Incretin analogs as GLP-1, GIP and glucagon receptor triple agonists and uses thereof
Incretin analogs acting as triple agonists at GIP, GLP-1, and glucagon receptors provide effective glucose control and weight loss benefits with a favorable side effect profile, addressing the need for less frequent dosing and treating conditions like obesity and fatty liver disease.
Patent Information
- Application Number
- PCT/CN2025/086366
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-09-26
- Filing Date
- 2025-03-31
- Publication Date
- 2025-10-09
AI Technical Summary
Current treatments for conditions like T2DM and obesity lack effective glucose control with a favorable side effect profile, and there is a need for therapeutic agents with extended duration of action to allow for less frequent dosing, such as once a week or twice monthly.
Development of incretin analogs that act as agonists at the GIP, GLP-1, and glucagon receptors, with a protracted profile, allowing for administration as infrequently as once-a-week, and providing enhanced glucose control, metabolic benefits, and weight loss benefits through a balanced activity at each receptor.
The incretin analogs offer improved glucose control, metabolic benefits, and weight loss with a favorable side effect profile, and can treat conditions like obesity, dyslipidemia, and fatty liver disease with extended duration of action.
Smart Images

Figure PCTCN2025086366-APPB-I200002 
Figure PCTCN2025086366-APPB-I200003 
Figure PCTCN2025086366-APPB-I200006
Abstract
Description
INCRETIN ANALOGS AS GLP-1, GIP AND GLUCAGON RECEPTOR TRIPLE AGONISTS AND USES THEREOFTECHNICAL FIELD
[0001] The present invention relates to novel incretin analog compounds that are agonists of the glucagon-like peptide 1 receptor (GLP-1R) , the glucose-dependent insulinotropic polypeptide receptors (GIPR) , and the glucagon receptor (GcgR) with a protracted profile of action.BACKGROUND ART
[0002] Glucagon-like peptide-1 (GLP-1) / glucose-dependent insulinotropic polypeptide (GIP) / glucagon (Gcg) receptor triple agonists and their potential medical uses are described in several patent applications. Triple agonists with protracted effect appropriate for once-weekly administration in humans are described in WO 2019 / 125929, WO2019 / 125938, and WO 2015 / 067716. Co-administration of protracted glucagon analogs with a protracted GLP-1 / GIP co-agonist is described in WO 2017 / 009236. Triple agonists designed for extended duration of action via conjugation to an Fc fragment are described in US 2019 / 0218269 and US 2019 / 0153060. Exendin-4 derivatives with triple agonistic activity and protracted effect appropriate for once-daily administration in humans are described in WO2017009236, WO2015 / 155141, WO2014 / 096145, WO2014 / 096148, and WO 2014 / 096150. However, no triple agonistic products have so far obtained market approval.
[0003] Nevertheless, a need remains for treatments, especially for T2DM and obese patients, that are capable of providing effective glucose control, with weight loss benefits and a favorable side effect profile. There also is a need for therapeutic agents available for use with sufficiently extended duration of action to allow for dosing as infrequently as once a week or once two weeks, or oral dosing.SUMMARY OF THE INVENTION
[0004] The incretin analogs described herein seek to meet the needs above. Accordingly, this disclosure provides incretin analogs with activity at each of the GIP, GLP-1 and glucagon receptors. Advantageously, the incretin analogs described herein have balanced activity allowing for administration of doses that provide sufficient activity at each receptor to provide the benefits of agonism of that receptor while avoiding unwanted side effects associated with too much activity. Moreover, the incretin analogs described herein have extended duration of action at each of the GIP, GLP-1 and glucagon receptors allowing for dosing as infrequently as once-a-week, thrice-monthly, or twice monthly. In this manner, the incretin analogs result in enhanced glucose control, metabolic benefits such as body weight lowering and / or improved body composition, lipid benefits such as proprotein convertase subtilisin / kexin type 9 (PCSK9) lowering, and / or other benefits such as an increase in bone mass or bone formation or a decrease in bone resorption. This disclosure also provides effective treatments for other disorders or conditions, including obesity, MAFLD, MASH, dyslipidemia, and / or metabolic disorder. In one embodiment, an incretin analog is provided that includes the formula:
