCCT ATA GA A AGTTAT AT' AT ACTCTGCTACTCCC AGTGGG TCT'ATGATAACAT'CTGATTCTCAAATTTTTAATAAGCCTTATrGGCTTCACCGTGCG CAGGGTCACAATAATGGCAlTTGCTGGAACAATCAGCTTrTrATTACCTG'rGTrGA TACTACCAGAAGTACAAATTTAACTATTAGTACTGCCACTGCTGCAGTTTCCCCAA CATTTACTCCAAGTAACTTTAAGCAATATATTAGGCATGGGGAAGAGTATGAATT GCAATTTATTTTTCAGTTATGTAAAATTACTTTAACTACAGAGGTAATGGCTTATTT ACACACAATGGACCCTACCATCCTTGAACAGTGGAATTTTGGATTAACATTACCTC CGTCTGCTAGTTTGGAGGATGCATATAGGTTTGTTCGAAATGCAGCCACCAGCTGT CAAAAGGACACCCCTCCACAGGATAAGCCAGATCCTTTGGCCAAATATAAATTTT GGGATGTTGATTTAAAGGAACGGTTTTCGTTAGATTrAGACCAATTTGCATTGGGT CGCAAGTTTTTGlTGCAGGTrGGCGTACAACGCAAGCCCAAACCAGGCCTTAAAC GCCCGGCTTCATCGGCCTCCTCTTCCTCTTCCTCTTCAGCCAAACGTAAACGTGTTA AAAAG _

[0466] SEQ. ID. NO. 23 | Encoding for HPV-35-L1 _ ATGTCTCTGTGGCGGTCTAACGAAGCCACTGTCTACCTGCCTCCAGTGTCAGTGTC TAAGGTTGTTAGCACTGATGAATATGTAACACGCACAAACATCTACTATCATGCA GGCAGTTCTAGGCTATTAGCTGTGGGTCACCCATACTATGCTATTAAAAAACAAG ATTCTAATAAAATAGCAGTACCCAAGGTATCTGGTTTGCAATACAGAGTATTTAG AGTAAAATTACCAGATCCrAATAAGTrTGGATTTCCAGACACATCAlTTTATGArC CTGCCTCC: CAGCGTTTGGTTTGGGCCTGTACAGGAGTTGAAGTAGGTCGTGGTCAG

[0467]

