A hybridoma cell line 6F92E10 and its monoclonal antibody and its application
By developing the hybridoma cell line 6F92E10 and its monoclonal antibody, the problem of rapid isolation and identification of Akkermansia muciniphila was solved, efficient and specific detection was achieved, and research on its presence in the intestine was supported.
Patent Information
- Application Number
- CN202511107476.X
- Authority / Receiving Office
- CN · China
- Patent Type
- Patents(China)
- Current Assignee / Owner
- Filing Date
- 2025-08-08
- Publication Date
- 2025-10-14
- Estimated Expiration
- 2045-08-08
AI Technical Summary
Existing technologies make it difficult to quickly isolate and identify Akkermansia muciniphila, and lack tools to target its functional molecules, hindering in-depth research on its immune regulation and intestinal colonization mechanisms.
A hybridoma cell line 6F92E10 and its monoclonal antibody were developed. Through the preparation and purification process, a monoclonal antibody with strong specificity and high titer was obtained, which was applied to products and kits for the detection and identification of Akkermansia muciniphila.
The efficient subtype identification and specific detection of Akkermansia muciniphila were achieved, providing a basis for studying its adhesion and colonization in the intestine and providing a technical means for in-depth study of the function and mechanism of the bacteria.
Smart Images

Figure CN120591216B_ABST
Abstract
Description
Technical Field
[0001] The present invention relates to the field of biotechnology, and more particularly to a hybridoma cell line 6F92E10 and its monoclonal antibody and application. Background Art
[0002] Akkermansia muciniphila (AKK), a Gram-negative anaerobic bacterium native to the human intestine, uses mucin as its sole source of carbon, nitrogen, and energy. It hydrolyzes mucin to release free sulfate, which is then fermented to produce acetic and propionic acids. AKK is a common colonizer of the human intestine, comprising approximately 0.5% to 5% of the human microbiome. Research has shown that AKK exhibits promising potential in improving metabolic diseases (such as obesity and diabetes), limiting inflammation, combating aging, and assisting in cancer immunotherapy. It is considered a promising candidate for second-generation probiotics.
[0003] However, Akkermansia muciniphila is difficult to isolate and culture, and rapid isolation and identification of AKK bacteria remains a research bottleneck. Furthermore, the lack of tools targeting specific functional molecules of AKK hinders in-depth research on its mechanisms of immune regulation and intestinal colonization. These technical bottlenecks all involve the preparation of monoclonal antibodies against AKK bacteria.
[0004] In summary, how to provide a monoclonal antibody against Akkermansia muciniphila is an urgent problem that needs to be solved by those skilled in the art. Summary of the Invention
[0005] In view of this, the present invention provides a hybridoma cell line 6F92E10 and its monoclonal antibody and application.
[0006] In order to achieve the above object, the present invention adopts the following technical solutions:
[0007] A hybridoma cell line 6F92E10, classified and named Hybridoma cell line 6F92E10, was deposited in the China Center for Type Culture Collection on June 30, 2025, with the deposit number CCTCC NO: C2025203, and the deposit address is Wuhan University, Wuhan, China.
[0008] The invention relates to the use of the hybridoma cell line in preparing monoclonal antibodies against Akkermansia muciniphila.
[0009] The hybridoma cell line is used to prepare a product for detecting Akkermansia muciniphila.
[0010] The invention relates to a monoclonal antibody against Akkermansia muciniphila, which is secreted by the hybridoma cell line.
[0011] Further, the monoclonal antibody comprises a light chain and a heavy chain, the light chain comprises a light chain LFR1, a light chain CDR-L1, a light chain LFR2, a light chain CDR-L2, a light chain LFR3, a light chain CDR-L3 and a light chain LFR4, and the amino acid sequences are shown in SEQ ID No. 1~SEQ ID No. 7; the heavy chain comprises a heavy chain HFR1, a heavy chain CDR-H1, a heavy chain HFR2, a heavy chain CDR-H2, a heavy chain HFR3, a heavy chain CDR-H3 and a heavy chain HFR4, and the amino acid sequences are shown in SEQ ID No. 8~SEQ ID No. 14.
[0012] The monoclonal antibody is used for preparing a product for detecting mucinophilic Akkermansia.
[0013] A kit for detecting mucinophilic Akkermansia, comprising the hybridoma cell strain or the monoclonal antibody.
[0014] Further, the ELISA reagent is further included.
[0015] Compared with the prior art, the beneficial effects obtained by the technical solutions are as follows.