[0005] YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) ,
[0006] wherein
[0007] X2 is Aib, (S) -D3Aib, or (R) -D3Aib,
[0008] X13 is αMeL, αD3MeL, αMedhL / αMedhLeu, (D) -αMedhL / (D) -αMedhLeu, αMecpL / αMecpLeu, αMecbL / αMecbLeu, (D) -αMecpL / (D) -αMecpLeu, cpL / cpLeu, or cbL / cbLeu,
[0009] X14 is L, cpL, or cbL,
[0010] X16 is K, Dab, Orn, OxyK, OxyOrn, or homoK,
[0011] X17 is K, homoK, Dab, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of a fatty diacid of the formula *HOOC- (C12-C20alkylene) -COOH, to the *HOOC group of a terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2, or to the *HOOC group of a substituted carboxylic acid of the formula *HOOC- (C6-C21alkylene) -B, wherein Ra and Rb are each independently and o and p are each independently selected from 1-6;
[0012] X20 is Aib, (S) -D3Aib, or (R) -D3Aib,
[0013] X26 is L, cpL, or cbL,
[0014] X27 is L, cpL, or cbL,
[0015] and the C-terminal amino acid S is optionally amidated,
[0016] or a pharmaceutically acceptable salt thereof.
[0017] In another embodiment, a method is provided for treating a disease such as dyslipidemia, fatty liver disease, metabolic syndrome, heart failure, hypertention, MASH, MAFLD, obesity and T2DM. Such methods can include at least a step of administering to an individual in need thereof an effective amount of an incretin analog described herein. In some instances, the disease is fatty liver disease, obesity, MASH, MAFLD or T2DM.
[0018] In another embodiment, an incretin analog as described herein is provided for use in therapy. For example, an incretin analog as described herein is provided for use in treating a disease such as dyslipidemia, fatty liver disease, metabolic syndrome, MASH, MAFLD, obesity and T2DM. In some instances, the disease is fatty liver disease, obesity, MASH, MAFLD or T2DM. In another embodiment, an incretin analog as described herein is provided for use in manufacturing a medicament for treating dyslipidemia, fatty liver disease, metabolic syndrome, MASH, MAFLD, obesity and T2DM. In some instances, the disease is fatty liver disease, obesity, MASH, MAFLD or T2DM.
[0019] In another embodiment, a pharmaceutical composition is provided that includes an incretin analog as described herein and a pharmaceutically acceptable carrier, diluent or excipient.DETAILED DESCRIPTION
[0020] Definitions
[0021] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one skilled in the art to which the disclosure pertains. Although any methods and materials similar to or equivalent to those described herein can be used in the practice or testing of the incretin analogs, pharmaceutical compositions, and methods, the preferred methods and materials are described herein.
[0022] “Alkylene” means a divalent linear or branched, saturated hydrocarbon radical having the indicated number of carbon atoms. For example, “C12-C20alkylene” means a divalent linear or branched, saturated hydrocarbon radical having 12 to 20 carbon atoms, “C11-C21alkylene” means a divalent linear or branched, saturated hydrocarbon radical having 11 to 21 carbon atoms. Preferably, the alkylene is linear.
[0023] Moreover, reference to an element by the indefinite article “a” or “an” does not exclude the possibility that more than one element is present, unless the context clearly requires that there be one and only one element. The indefinite article “a” or “an” thus usually means “at least one” .
[0024] GIP is a 42-amino acid peptide (SEQ ID NO: 4) and is an incretin, which plays a physiological role in glucose homeostasis by stimulating insulin secretion from pancreatic beta cells in the presence of glucose.
[0025] GLP-1 is a 36-amino acid peptide and also is an incretin, which stimulates glucose-dependent insulin secretion and which has been shown to prevent hyperglycemia in diabetics. Amino acid residues from position 7 to position 36 of GLP-1 are shown in SEQ ID NO: 2.