[0468] CCATTAGGTGTAGGTATTAGTGGTCATCCTTTATTAAATAAATTGGATGATACTGAAtorney Docket No. 11538-009W01

[0469] AAATTCTAATAAATATGTTGGTAACTCTGGTACAGATAACAGGGAATGCATTTCTA TGGATTATAAACAAACACAATTGTGTTTAATAGGTTGTAGGCCTCCTATAGGTGAA CATTGGGGAAAAGGCACACCTTGTAATGCTAACCAGGTAAAACCAGGAGAATGTC CTCCTTTGGAGTTACTAAACACTGTACTACAAGACGGGGACATGGTAGACACAGG ATTTGGTGCAATGGATTTTACTACATTACAAGCTAATAAAAGTGATGTTCCCCTAG ATATATGCAGTTCCATTTGCAAATATCCTGATTATCTAAAAATGGTTTCTGAGCCA TATGGAGATATGTTATTTTTTTATTTACGTAGAGAGCAAATGTTTGTTAGACATTT ATTTA ATA GGGCTGGA ACTGTAGGTGAA AC AGTACCTGC AG ACCTAT ATA IT A AG GGTACCACTGGCACAlTGCCTAGTACTAGlTATnTCCTACTCCTAGTGGCTCTAT GGTAACCTCAGATGCACAAATATTTAATAAACCATATTGGTTGCAACGTGCACAA GGCCATAATAATGGTATTTGTTGGAGTAACCAATTGTTTGTTACTGTAGTTGATAC AACCCGTAGTACAAATATGTCTGTGTGTTCTGCTGTGTCTTCTAGTGACAGTACAT ATAAAAATGACAATTTTAAGGAATATTTAAGGCATGGTGAAGAATATGATTTACA GTTTATTTTTCAGTTATGTAAAATAACACTAACAGCAGATGTTATGACATATATTC ATAGI ATGA ACCC GTCCATTTTAGA GGATTGGAATTTTGGCCTTACACC ACCGCCT TCTGGTACCTTAGAGGACACATATCGCTATGTAACATCACAGGCTGTAACTTGTCA AAAACCCAGTGCACCAAAACCTAAAGATGATCCATTAAAAAATTATACTTTTTGG GAGGTTGATTTAAAGGAAAAGTTTTCTGCAGACTTAGATCAATTTCCGTTGGGCCG TAAATTTTTGTTACAAGCAGGACTAAAGGCCAGGCCTAATTTTAGATTAGGCAAG CGTGCAGCTCCAGCATCTACATCTAAAAAATCTTCTACTAAACGTAGAAAAGTAA AAAGT SEQ. ID. NO. 24 Encoding for HPV-33-L1 ATGTCCGTGTGGCGGCCTAGTGAGGCCACAGTGTACCTGCCTCCTGTACCTGTATC TAAAGTTGTCAGCACTGATGAATATGTGTCTCGCACAAGCATTTATTATTATGCTG GTAGTTCCAGACTTCTTGCTGTTGGCCATCCATATTTTTCTATTAAAAATCCTACTA ACGCTAAAAAATTATTGGTACCCAAAGTATCAGGCTTGCAATATAGGGTTTTTAG GGTCCGTTTACCAGATCCTAATAAATTTGGATTTCCTGACACCTCCTTTTATAACCC TGATACACAACGATTAGTATGGGCATGTGTAGGCCTTGAAATAGGTAGAGGGCAG CCATTAGGCGTTGGCATAAGTGGTCATCCTTTATTAAACAAATTTGATGACACTGA AACCGGTAACAAGTATCCTGGACAACCGGGTGCTGATAATAGGGAATGTTTATCC ATGGATI AT A A AC A A AC AC A GTI’ATGITT ACTTGG ATGTA A GCCTCC A AC A GGGG AACATrGGGGTAAAGGTGTrGCTTGTAC'rAATGCAGCACCTGCCAATGAITGTCCA CCTTTAGAACTTATAAATACTATTATTGAGGATGGTGATATGGTGGACACAGGATT TGGTTGCATGGATTTTAAAACATTGCAGGCTAATAAAAGTGATGTTCCTATTGATA TTTGTGGCAGTACATGCAAATATCCAGATTATTTAAAAATGACTAGTGAGCCTTAT GGTGATAGTTTATTTTTCTTTCTTCGACGTGAACAAATGTTTGTAAGACACTTTTTT AATAGGGCTGGTACAlTAGGAGAGGCTGITCCCGATGACCTGTACAITAAAGGTr C A GG A ACTACTGCCTCTATTC A A A GC A GTGCTTTTTTTCCC ACTCCTAGTGGATC A ATGG'rTACTTCCGAATCTCAGTTATTrAATAAGCCA'rATTGGCTACAACGTGCACA AGG'rCATAA'rAATGGTATTTGTTGGGGCAATCAGGIATITGTTACTGTGGTAGATA CCACTCGCAGTACTAATATGACTTTATGCACACAAGTAACTAGTGACAGTACATAT AAAAATGAAAATTTTAAAGAATATATAAGACATGTTGAAGAATATGATCTACAGT TTGTTTTTCAACTATGCAAAGTTACCTTAACTGCAGAAGTTATGACATATATTCAT GCTATGAATCCAGATATTTTAGAAGATTGGCAATTTGGTTTAACACCTCCTCCATC TGCTAGTTTACAGGATACCTATAGGTTTGTTACCTCTCAGGCTATTACGTGTCAAA AAACAGTACCTCCAAAGGAAAAGGAAGACCCCITAGGTAAArAT'ACATTTrGGGA AGTGGATTTAAAGGAAAAATTTrCAGCAGATTTAGATCAGTTTCCTTTGGGACGCA AGTTTTTATTACAGGCAGGTCTTAAAGCAAAACCTAAACTTAAACGTGCAGCCCC

[0470]

[0471] CACATCCACCCGCACATCATCTGCAAAACGCAAAAAGGTTAAAAAAAttorney Docket No. 11538-009W01

[0472] SEQ. ID. NO.49 Encoding for human HLA-A2.1 restricted E6-derived CDS T-cell epitope

[0473] ACTATACATGATATAATATTAGAATGTGTG SEQ. ID. NO.50 Encoding for HLA-A2 ATGAGCAGAAGCGTGGCCCTGGCCGTGCTGGCCCTGCTGAGCCTGAGCGGCCTGG AGGCCGGATGCGGCGCTAGCGGCGGGGGCGGAAGCGGTGGCGGAGGTAGCATTC AGAGAACCCCCAAGATCCAAGTGTACAGCAGACACCCTGCCGAAAACGGAAAGA GCAACTTCCTGAACTGCTACGTGAGCGGCTTCCACCCTAGCGACATCGAGGTGGA CCTGCTGAAGAACGGCGAGAGAATCGAGAAGGTGGAGCACAGCGACCTGAGCTT CAGCAAGGACTGGAGCTTCTACCTGCTGTACTACACCGAGTTCACCCCCACCGAG AAGGACGAGTACGCCTGCAGAGTGAACCACGTGACCCTGTCTCAGCCCAAGATCG TGAAGTGGGACCGGGACATGGGGGGCGGAGGCTCGGGTGGCGGTGGCAGCGGCG GTGGGGGTAGTGGGGGTGGCGGC AGCGGAAGTGGTAGCC AC AGC ATG AG ATACT TCTI'CACAAGCGTGAGCAGACCCGGCAGAGGCGAGCCTAGATTCATCGCCGTGGG CTACGTGGACGACACACAGTTCGTGAGATTCGACAGCGACGCCGCTTCTCAGAGA ATGGAGCCTAGAGCCCCCTGGATCGAGCAAGAGGGCCCCGAGTACTGGGACGGC GAGACAAGAAAGGTGAAGGCCCACTCTCAGACCCACAGAGTGGACCTGGGCACC CTGAGAGGCTGCTACAATCAGAGCGAGGCCGGCAGCCACACCGTGCAGAGAATG TACGGCTGCGACGTGGGCAGCGACTGGAGATTCCTGAGAGGCTACCATCAGTACG CCTACGACGGCAAGGACTACATCGCCCTGAAGGAGGACCTGAGAAGCTGGACCG CCGCCGACATGGCCGCCCAAACCACCAAACACAAGTGGGAGGCCGCCCACGTGG CCGAGCAGCTGAGAGCCTACCTGGAGGGCACCTGCGTGGAGTGGCTGAGAAGAT

[0474]

[0475] ACCTGGAAAACGGCAAAGAGACGCTGCAGAGAACCGACGCCCCC

[0476] Table 2. List of amino acid sequences of example antigens that can be encoded for by nucleic acids in the niRNA vaccines described herein.