[0016] ① Subtype identification: the obtained monoclonal antibody is subjected to subtype identification by using a monoclonal antibody subtype identification kit, and the antibody type and subtype are determined as IgG1, which provides important information for further application of the antibody.
[0017] ② Variable region sequence: the variable region sequence of the monoclonal antibody is obtained, which provides convenience for subsequent research.
[0018] ③ Titer determination: the titer of the monoclonal antibody ascites is detected by using an indirect ELISA method, and the result shows that the titer of the monoclonal antibody ascites is 4.5×10 -4 , which indicates that the antibody has high activity.
[0019] ④ Specificity: four different isolates of mucinophilic Akkermansia and other common 8 strains of 12 strains of bacteria are used as detection samples, and the specificity of the monoclonal antibody is detected by using an indirect ELISA method, and the result shows that the monoclonal antibody has strong positive immune reaction to the four strains of mucinophilic Akkermansia, and has no reaction with other bacteria, which fully proves the specificity of the antibody.
[0020] ⑤ Indirect immunofluorescence localization: the adhesion and colonization of mucinophilic Akkermansia in the colon of mice are successfully detected by using an indirect immunofluorescence localization experiment, which provides a new method and technical means for studying the mechanism of the bacteria in the intestinal tract. BRIEF DESCRIPTION OF DRAWINGS
[0021] In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the following briefly introduces the drawings required for use in the embodiments or the description of the prior art. Obviously, the drawings described below are merely embodiments of the present invention. For ordinary technicians in this field, other drawings can be obtained based on the provided drawings without paying any creative work.
[0022] Figure 1 The WB results of the monoclonal antibody and Akkermansia muciniphila in Example 4 of the present invention are shown, wherein lane 1 is Marker 250 / 150 / 100 / 70 / 50 / 40 / 35 / 25 / 20 / 15 / 10 (kDa), and lane 2 is the size result of the monoclonal antibody reaction protein;
[0023] Figure 2 This is the immunofluorescence result of mouse colon in Example 5 of the present invention. DETAILED DESCRIPTION
[0024] The following will clearly and completely describe the technical solutions in the embodiments of the present invention in conjunction with the accompanying drawings. Obviously, the described embodiments are only part of the embodiments of the present invention, not all of the embodiments. Based on the embodiments of the present invention, all other embodiments obtained by ordinary technicians in this field without making creative efforts are within the scope of protection of the present invention.
[0025] The reagents required for the present invention are conventional experimental reagents, purchased from commercial channels; the experimental methods not mentioned are conventional experimental methods and will not be described in detail here.
[0026] Example 1
[0027] Screening of hybridoma cell lines and preparation of monoclonal antibodies
[0028] 1. Materials
[0029] The strains used in this example and their sources are shown in Table 1.
[0030]
[0031] 2. Immunogen Preparation
[0032] The immunization strain A. muciniphila SDLYAKK8 was initially cultured anaerobically at 37°C for 72 h on BHI solid medium supplemented with 5% mucin and 0.25% L-cysteine hydrochloride. After PCR verification, individual colonies were transferred to 200 μL of BHI liquid medium supplemented with 5% mucin and 0.25% L-cysteine hydrochloride and incubated anaerobically at 37°C for 24 h in a 96-well plate. The culture was then transferred to 2 mL of BHI liquid medium supplemented with 5% mucin and 0.25% L-cysteine hydrochloride and cultured until logarithmic phase. The culture was then transferred to 50 mL of BHI liquid medium supplemented with 5% mucin and 0.25% L-cysteine hydrochloride and cultured until the end-logarithmic and early-stationary phase. The culture was then centrifuged at 12,000 rpm for 5 minutes at 4°C. The resulting pellet was then resuspended in 0.4% formaldehyde in PBS and incubated at 4°C for 24 hours. The pellet was then washed twice with PBS before use for immunization.
[0033] 3. Immunization of Animals
[0034] 8-week-old female SPF BALB / c mice were immunized to prepare monoclonal antibodies. Inactivated A. muciniphila SDLYAKK8 bacterial suspension (10 9 CFU / mouse) was mixed with an equal amount of Freund's complete adjuvant and emulsified, then injected subcutaneously into mice (primary immunization). Two weeks later, the same inactivated bacterial solution was mixed with Freund's incomplete adjuvant and used to immunize mice (secondary immunization). Two weeks later, the same inactivated bacterial solution was mixed with Freund's complete adjuvant and used to immunize mice (third immunization). Two weeks later, a booster immunization was performed with the same inactivated bacterial solution mixed with Freund's incomplete adjuvant and used to immunize mice (fourth immunization). After the fourth immunization, the same inactivated bacterial solution was mixed with PBS and injected intraperitoneally into the mice for a booster immunization.