[0026] Glucagon is a 29-amino acid peptide (SEQ ID NO: 1) that helps maintain blood glucose by binding to and activating glucagon receptors on hepatocytes, causing the liver to release glucose-stored in the form of glycogen-through a process called glycogenolysis.
[0027] Oxyntomodulin (OXM) is a 37-amino acid peptide including not only the 29-amino acid sequence of glucagon but also an octapeptide carboxy terminal extension (SEQ ID NO: 3) that activates both the glucagon and GLP-1 receptors, with a slightly higher potency for the glucagon receptor over the GLP-1 receptor.
[0028] In addition to T2DM, incretins and analogs thereof having activity at one or more of the GIP, GLP-1 and / or glucagon receptors have been described as having a potential for therapeutic value in a number of other conditions, diseases or disorders, including, for example, obesity, MAFLD, MASH, dyslipidemia, metabolic syndrome, bone-related disorders, Alzheimer's disease and Parkinson's Disease (See, e.g., Jall et al., (2017) Mol. Metab. 6: 440-446) ; Carbone et al., (2016) J. Gastroenterol. Hepatol. 31: 23-31; Finan et al., (2016) Trends Mol. Med. 22: 359-376; Choi et al. (2017) Potent body weight loss and efficacy in a MASH, MAFLD animal model by a novel long-acting GLP-1 Glucagon GIP triple-agonist (HM15211) , ADA Poster 1139-P; Ding (2008) J. Bone Miner: Res. 23: 536-543; Tai et al., (2018) Brain Res. 1678: 64-74; Muller et al., (2017) Physiol. Rev. 97: 721-766; Finan et al., (2013) Sci. Transl. Med. 5: 209; Holscher (2014) Biochem. Soc. Trans. 42: 593-600.
[0029] As used herein, “about” means within a statistically meaningful range of a value or values such as, for example, a stated concentration, length, molecular weight, pH, sequence identity, time frame, temperature or volume. Such a value or range can be within an order of magnitude typically within 20%, more typically within 10%, and even more typically within 5%of a given value or range. The allowable variation encompassed by “about” will depend upon the particular system under study, and can be readily appreciated by one of skill in the art.
[0030] Overview
[0031] The invention relates to GLP-1 / GIP / Gcg receptor triple agonists comprising a synthetic peptide and a substituent, wherein the substituent is covalently attached to the peptide at position 17, e. g. the substituent is linked via an distal-amino group of lysine, Ornithine, OxyOrn, or OxyLys at a position 17 in the peptide. The substituent enhances half-life of the triple agonist and comprises a protractor comprising a di-fatty acid or a terminal carboxylic acid substituted phosphonic acid and optionaly a linker. The invention also relates to pharmaceutical compositions comprising such triple agonists and pharmaceutically acceptable excipients, as well as the medical use of said triple agonists.
[0032] In one aspect, the invention relates to a GLP-1 / GIP / Gcg receptor triple agonist comprising a peptide, wherein the amino acid sequence of the peptide is:
[0033] YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) ,
[0034] wherein
[0035] X2 is Aib, (S) -D3Aib, (R) -D3Aib,
[0036] X13 is αMeL, αD3MeL, αMedhL / αMedhLeu, (D) -αMedhL / (D) -αMedhLeu, αMecpL / αMecpLeu, αMecbL / αMecbLeu, (D) -αMecpL / (D) -αMecpLeu, cpL / cpLeu, cbL / cbLeu
[0037] X14 is L, cpL, or cbL,
[0038] X16 is K, Dab, Orn, OxyK, OxyOrn, or homoK,
[0039] X17 is K, homoK, Dab, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of a fatty diacid of the formula *HOOC- (C12-C20alkylene) -COOH, to the *HOOC group of a terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2, or to the *HOOC group of a substituted carboxylic acid of the formula *HOOC- (C6-C21alkylene) -B, wherein Ra and Rb are each independently and o and p are each independently selected from 1-6,
[0040] X20 is Aib, (S) -D3Aib, (R) -D3Aib,
[0041] X26 is L, cpL, or cbL,
[0042] X27 is L, cpL, or cbL,
[0043] and the C-terminal amino acid S is optionally amidated,
[0044] or a pharmaceutically acceptable salt thereof.