[0477] Amino Acid Sequence of Example Antigens

[0478] SEQ. ID. NO.25 Amino acid sequence of HPV-16 E6 MHQKRTAMVQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLC IVYRDGNPYAVGDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKP LCPEEKQRHLDKKQRFHNTRGRWTGRCMSCCRSSRTRRETQL SEQ. ID. NO.26 Amino acid sequence of HPV-16 E7 MPGDTPTLHEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTF CCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP SEQ. ID. NO.27 Amino acid sequence of S2 Subdomain of SARS-CoV-2 Spike Protein

[0479] LGDIAARDI JC AQKFNGI JTVLPPI. LTDEMI AQ YTS ALL AGTITSG WTFGAG A ALQIPFA MQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNA QALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAA LIRAS ANL AATKMSEC VLGQ SEQ. ID. NO.28 Amino acid sequence of pan-mRNA5 (HPV31-E6 / E7-HPV52-E6- E7-HPV18-E6-E7) MVKNPAERPRKLHELSSALEIPYDELRLNCVYCKGQLTETEVLDFAFTDLTIVYRDDT PYGVGTKCLRFYSKVSEFRWYRYSVYGTTLEKLTNKGICDLLIRCITCQRPLCPEEKQR HLDKKKRFHNTGGRWTGRCI VC WRRPRTETQ VMPGE TPTLQD Y V EDI. QPE ATDI. YG YGQT. PDSSDEED VIDSP AGQAKPDTSN YNIVT FCC QCESTLR1, C VQS'fQ VDIRII. QEI. L MGSFGIVCPNCSTRLMVEDPATRPRTLHELCEVLEESVHEIRLQCVQCKKELQRREVY

[0480]

[0481] KFLFTDLRIVYRDNNPYGVGIMCLRFLSKISEYRHYQYSLYGKTLEERVRKPlSEITRCAtorney Docket No. 11538-009W01

[0482] IICQTPLCPEEKERHVNANKRFHNTMGRWTGRCSECWRPRPVTQVMPGDKATIKDYI LDLQPETTDLHGYGQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRL CIHS TATDLRTLQQMLLG TLQ V VCPGC ARLMPGPKATLQDIVLHLEPQNEIP VDLLGH GQLSDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIELVVESSADDLRA FQQLFLNTLSFVCPWCASQQ SEQ. ID. NO.29 Amino acid sequence of pan-mRNA6 (HPV51-E7 / E6-HPV35-E7- E6-HPV33-E7-E6) MPGNVPQLKDVVLHLTPQTEIDLQGYGQFDSSEEEDEVDNMRDQLPERRAGQATCY RJEAPCCRCSSVVQLAVESSEDNLRVVQQMI. MGELSLVCPCCANNMVEDKRERPRTL HELCEALNVSMHNIQVVCVYCKKELCRADVYNVAFTEIKIVYRDNNPYAVGKQCLLF YSKIREYRR YSRS VYG ITLEA11’KKSL YDLLIRCHRCQRPLGPEEKQKLVDEKKRFHET AGRWTGQCANCWQRTRQRNETQVMPGEITTLQDYVLDLEPEATDLYGYGQLCDSSE EEEDTIDGPAGQAKPDTSNYNIVTSCCKCEATLRI. CVQSTHIDIRKEEDI. LMGTFGIVC PGCSQRAMVQDPAERPYKLHDLCNEVEESniEICLNCVYCKQELQRSEVYDFACYDL CIVYREGQPYGVGMKCLKFYSKISEYRWYRYSVYGETLEKQCNKQLCHLLIRCrrCQ KPLCPVEKQRHLEEKKRFHNTGGRWTGRCMSCWKPTRRETEVMPGHKPrLKEYVLD LYPEPrDLYGYGQLSDSSDEDEGLDRPDGQAQPATADYYIVTCCHTCNTrVRLCVNS TASDLRTIQQLLMGTVNIVCPTCAQLMVQDTEEKPRTLHDLCQALETTIHNIELQCVE CKNPLQRSEVYDFAFADLTVVYREGNPFGIGKLCLRFLSKISEYRHYNYSVYGHTLEQ TVKKPLNEILIRCTICQRPLCPQEKKRIIVDLNKRFIINTSGRWAGRCAACWRSRRRETA L SEQ. ID. NO.30 Amino acid sequence of HPV-31-E6 MVKNPAERPRKLHELSSALEIPYDELRLNCVYCKGQLTETEVLDFAFTDLTIVYRDDT PYGVGTKCLRFYSKVSEFRWYRYSVYGTTLEKLTNKGICDLLIRCITCQRPLCPEEKQR HLDKKKRFHNTGGRWTGRC1VCWRRPRTETQV