[0035] 4. Cell Fusion
[0036] Three days after the last booster immunization, the eyes were removed and the animals were sacrificed. Positive control blood was collected, the spleen was removed, and a single-cell suspension was prepared. SP2 / 0 cells in the logarithmic phase were removed and treated, and then mixed with spleen cells at a cell number ratio of 1:10. 50% PEG1450 was added for 1 min, and the cells were diluted with basal medium DMEM. After low-speed centrifugation, the cells were gently suspended and mixed with HAT medium containing 20% fetal bovine serum. The suspension was then diluted to 2×10 7 / Plate onto a pre-prepared feeder cell plate and culture at 37°C with 5% CO2.
[0037] 5. Screening and cloning of hybridoma cell lines
[0038] After the cells in the fusion plate have grown to about 10,000 cells, the test is started. After the ELISA quality control is qualified (i.e., negative control <0.2, positive control >1.0), the positive wells (OD 450 ≥0.5) for subcloning. Wells with high positive test values in the fusion plate were selected for limiting dilution. 60% of the wells per plate were counted for subcloning. Each time, single clones with high positive test values were selected for limiting dilution. ELISA testing was performed 5-7 days after each subcloning step until a monoclonal cell line that consistently secreted positive antibodies was identified for expansion. Cell lines that consistently secreted positive antibodies, identified during the subcloning phase, were expanded in 24-well plates. The supernatant was collected for antigen detection. The cells were then expanded in 10 cm culture dishes, and the supernatant was again collected and assayed for antibody titer. A hybridoma cell line specifically secreting monoclonal antibodies against Akkermansia muciniphila was identified and designated 6F92E10. The cell line was cryopreserved in liquid nitrogen.
[0039] 6. Deposit of Hybridoma Cell Line 6F92E10
[0040] The hybridoma cell line 6F92E10, which is classified and named Hybridoma cell line 6F92E10, was deposited in the China Center for Type Culture Collection on June 30, 2025, with the deposit number CCTCC NO: C2025203, and the deposit address is Wuhan University, Wuhan, China.
[0041] 7. Preparation and purification of monoclonal antibody ascites
[0042] First, liquid paraffin was injected into the mouse peritoneal cavity. One week later, hybridoma cell line 6F92E10 was inoculated into the mouse peritoneal cavity. Hybridoma cell line 6F92E10 was expanded and cultured in 10% fetal bovine serum medium. When the cell density reached 1×10 6 When the volume of the solution is 100 mL, centrifuge at 800 rpm, collect the precipitate, resuspend it in PBS, and inject it intraperitoneally into mice. After 7-10 days, collect the ascites. The collected ascites is pretreated and purified using a Protein G-agarose affinity chromatography column and stored at -20°C until use.
[0043] 8. Monoclonal Antibody Subtype Identification and Ascites Titer Determination
[0044] The subtype of the monoclonal antibody obtained was identified using a monoclonal antibody subclass identification kit. For specific steps, please refer to the instructions. The antibody subtype identification results showed that the type and subtype of the antibody secreted by the hybridoma cell line 6F92E10 were IgG IgG1 (Table 2). 6The ascites titer of the monoclonal antibody was determined by indirect ELSIA method, and the results showed that the ascites titer of the monoclonal antibody reached 4.5×10 -4 .
[0045]
[0046] Example 2
[0047] Determination of monoclonal antibody light chain and heavy chain amino acid sequences
[0048] 1. RNA extraction of hybridoma cell strain 6F92E10
[0049] The cryopreservation tube containing the hybridoma cell strain 6F92E10 was immediately placed in 37°C water after being taken out from the liquid nitrogen tank, and then centrifuged at 1000 r / min for 3 min. The supernatant was removed, 1 mL of DMEM cell culture medium was quickly added to the cryopreservation tube to resuspend the cells, and then transferred to a cell culture bottle containing 10 mL of DMEM cell culture medium.