[0045] Also or alternatively, in a second aspect, the invention relates to a pharmaceutical composition comprising the GLP-1 / GIP / Gcg receptor triple agonists as described herein and optionally at least one pharmaceutically acceptable excipient.
[0046] Also or alternatively, in a further aspect, the invention relates to the GLP-1 / GIP / Gcg receptor triple agonist as described herein for use as a medicament.
[0047] Also or alternatively, in a further aspect, the invention relates to the GLP-1 / GIP / Gcg receptor triple agonist as described herein for use in prevention and / or treatment of diabetes, obesity and / or liver diseases.
[0048] In a further aspect, the invention relates to a method for treating a disease such as dyslipidemia, fatty liver disease, metabolic syndrome, heart failure, hypertention, MASH, MAFLD, obesity and T2DM, comprising administering to an individual in need thereof an effective amount of the GLP-1 / GIP / Gcg receptor triple agonist as described herein. In some instances, the disease is fatty liver disease, obesity, MASH, MAFLD or T2DM.
[0049] Description of the peptide
[0050] The GLP-1 / GIP / Gcg receptor triple agonists described herein comprise a peptide and a substituent wherein the substituent is attached to the peptide backbone via an amino acid residue, e. g. via a functional group on an amino acid side chain. In some embodiments, the GLP-1 / GIP / Gcg receptor triple agonists comprise a peptide, wherein the amino acid sequence of the peptide is:
[0051] YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) ,
[0052] wherein
[0053] X2 is Aib, (S) -D3Aib, or (R) -D3Aib,
[0054] X13 is αMeL, αD3MeL, αMedhL / αMedhLeu, (D) -αMedhL / (D) -αMedhLeu, αMecpL / αMecpLeu, αMecbL / αMecbLeu, (D) -αMecpL / (D) -αMecpLeu, cpL / cpLeu, or cbL / cbLeu
[0055] X14 is L, cpL, or cbL,
[0056] X16 is K, Dab, Orn, OxyK, OxyOrn, or homoK,
[0057] X17 is K, Dab, homoK, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of a fatty diacid of the formula *HOOC- (C12-C20alkylene) -COOH, to the *HOOC group of a terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2, or a to the *HOOC group of substituted carboxylic acid of the formula*HOOC- (C6-C21alkylene) -B, wherein Ra and Rb are each independently and o and p are each independently selected from 1-6,
[0058] X20 is Aib, (S) -D3Aib, or (R) -D3Aib,
[0059] X26 is L, cpL, or cbL,
[0060] X27 is L, cpL, or cbL,
[0061] and the C-terminal amino acid S is optionally amidated,
[0062] or a pharmaceutically acceptable salt thereof.
[0063] The amino acid sequences of incretin analogs described herein incorporate naturally occuring amino acids, typically depicted herein using standard one letter or three letter codes (e.g., L=Leu=leucine) , as well as alpha-methyl substituted residues of natural amino acids (e.g., α-methyl leucine (αMeL / αMeLeu) and α-methyl lysine (αMeK / αMeLys) , and certain other unnatural amino acids, such as alpha amino isobutyric acid (Aib) . The structures of these non-limiting un-natual amino acids and non-essential amino acids used in the invention are depicted and named below:
[0064] As noted above, the incretin analogs described herein have structural similarities to, but many structural differences, from any of the native human peptides. For example, when compared to native human GIP (SEQ ID NO: 4) , the incretin analogs described herein include modifications at one or more of positions 2, 3, 7, 13, 14, 16, 17, 18, 20, 21, 23-25, 28-29 and 30-42. In some instances, the incretin analogs described herein include modifications to the amino acids of native human GIP (SEQ ID NO: 4) at each of positions 2, 3, 7, 13, 14, 16, 17, 18, 20, 21, 23-25, 29 and 30-42. In certain instances, the incretin analogs described herein include the following amino acid modifications: Aib or D3Aib at position 2; Q at position 3; T at position 7; αMeL, aD3MeL, αMecpL, αMecbL or αMedhL at position 13; L, cpL or cbL at position 14; a modified K, homoK, Orn, OxyOrn, or OxyK residue at position 17 that is modified through conjugation the distal-amino group of the K, homoK, Orn, OxyOrn, or OxyK-side chain, optionally via a linker, to the *HOOC-group of a fatty diacid of the formula *HOOC- (C12-C20alkylene) -COOH, to the *HOOC group of a terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2, or to the *HOOC group of a substituted carboxylic acid of the formula of *HOOC- (C6-C21alkylene) -B, wherein wherein Ra and Rb are each independently , and o and p are each independently selected from 1-6; A at position 18; A at position 21; I at position 23; E at position 24; Y at position 25; G at position 29; and replacement of