[0483] SEQ. ID. NO.31 Amino acid sequence of IIPV-31-E7 MPGETPTLQDYVLDLQPEATDLYGYGQLPDSSDEEDVIDSPAGQAKPDTSNYNIVTFC CQCESTLRLCVQSTQVDIRILQELLMGSFGIVCPNCSTRL SEQ. ID. NO.32 Amino acid sequence of HPV-52-E6 MVEDPATRPRTLHELCEVI. EESVHEIRI. QCVQCKKELQRREVYKFI. FTDLRIVYRDNN PYGVGIMCLRFLSKISEYRHYQYSLYGKTLEERVRKPLSEITIRCIICQTPLCPEEKERHV NANKRFHNTMGRWTGRCSF. CWRPRPVTQV

[0484] SEQ. ID. NO.33 Amino acid sequence of IIPV -52-E7 MPGDKATIKDYILDLQPETrDLHGYGQLGDSSDEEDTDGVDRPDGQAEQATSNYYIV TYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL SEQ. ID. NO.34 Amino acid sequence of HPV-18-E6 MARVEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDS IPHAAGHKCIDFYSRIRELRHYSDSVYGDTEEKLTNTGLYNLLIRCLRCQKPLNPAEKL RH1.. NEKRRFHN 1 AGHYRGQCHSCCNRARQEREQRRRETQV

[0485] SEQ. ID. NO.35 Amino acid sequence of HPV-18-E7

[0486] MPGPK A TLQDIVLHI. EPQNEIPVDI. LGHGQLSDSEEENDEIDGVN HQHLPARR AEPQR HTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCASQQ SEQ. ID. NO.36 Amino acid sequence of IIPV-51-E6 MVEDKRERPRTLHELCEALNVSMHNIQVVCVYCKKELCRADVYNVAFTEIKIVYRDN NPYAVGKQCLLFYSKIREYRRYSRSVYGTTLEAITKKSLYDLLIRCHRCQRPLGPEEKQ KEVDEKKRFHETAGRWTGQCANCWQRTRQRNETQV SEQ. ID. NO.37 Amino acid sequence of HPV-51-E7

[0487] MPGNVPQLKDVVLHLTPQTEIDLQGYGQFDSSEEEDEVDNMRDQLPERRAGQATCY

[0488]

[0489] RIEAPCCRCSSVVQLAVESSEDNLRVVQQMLMGELSLVCPCCANNAtorney Docket No. 11538-009W01

[0490] SEQ. ID. NO.38 Amino acid sequence of HPV-35-E6 MVQDPAERPYKEHDECNEVEESIHEICENCVYCKQEEQRSEVYDFACYDECIVYREG QPYGVGMKCEKFYSKISEYRWYRYSVYGETEEKQCNKQECHEEIRCrrCQKPECPVE KQRHLEEKKRFHN TGGRW TGRCMSC WKP TRRE TEV SEQ. ID. NO.39 Amino acid sequence of HPV-35-E7 MPGEI1TLQDYVLDLEPEATDLYGYGQLCDSSEEEEDTIDGPAGQAKPDTSNYNIVTS CCKCEATLRLCVQSTHIDIRKLEDLLMGTFGIVCPGCSQRA SEQ. ID. NO.40 Amino acid sequence of HPV-33-E6 MVQDTEEKPRTLHDLCQALETTIHNIELQCVECKNPLQRSEVYDFAFADLTVVYREG NPFGIGKLCLRFLSKISEYRHYNYSVYGHTLEQTVKKPLNEILIRCIICQRPLCPQEKKR HVDLNKRFHNTSGRWAGRCAACWRSRRRETAL SEQ. ID. NO.41 Amino acid sequence of HPV-33-E7 MPGHKFrLKEYVLDLYPEFrDLYGYGQLSDSSDEDEGLDRPDGQAQPATADYYIVTC CHTCNlTVRLCVNSTASDLRTIQQLLMGTVNIVCFrCAQL

[0491] SEQ. ID. NO.42 Amino acid sequence of HPV-16-L1 MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN KILVPKVSGLQYRVFRIIILPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV GISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKG SPCTNVAVNPGDCPPEEEINTVIQDGDMVDTGFGAMDFTTEQANKSEVPEDICTSICK YPD YIKMVSEPYGDSLFFYI. RREQMFVRHI. FNR AGTVGENVPDDI. YIKGSGSTANI. A SSNYFFrPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDlTRSTNMSL CAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILEDWN FGLQPPPGGTLEDTYRFVTSQAIACQKHTPPAPKEDPLKKYTFWEVNLKEKFSADLDQ FPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRKL SEQ. ID. NO.43 Amino acid sequence of HPV-31-L1 MSEWRPSEATVYEPPVPVSKVVSTDEYVTRTNIYYHAGSAREETVGHPYYSIPKSDNP KKIVVPK VSGLQ YR VFR VRLPDPNKFGFPDTSFYNPE I’QRI. VWAC VGLEVGRGQPLG VGISGHPLLNKFDDTENSNRYAGGPGTDNRECISMDYKQTQLCLLGCKPPIGEHWGK GSPCSNNAITPGDCPPLELKNSVIQDGDMVDTGFGAMDFTALQDTKSNVPLDICNSIC KYPDYLKMVAEPYGDTLFFYLRREQMFVRHFFNRSGAVGESVPNDLYIKGSGSTATL ANSTYFPTPSGSMVTSDAQIFNKPYWMQRAQGHNNGICWGNQLFVTVVDTTRSTNM SVCAAIANSDTTFKSSNFKEYLRHGEEFDLQFIFQLCKITLSADIMTYIHSMNPAILEDW NFGETTPPSGSEEDTYRFVTSQAITCQKTAPQKPKEDPFKDYVFWEVNEKEKFSADED QFPI. GRKFLLQAGYRARPKFKAGKRSAPSASTTTPAKRKKTKK