[0050] After the cultured cell strain was blown and centrifuged, the supernatant was discarded, and then washed with sterilized 1×PBS for 2 times, and then centrifuged and discarded the supernatant PBS. 1 mL of Trizol was added to the centrifuged cells, and then mixed uniformly by blowing. Chloroform was added at a ratio of 0.2 mL per 1 mL of Trizol, and then shaken vigorously for 15 seconds. After the obvious layering appeared in the EP tube at room temperature, it was centrifuged at 4°C and 12000 rpm for 15 min. The upper water sample layer was transferred to a new EP tube, and then an equal volume of isopropanol was added. After mixing thoroughly, the EP tube was inserted into ice for 30 min to precipitate the RNA, and then centrifuged at 4°C and 12000 rpm for 10 min. The supernatant was discarded, and then 1 mL of 75% ethanol was added to wash the RNA precipitate. After centrifugation at 4°C and 12000 rpm for 5 min, the supernatant was discarded, and then 50 µL of double distilled water was added to the RNA precipitate.
[0051] The dissolved RNA was aliquoted in PCR tubes according to the reverse transcription system, and the reverse transcription reaction program of the PCR instrument was set as 37°C for 15 min and 98°C for 5 min.
[0052]
[0053] The PCR reaction system was prepared (Table 5), and the designed mouse IgG VH VL primers (Table 4) were used to amplify the above cDNA. The PCR reaction was performed under the following conditions: 98°C for 5 min pre-denaturation; 94°C for 30 s denaturation; 54°C for 30 s annealing; 72°C for 2 min extension; 30 cycles, and then 72°C for 6 min extension.
[0054]
[0055]
[0056] The variable region genes of the light chain and the heavy chain of the monoclonal antibody were amplified respectively. After the variable region genes of the monoclonal antibody were connected into the pMD-18T plasmid and were transferred into DH5a, the colonies were identified by PCR, and the colonies with positive results were sent for sequencing. The monoclonal antibody gene sequence was obtained by comparing the PCR primers with the measured sequence. The gene sequences are SEQ ID No. 1-SEQ ID No. 14.
[0057] DIQMTQSPASLSASVGETVTITC, SEQ ID No. 1;
[0058] HSSENIFSYLA, SEQ ID No. 2;
[0059] WYRQKQGKSPQLLVS, SEQ ID No. 3;
[0060] HENILAE, SEQ ID No. 4;
[0061] GVPSRFSASGSGTQFSLRINSLQPEDFGSFYC, SEQ ID No. 5;
[0062] QHHYGFPWT, SEQ ID No. 6;
[0063] FGGGTKLEVK, SEQ ID No. 7;
[0064] QVQLKESGPGLVAPSQSLSITCTVSGFSLT, SEQ ID No. 8;
[0065] SFGVS, SEQ ID No. 9;
[0066] WVRQPPGKGLEWLG, SEQ ID No. 10;
[0067] VIWDDGNTNYNSTLIS, SEQ ID No. 11;
[0068] RLSISKDNSKSQVFLKLKSLQTDDTATYYCAK, SEQ ID No. 12;
[0069] LGFYVWYFDV, SEQ ID No. 13;
[0070] WGAGTTVTVSS, SEQ ID No. 14.
[0071] Example 3
[0072] Specificity detection of monoclonal antibody
[0073] The specificity of 6F92E10 mAb was detected by indirect ELSIA with 4 different isolates of M. hupilinosa (SDLYAKK5, SDLYAKK8, SDLYAKKC1 and ATTC BAA-835) and other common bacteria such as E. coli (ATCC43895, ATCC25922), S. typhimurium (CMCC50115), P. aeruginosa (ATCC15442), F. nucleatum (ATCC10953, ATCC25586), E. faecalis (E745, V583), E. faecium (E.980), L. monocytogenes (ATCC 13932), E. cloacae (ATCC23355, 002) as test samples, negative serum as negative control, M. hupilinosa SDLYAKK8 as positive control.
[0074] 1. Coating
[0075] The bacterial suspension (1 x 10 7 CFU / mL) or negative serum 100 μL / well was coated on ELSIA plates, 3 replicates for each sample, 37°C for 2 h or 4°C overnight.
[0076] 2. Blocking
[0077] After washing 3 times with PBST, block with 1% BSA in PBST for 2 h.
[0078] 3. Primary antibody incubation
[0079] After washing 3 times with PBST, add 100 μL / well of 1:5000 diluted mAb, 37°C for 1 h.
[0080] 4. Secondary antibody incubation
[0081] After washing 4 times with PBST, add 100 μL / well of 1:10000 diluted HPR labeled rabbit anti-mouse IgG secondary antibody, 37°C for 1 h.
[0082] 5. Color development
[0083] After washing 4 times with PBST, develop color with TMB substrate for 20 min.
[0084] 6. Degree observation
[0085] After termination of the termination solution, read OD 450 values with a microplate reader, and samples with OD values greater than 2.1 compared to negative OD values were positive.