the amino acids at positions 30-42 of native human GIP (SEQ ID NO: 4) with an amino acid sequence selected from GPSSGAPPPS. In certain instances, the incretin analogs described herein are amidated. In addition to the changes described herein, the incretin analogs described herein may include one or more additional amino acid modifications, provided, however, that the analogs remain capable of binding to and activating each of the GIP, GLP-1 and glucagon receptors. As noted above, the incretin analogs described herein include a fatty acid moiety or a phosphonic acid, moiety conjugated, for example, by way of a linker to a natural or unnatural amino acid with a functional group available for conjugation. Such a conjugation is sometimes referred to as amidation, i.e., attachment via an amide bond. In certain instances, the amino acid with a functional group available for conjugation can be K, homoK, Orn, OxyOrn, or OxyK. In particular instances, the amino acid with a functional group available for conjugation is K, Orn, OxyOrn, or OxyK, where the conjugation is to an distal-amino group of a K, Orn, OxyOrn, or OxyK side-chain.
[0065] The amidation of the incretin analogs described herein is at position 17 in SEQ ID NO: 5, which was determined to be the optimal location for inclusion of this structure. As a substituent, the fatty diacid or a terminal carboxylic acid substitued fatty phosphonic acid, or the *HOOC- (C6-C21alkylene) -B moietyt (wherein Ra and Rb are each independently and o and p are each independently selected from 1-6) , the *HOOC-group of a fatty diacid of the formula *HOOC- (C12-C20alkylene) -COOH, the *HOOC-group of the terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2, or the *HOOC-group of the formula of *HOOC- (C6-C21alkylene) -B (wherein Ra and Rb are each independently and o and p are each independently selected from 1-6) , forms an amide bond through the *HOOC group with the distal amino group of the position 17 amino acid, and in certain embodiments, via a linker, acts as albumin binders, and provides a potential to generate long-acting compounds. The incretin analogs described herein comprise a C12 -C22 fatty diacid moiety, a terminal carboxylic acid substitued C11-C21 phosphonic acid moiety or the *HOOC- (C6-C21alkylene) -B moiety, wherein Ra and Rb are each independently and o and p are each independently selected from 1-6, chemically conjugated through the *HOOC group via an amide bond to the distal amino group of the position 17 amino acid either directly or via a linker. The length and composition of the C12-C22 fatty diacid or the terminal carboxylic acid substitued C11-C22 fatty phosphonic acid or the *HOOC- (C6-C21alkylene) -B, wherein Ra and Rb are each independently and o
[0066] and p are each independently selected from 1-6, impacts half-life of the incretin analogs, their potency in in vivo animal models, and their solubility, stability and bioavailability. Conjugation to a C12-C22 fatty diacid or a terminal carboxylic acid substitued C11-C21 phosphonic acid or a *HOOC- (C6-C21alkylene) -B moiety, wherein Ra and Rb are each independently and o and p are each independently selected from 1-6, results in incretin analogs that exhibit desirable half-life, desirable potency in in vivo animal models, and desirable solubility and stability characteristics, as well as desirable bioavailability. Examples of saturated C12-C22 fatty diacids (i.e., *HOOC- (C12-C20alkylene) -COOH described above) for use herein include, but are not limited to the following
[0067] Examples of saturated terminal carboxylic acid substitued C11-C21 phosphonic acids (also known as C11-C21 phosphono fatty acid, i.e., *HOOC- (C11-C21alkylene) -PO3H2 described above) for use herein include, but are not limited to the following
[0068] Example of substituted carboxylic acid of the formula *HOOC- (C6-C21alkylene) -B, (wherein Ra and Rb are each independently and o and p are each independently selected from 1-6) for use herein include those wherein is, but not limited to the following
[0069] In certain instances, the saturated C11-C21 phosphono fatty acid for use herein includes, but are not limited to, 14-phosphonotetradecanoic acid, 15-phosphonopentadecanoic acid, 16-phosphonohexadecanoic acid, 17-phosphonoheptadecanoic acid, 18-phosphonooctadecanoic acid, 19-phosphonononadecanoic acid, 20-phosphonoicosanoic acid, 21-phosphonohenicosanoic acid. In all cases, the phosphono fatty acid chains are attached to the incretin analogs backbone X17 (position 17) via the carboxylic acid group, optionaly via a linker, through amide formation to X17, leaving the phosphonic acid free.