[0492] SEQ. ID. NO.44 Amino acid sequence of HPV-52-L1

[0493] MVQILFYILVIFYYV AG VNVFHIFLQMSVWRPSEATVYLPPVPVSKVVS TDEY VSRTSI YYYAGSSRLLTVGHPYFSIKNTSSGNGKKVLVPKVSGLQYRVFRIKI. PDPNKFGFPDT SFYNPETQRLVWACTGLEIGRGQPLGVGISGHPLLNKFDDTETSNKYAGKI’GIDNREC LSMDYKQTQLCILGCKPPIGEHWGKGTPCNNNSGNPGDCPPLQLINSVIQDGDMVDT GFGCMDFNTLQASKSDVPIDICSSVCKYPDYLQMASEPYGDSLFFFLRREQMFVRHFF NRAGTLGDPVPGDEYIQGSNSGNTATVQSSAFFPTPSGSMVTSESQEFNKPYWLQRAQ GIINNGICWGNQEFVTVVDTTRSTNMTECAEVKKESTYKNENFKEYERHGEEFDLQFI FQLCKITLTADVMTYIHKMDATILEDWQFGLTPPPSASLEDTYRFVTSTAITCQKNTPP KGKEDPLKDYMFWEVDLKEKFSADLDQFPLGRKFLLQAGLQARPKLKRPASSAPRTS TKKKKVKR SEQ. ID. NO.45 Amino acid sequence of HPV-18-L1 MALWRPSDNTVYLPPPSVARVVNTDDYVTRTSIFYHAGSSRLLTVGNPYFRVPAGGG NKQDIPKVSAYQYRVFRVQLPDPNKFGLPDNSIYNPETQRLVWACAGVEIGRGQPLG

[0494]

[0495] VGLSGIIPFYNKEDDTESSHAATSNVSEDVRDNVSVDYKQTQLCIEGCAPAIGEHWAKAtorney Docket No. 11538-009W01

[0496] GTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSIC KYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMRAS PGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGICWHNQLFVTVVDTTRSTNLT ICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILED WNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLD LDQYPLGRKFLVQAGLRRKPTTGPRKRSAPSATTSSKPAKRVRVRARK SEQ. ID. NO.46 Amino acid sequence of HPV-51-L1 MALWRTNDSKVYLPPAPVSRIVNTEEYITRTGIYYYAGSSRLrn., GHPYFPIPKTSl’RAA IPKVSAFQYRVFRVQLPDPNKFGLPDPNLYNPDTDRLVWGCVGVEVGRGQPLGVGLS GHPLFNKYDDTENSRIANGNAQQDVRDNTSVDNKQTQLCIIGCAPPIGEHWGIGITCK NTAVPPGDCPPLELVSSVIQDGDMIDTGFGAMDFAALQATKSDVPLDISQSVCKYPDY LKMSADTYGNSMFFHLRREQIFARHYYNKLGSVGEDIPNNYYIKGSGNGRDPIESYIY SATPSGSMITSDSQIFNKPYWLHRAQGHNNGICWNNQLFITCVDTTRSTNLTISTATAA VSPTFTPSNFKQYIRHGEEYELQFIFQirKITLTTEVMAYLHTMDPTIIJiQWNFGLTLPP SASLEDAYRFVRNAATSCQKDTPPQDKPDPLAKYKFWDVDLKERFSLDLDQFALGRK FLLQVGVQRKPKPGLKRPASSASSSSSSSAKRKRVKK SEQ. ID. NO.47 Amino acid sequence of HPV-35-L1 MSLWRSNEATVYLPPVSVSKVVSTDEYVTRTNIYYHAGSSRLLAVGHPYYAIKKQDS NKIAVPKVSGLQYRVFRVKLPDPNKFGFPDTSFYDPASQRLVWACTGVEVGRGQPLG VGISGHPLLNKLDDTENSNKYVGNSGTDNRECISMDYKQTQLCLIGCRPPIGEHWGKG TPCNANQVKPGECPPLELLNTVLQDGDMVDTGFGAMDFTTLQANKSDVPLDICSSIC KYPDYLKMVSEPYGDMLFFYLRREQMFVRHLFNRAGTVGETVPADLYIKGTTGTLPS TSYFP'lPSGSMVrSDAQIFNKPYWLQRAQGHNNGlCWSNQI. FVTVVDTrRSTNMSVC SA VSSSDSTYKNDNTKE YI. RHGEEYDLQFIFQLCKrn / rADVMTYIHSMNPSIl EDWNF GLTPPPSGTLEDTYRYVTSQAVTCQKPSAPKPKDDPLKNYTFWEVDLKEKFSADLDQ FPLGRKFLLQAGLKARPNFRLGKRAAPASTSKKSSTKRRKVKS SEQ. ID. NO.48 Amino acid sequence of HPV-33-L1 MSVWRPSEATVYLPPVPVSKVVSTDEYVSRTSIYYYAGSSRLLAVGHPYFSIKNPTNA KKLLVPKVSGLQYRVFRVRLPDPNKFGFPDTSFYNPDTQRLVWACVGLEIGRGQPLG VGISGIIPLLNKFDDTETGNKYPGQPGADNRECLSMDYKQTQLCLLGCKPPTGEHWG KGVACTNAAPANDCPPLELINTIIEDGDMVDTGFGCMDFKTLQANKSDVPIDICGSTC KYPDYLKMTSEPYGDSLFFFLRREQMFVRHFFNRAGTLGEAVPDDLYIKGSGTTASIQ SSAFFPTPSGSMVTSESQLFNKPYWLQRAQGHNNGICWGNQVFVTVVD1TRSTNMTL CTQVTSDSTYKNENFKEYIRHVEEYDLQFVFQLCKVTLTAEVMTYIHAMNPDILEDW QFGLTPPPSASLQDTYRFVTSQAITCQKTVPPKEKEDPLGKYTFWEVDLKEKFSADLD QFPLGRKFLLQAGLKAKPKLKRAAPTSTRTSSAKRKKVKK SEQ. ID. NO.51 Amino acid sequence of human HLA-A2.1 restricted E6-derived CD8 T-cell epitope