[0086] The results are shown in Table 6. The monoclonal antibody had strong positive immunoreaction with 4 strains of M. huphylipila, but had no reaction with other 8 kinds of 12 strains of bacteria.
[0087]
[0088] Example 4
[0089] Western blotting experiment of monoclonal antibody
[0090] 1. Preparation of polyacrylamide gel
[0091] Prepare a separating gel solution with a concentration of 12%. Quickly add the separating gel solution into the gap between two glass plates, leaving space for pouring the concentrated gel, and carefully add 1 mL of isopropyl alcohol on the separating gel solution. After the separating gel is completely polymerized (about 30 min at 25°C), remove as much liquid as possible on the gel, and then use the edge of filter paper to absorb the residual liquid. Prepare a concentrated gel solution with a concentration of 5% (4 mL), quickly pour the concentrated gel solution directly on the polymerized separating gel, and immediately insert a clean comb into the concentrated gel solution. After the concentrated gel is completely polymerized (about 30 min at 25°C), carefully remove the comb, and add the protein electrophoresis buffer into the electrophoresis tank.
[0092] 2. Preparation of samples
[0093] After the M. huphylipila SDLYAKK8 is lysed, mix 30 μL of the extracted sample lysate with 5 μL of 6XLoading buffer, and then boil in a water bath for 5-10 min. Centrifuge the solution on the tube wall at 2500 rpm for 2 min to separate the solution from the tube wall.
[0094] 3. Electrophoresis
[0095] Slowly add the sample mixture to the sample tank using a pipette, and add 10 μL of pre-stained Marker. Turn on the power supply, and perform electrophoresis at 80 V for 30 min, and then change the voltage to 120 V until the bromophenol blue sample buffer migrates to the bottom of the gel.
[0096] 4. Wet transfer to membrane
[0097] Take the gel and immerse it in the transfer buffer. Soak the PVDF membrane in methanol for 1 min, and then dry it with filter paper. Then, immerse the PVDF membrane in the transfer buffer, and immerse the filter paper in the transfer buffer as well. Make a transfer sandwich: 3 pieces of transfer filter paper (negative black side) + gel + PVDF membrane + 3 pieces of transfer filter paper (positive white side). Place the transfer sandwich in the transfer tank, with the black side facing the black side and the white side facing the red side, and perform constant current transfer at 200 mA for 60 min.
[0098] 5. Blocking
[0099] Remove the membrane and wash once with TBS for 5 minutes each time (shake on a horizontal shaker). Remove the membrane and immerse it in blocking solution at 25°C for 1 hour or at 4°C overnight.
[0100] 6. Binding Antibodies
[0101] Remove the membrane and wash once with TBST (5 min each time, shaken horizontally). Remove the membrane and soak in primary antibody diluted in diluent at 25°C for 2 hours or overnight at 4°C. Remove the membrane and wash five times with TBST (5 min each time, shaken horizontally). Remove the membrane and soak in secondary antibody diluted in diluent at 25°C for 1 hour (goat anti-mouse-HRP 1:10,000).
[0102] 7. ECL exposure
[0103] Dilute and mix the A and B luminescent solutions in equal proportions (500µL each per membrane), place the membrane on plastic wrap, evenly drip the AB mixture onto the membrane, cover with plastic wrap, and react in the dark for 1 minute; place the membrane on filter paper to absorb the liquid (no liquid should flow out, the membrane should not be completely dry), transfer it to clean plastic wrap, wrap it (keep the front flat), and fix it in a dark box; place the dark box in a dark room, remove the film and quickly place it on the membrane inside the dark box, close the dark box, and expose it according to the observed fluorescence intensity (the exposure time is generally 1 minute, if the bands are weak, you can choose to press the film overnight); open the dark box, remove the film, and immediately and completely immerse it in the developer for 1 minute; remove the film, rinse with deionized water, and then immerse it in the fixer for 1 minute; remove the film, rinse with deionized water, and dry it, calibrate the marker, and analyze the experimental results.
[0104] The results showed that the monoclonal antibody had a specific band at 60 kDa for Akkermansia muciniphila, but no bands at other positions ( Figure 1 ). This indicates that the monoclonal antibody specifically binds to Akkermansia muciniphila and can be used for immunoblotting experiments on this bacterium.