[0497] TIHDIILECV SEQ. ID. NO.52 Amino acid sequence of human HLA-A2.1 MSRSVALAVLALLSLSGLEAGCGASGGGGSGGGGSIQRTPKIQVYSRHPAENGKSNFL NCYVSGFHPSDIEVDLLKNGERlEKVEHSDLSFSKDWSFYLLYYTEFTPrEKDEYACR VNHVTLSQPKIVKWDRDMGGGGSGGGGSGGGGSGGGGSGSGSHSMRYFFTSVSRPG RGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQT HRVDLGTLRGCYNQSEAGSHTVQRMYGCDVGSDWRFERGYHQYAYDGKDYIALKE DLR S W TAADM AAQTTKHK WEAAHV AEQI JRA YI JEGTC VE WI JRRY I JENGKETI. QR'ID APKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDG TFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVI

[0498]

[0499] TGAVVAAVMWRRKSSDRKGGSYSQAASSDSAQGSDVSLTACKV

Claims

Attorney Docket No. 11538-009W01What is claimed is:

1. A composition comprising:a first nucleic acid encoding for an HPV E6 peptide or a variant or fragment thereof; a second nucleic acid encoding for an HPV E7 peptide or a variant or fragment thereof; anda third nucleic acid encoding a subdomain of the SARS-CoV-2 spike protein.

2. The composition of claim 1, wherein the first nucleic acid encodes for an HPV 16 E6 peptide or a variant or fragment thereof.

3. The composition of any one of claims 1-2, wherein the first nucleic acid comprises SEQ. ID. NO. 1.

4. The composition of any one of claims 1-3, wherein the first nucleic acid encodes for SEQ. ID. NO. 25.

5. The composition of any one of claims 1-4, wherein the second nucleic acid encodes for an HPV 16 E7 peptide or a variant or fragment thereof.

6. The composition of any one of claims 1-5, wherein the second nucleic acid comprises SEQ. ID. NO. 2.

7. The composition of any one of claims 1-6, wherein the second nucleic acid encodes for SEQ. ID. NO. 26.

8. The composition of any one of claims 1-7, wherein the third nucleic acid encodes the S2 subdomain of the SARS-CoV-2 spike protein.

9. The composition of any one of claims 1-8, wherein the third nucleic acid comprises SEQ. ID. NO. 3.Attorney Docket No. 11538-009W0110. The composition of any one of claims 1-9, wherein the third nucleic acid encodes for SEQ. ID. NO. 27.

11. The composition of any one of claims 1-10, wherein the first nucleic acid, the second nucleic acid, and the third nucleic acid are linked.

12. The composition of claim 11, wherein the first nucleic acid, the second nucleic acid, the third nucleic acid, or a combination thereof are linked directly or via a peptide linker such as a glycine-serine linker, glycine -rich linker, or GSAT linker.

13. The composition of claim 11, wherein the first nucleic acid, the second nucleic acid, the third nucleic acid, or a combination thereof are linked via F2A, P2A, T2A or E2A from Ewing’s sarcoma activated transcript- 1 (EAT2).

14. The composition of claim 11, wherein the first nucleic acid, the second nucleic acid, the third nucleic acid, or a combination thereof are linked via internal ribosome entry site (IRES) derived from Picornavirus, Aphthovirus, Kaposi’s sarcoma-associated herpesvirus, Hepatitis A, Hepatitis C, Pestivirus, Cipavirus, Rhopalosiphum padivirus, etc.

15. The composition of any one of claims 1-14, wherein upon administration to a human subject, the composition elicits a T-cell mediated immune response targeting HPV-infected cells.

16. The composition of any one of claims 1-15, wherein the composition further comprises a fourth nucleic acid encoding one or more human HEA-A2.1 restricted E6-derived CD8 T-cell epitopes.

17. The composition of claim 16, wherein the third nucleic acid comprises SEQ. ID. NO. 49.

18. The composition of any one of claims 16-17, wherein the composition further comprises a fifth nucleic acid encoding HLA-A2.

19. The composition of claim 18, wherein the fifth nucleic acid comprises SEQ. ID. NO. 50.Attorney Docket No. 11538-009W0120. The composition of any one of claims 16-19. wherein upon administration to a human subject, the composition induces HLA-A2-specific CD8 T-cell immunity.

21. The composition of any one of claims 1-20, wherein the first nucleic acid, the second nucleic acid, and the third nucleic acid comprise plasmid DNA, minicircle DNA, microRNA, mRNA, self-amplifying RNA, circle RNA, DNA launched self-amplifying RNA, or viral vector.

22. The composition of any one of claims 1-21, wherein the composition further comprises one or more additional nucleic acids encoding for an HPV antigen from another HPV strain, one or more additional nucleic acids encoding for an HPV antigen other than an E6 or E7 peptide or a variant or fragment thereof, or a combination thereof.

23. The composition of claim 22, wherein the composition further comprises one or more additional nucleic acids encoding an HPV antigen from HPV 18, HPV 31, HPV 33, HPV 35, HPV 39, HPV 45, HPV 51, HPV 52, HPV 56, HPV 58, HPV 59, HPV 66, or a combination thereof.

24. The composition of any one of claims 22-23, wherein the composition further comprises one or more additional nucleic acids encoding an HPV LI peptide or a variant or fragment thereof, an HPV E2 peptide or a variant or fragment thereof, or a combination thereof.

25. The composition of any one of claims 22-24, wherein the one or more additional nucleic acids encode for an HPV 18 E6 peptide or a variant or fragment thereof, an HPV 31 E6 peptide or a variant or fragment thereof, an HPV 33 E6 peptide or a variant or fragment thereof, an HPV 35 E6 peptide or a variant or fragment thereof, an HPV 39 E6 peptide or a variant or fragment thereof, an HPV 45 E6 peptide or a variant or fragment thereof, an HPV 51 E6 peptide or a variant or fragment thereof, an HPV 52 E6 peptide or a variant or fragment thereof, an HPV 56 E6 peptide or a variant or fragment thereof, an HPV 8 E6 peptide or a variant or fragment thereof, an HPV 59 E6 peptide or a variant or fragment thereof, an HPV 66 E6 peptide or a variant or fragment thereof, an HPV 18 E7 peptide or a variant or fragment thereof, an HPV 1 E7 peptide or a variant or fragment thereof, an HPV 33 E7 peptide or a variant or fragment thereof, an HPV 35 E7 peptide or a variant or fragment thereof, an HPV 39 E7 peptide or a variant or fragment thereof, an HPV 45 E7 peptide or a variant or fragment thereof, an HPV 51Attorney Docket No. 11538-009W01E7 peptide or a variant or fragment thereof, an HPV 52 E7 peptide or a variant or fragment thereof, an HPV 56 E7 peptide or a variant or fragment thereof, an HPV 58 E7 peptide or a variant or fragment thereof, an HPV 59 E7 peptide or a variant or fragment thereof, an HPV 66 E7 peptide or a variant or fragment thereof, an HPV 16 El peptide or a variant or fragment thereof, an HPV 18 LI peptide or a variant or fragment thereof, an HPV 31 El peptide or a variant or fragment thereof, an HPV 33 LI peptide or a variant or fragment thereof, an HPV 35 El peptide or a variant or fragment thereof, an HPV 39 LI peptide or a variant or fragment thereof, an HPV 45 LI peptide or a variant or fragment thereof, an HPV 51 LI peptide or a variant or fragment thereof, an HPV 52 LI peptide or a variant or fragment thereof, an HPV 56 LI peptide or a variant or fragment thereof, an HPV 58 LI peptide or a variant or fragment thereof, an HPV 59 LI peptide or a variant or fragment thereof, an HPV 66 LI peptide or a variant or fragment thereof, an HPV 16 E2 peptide or a variant or fragment thereof, an HPV 18 E2 peptide or a variant or fragment thereof, an HPV 31 E2 peptide or a variant or fragment thereof, an HPV 33 E2 peptide or a variant or fragment thereof, an HPV 35 E2 peptide or a variant or fragment thereof, an HPV 39 E2 peptide or a variant or fragment thereof, an HPV 45 E2 peptide or a variant or fragment thereof, an HPV 51 E2 peptide or a variant or fragment thereof, an HPV E2 El peptide or a variant or fragment thereof, an HPV 56 E2 peptide or a variant or fragment thereof, an HPV 58 E2 peptide or a variant or fragment thereof, an HPV 59 E2 peptide or a variant or fragment thereof, an HPV 66 E2 peptide or a variant or fragment thereof, or a combination thereof.