[0105] Example 5
[0106] Indirect immunofluorescence localization of Akkermansia muciniphila adherence and colonization in mouse colon
[0107] 1. Oral administration of Akkermansia muciniphila SDLYAKK8 into mice
[0108] Sixteen 8-week-old BALB / c mice were randomly divided into two groups (experimental group and control group), with 8 mice in each group. After 1 week of acclimatization, each mouse was gavaged with a combination of antibiotics for 5 days, followed by antibiotic drinking water for 3 days. After a 2-day interval, each mouse in the experimental group was gavaged with a bacterial concentration of 1×10 9 The control group was gavaged with 200 μL of PBS in the same manner.
[0109] 2. Cryosection Preparation
[0110] On the fifth day, mice were dissected, and the colons were removed and fixed in 4% paraformaldehyde for 24 hours. The tissues were then cryoprotected by incubation in a 30% sucrose solution, allowing them to sink to the bottom of the tube. Excess sucrose was removed from the tissues, and the tissues were placed in the center of a mold filled with OCT. The tissue blocks were then frozen on dry ice and ready for sectioning.
[0111] Cut the tissue into slices with a thickness of 5 to 20 microns, use a small brush to flatten the slices, and quickly attach the frozen tissue slices to a warm glass slide that has been coated (usually Poly-L-Lysine). Store the slices in a freezer at -80°C.
[0112] 3. Staining and Observation of Frozen Sections
[0113] Remove frozen tissue sections from the refrigerator and allow to stand at room temperature for 10-20 minutes. Rinse three times with PBS for 3 minutes each. Add blocking solution to the slides and block at room temperature for 1 hour. Add primary antibody diluted in blocking solution to the slides and incubate overnight at 4°C. Rinse three times with PBS for 5 minutes each. Add secondary antibody diluted in blocking solution and incubate at room temperature for 45 minutes. Rinse three times with PBS for 5 minutes each. Apply antifade mounting solution to the slides, cover with a coverslip, and observe under a fluorescence microscope.
[0114] The results are as follows Figure 2 As shown, this method can visually show the colonization location of Akkermansia muciniphila in mouse colon.
[0115] The various embodiments in this specification are described in a progressive manner, and each embodiment focuses on the differences from other embodiments. The same or similar parts between the various embodiments can be referenced to each other.
[0116] The above description of the disclosed embodiments is intended to enable one skilled in the art to implement or use the present invention. Various modifications to these embodiments will be readily apparent to one skilled in the art, and the general principles defined herein may be implemented in other embodiments without departing from the spirit or scope of the present invention. Therefore, the present invention is not limited to the embodiments shown herein but is intended to conform to the widest scope consistent with the principles and novel features disclosed herein.
Claims
1. A hybridoma cell line 6F92E10, characterized in that: It is classified and named Hybridoma cell line6F92E10, and was deposited in the China Center for Type Culture Collection on June 30, 2025, with the deposit number CCTCC NO: C2025203, and the deposit address is Wuhan University, Wuhan, China.
2. Use of the hybridoma cell line according to claim 1 in preparing monoclonal antibodies against Akkermansia muciniphila.
3. Use of the hybridoma cell line according to claim 1 in preparing a product for detecting Akkermansia muciniphila.
4. A monoclonal antibody against Akkermansia muciniphila, characterized in that The hybridoma cell line according to claim 1 is secreted.
5. The monoclonal antibody according to claim 4, wherein The monoclonal antibody includes a light chain and a heavy chain, wherein the light chain includes a light chain LFR1, a light chain CDR-L1, a light chain LFR2, a light chain CDR-L2, a light chain LFR3, a light chain CDR-L3 and a light chain LFR4 as shown in the amino acid sequences of SEQ ID No.1 to SEQ ID No.7; and the heavy chain includes a heavy chain HFR1, a heavy chain CDR-H1, a heavy chain HFR2, a heavy chain CDR-H2, a heavy chain HFR3, a heavy chain CDR-H3 and a heavy chain HFR4 as shown in the amino acid sequences of SEQ ID No.8 to SEQ ID No.
14.
6. Use of the monoclonal antibody according to any one of claims 4 to 5 in the preparation of a product for detecting Akkermansia muciniphila.
7. A kit for detecting Akkermansia muciniphila, characterized in that: The method comprises the hybridoma cell line according to claim 1 or the monoclonal antibody according to any one of claims 4 to 5.
8. The kit according to claim 7, wherein Also includes ELISA reagents.
Citation Information
Patent Citations
Application of ackermania muciniphila in preparation of medicine for improving and treating multiple sclerosis
CN116059254A
Akkermansia Muciniphila and Product and Application Thereof
US20250059495A1