26. The composition of any one of claims 22-25, wherein the one or more additional nucleic acids comprise SEQ. ID. NO. 4, SEQ. ID. NO. 5, SEQ. ID. NO. 6, SEQ. ID. NO. 7, SEQ. ID. NO. 8, SEQ. ID. NO. 9, SEQ. ID. NO. 10, SEQ. ID. NO. 11, SEQ. ID. NO. 12, SEQ. ID. NO.13, SEQ. ID. NO. 14, SEQ. ID. NO. 15, SEQ. ID. NO. 16, SEQ. ID. NO. 17, SEQ. ID. NO. 18, SEQ. ID. NO. 19, SEQ. ID. NO. 20, SEQ. ID. NO. 21, SEQ. ID. NO. 22, SEQ. ID. NO. 23, SEQ. ID. NO. 24, or a combination thereof.

27. The composition of any one of claims 22-25, wherein the one or more additional nucleic acids encode for SEQ. ID. NO. 28, SEQ. ID. NO. 29, SEQ. ID. NO. 30, SEQ. ID. NO. 31, SEQ. ID. NO. 32, SEQ. ID. NO. 33, SEQ. ID. NO. 34, SEQ. ID. NO. 35, SEQ. ID. NO. 36, SEQ. ID. NO. 37, SEQ. ID. NO. 38, SEQ. ID. NO. 39, SEQ. ID. NO. 40, SEQ. ID. NO. 41, SEQ. ID. NO.Attorney Docket No. 11538-009W0142, SEQ. ID. NO. 43, SEQ. ID. NO. 44, SEQ. ID. NO. 45, SEQ. ID. NO. 46, SEQ. ID. NO. 47, SEQ. ID. NO. 48, or a combination thereof.

28. The composition of any one of claims 1-27, wherein the composition comprises a nanoparticle, a lipid nanoparticle dispersion, a liposomal formulation, a lipid emulsion, vaccine, vector, or any combination thereof.

29. The composition of any one of claims 1-28, wherein the composition is a lipid nanoparticle, and wherein the lipid nanoparticle comprises 20% to 80% of ionizable lipid, cationic lipid, or any combination thereof; 0 % to 5 % pegylated lipids; 0 % to 40 % helper lipids; and 0 % to 80 % sterol.

30. The composition of any one of claims 1-29, wherein the composition comprises a pharmaceutical composition suitable for administration to a human subject.

31. A nucleic acid comprising SEQ. ID. NO. 1, SEQ. ID. NO. 2, SEQ. ID. NO. 3, or a combination thereof.

32. The nucleic acid of claim 31, wherein the nucleic acid comprises SEQ. ID. NO. 1, SEQ. ID. NO. 2, and SEQ. ID. NO. 3.

33. A protein comprising SEQ. ID. NO. 25, SEQ. ID. NO. 26, SEQ. ID. NO. 27, or a combination thereof.

34. A fusion protein comprising an E6 HPV portion comprising SEQ. ID. NO. 25, an E7 HPV portion comprising SEQ. ID. NO. 26, and a spike domain portion comprising SEQ. ID. NO. 27.

35. A cell comprising the nucleic acid of any one of claims 31-32, the protein of any one of claims 33-34, or the composition of any one of claims 1-30.

36. The cell of claim 35, wherein the cell comprises a dendritic cell, B cell, or a macrophage.Attorney Docket No. 11538-009W0137. A method of heating or preventing HPV in a subject, the method comprising administering to the subject a therapeutically effective amount of the composition of any one of claims 1-30 or the nucleic acid of any one of claims 31-32.

38. A method of treating HPV-related cervical intraepithelial neoplasia (CIN) (e.g., CIN 1-3, CIN 2-3) in a subject, the method comprising administering to the subject a therapeutically effective amount of the composition of any one of claims 1-30 or the nucleic acid of any one of claims 1-32.

39. A method for reducing a risk of recurrence of a pre-cancerous or cancerous growth in a subject infected with HPV who has been treated for the growth, the method comprising administering to the subject a therapeutically effective amount of the composition of any one of claims 1-30 or the nucleic acid of any one of claims 1-32.

40. A method of heating cervical cancer in a subject, the method comprising administering to the subject a therapeutically effective amount of the composition of any one of claims 1-30 or the nucleic acid of any one of claims 31-32.

41. The method of claim 40, wherein the method further comprises administering an immune checkpoint inhibitor (CPI) to the subject.

42. A method of heating an HPV-related cancer in a subject, the method comprising administering to the subject a therapeutically effective amount of the composition of any one of claims 1-30 or the nucleic acid of any one of claims 1-32.

43. The method of claim 42, wherein the method further comprises administering an immune checkpoint inhibitor (CPI) to the subject.

44. A method of heating recurrent respiratory papillomatosis (RRP) in a subject, the method comprising administering to the subject a therapeutically effective amount of the composition of any one of claims 1-30 or the nucleic acid of any one of claims 31-32.Attorney Docket No. 11538-009W0145. The method of any one of claims 37-44, wherein the method further comprises administering an immune response modifier to the subject.

Images