[0070] In certain instances, the C11-C21 phosphono fatty acid can be a saturated 15-phosphonopentadecanoic acid, 16-phosphonohexadecanoic acid, 17-phosphonoheptadecanoic acid, 18-phosphonooctadecanoic acid, 19-phosphonononadecanoic acid, and branched and substituted derivatives thereof. In more particular instances, C11-C21 phosphono fatty acid can be a saturated 15-phosphonopentadecanoic acid, 16-phosphonohexadecanoic acid, 17-phosphonoheptadecanoic acid, 18-phosphonooctadecanoic acid, 19-phosphonononadecanoic acid. In all cases, the phosphono fatty acid chains are attached to the incretin analogs backbone X17 (position 17) via the carboxylic acid group through amide formation optionally via a linker to X17, leaving the phosphonic acid free.
[0071] In certain instances, in the substituted carboxylic acid of the formula *HOOC- (C6-C21alkylene) -B moietyt, wherein both Ra and Rb can be or both Ra and Rb can be or both Ra and Rb can be or Ra and Rb can be any combination of two of and o and p are each independently selected from 1-6. In all cases, *HOOC- (C6-C21alkylene) -B are attached to the incretin analogs backbone X17 (position 17) via the *HOOC group through amide formation optionally via a linker to X17, leaving the B moiety free.
[0072] In some instances, the linker can have from one to four amino acids, an amino polyethylene glycol acetate, an amino polyethylene glycol propionate or an amino polypropylene glycol acetate, or mixtures thereof. In certain instances, the amino polyethylene glycol acetate, the amino polyethylene glycol propionate or the an amino polypropylene glycol acetate have the following structure:
[0073] H- {NH- (CH2) q-O- (CH2) m-O- (CH2) s-CO} r-OH
[0074] where m, q is any integer from 2 to 8, s is any integer from 1 to 10, and r is 0 to 10.
[0075] In certain instances, the linker can have one or more (2- [2- (2-amino-ethoxy) -ethoxy] -acetyl) moieties, optionally in combination with one to four amino acids.
[0076] In certain instances, the linker can have one or more (2- [2- (2-amino-propyloxy) -ethoxy] -acetyl) moieties, optionally in combination with one to four amino acids.
[0077] In certain instances, the linker can have one or more (2- [2- (2-amino-ethoxy) -propyloxy] -acetyl) moieties, optionally in combination with one to four amino acids.
[0078] In certain instances, the linker can have one or more (2- [2- (2-amino-ethoxy) -ethoxy] -propionyl) moieties, optionally in combination with one to four amino acids.
[0079] In certain instances, the linker can be a short peptide with two to four amino acids. In instances in which the linker includes at least one amino acid, the amino acid can be one to four Glu or γGlu amino acid residues. In some instances, the linker can include one or two Glu or γGlu amino acid residues, including the D-forms thereof. For example, the linker can include either one or two γGlu amino acid residues. Alternatively, the linker can include one to four amino acid residues (such as, for example, Glu or γGlu amino acids) used in combination with up to thirty-six (2- [2- (2-amino-ethoxy) -ethoxy] -acetyl) moieties. Specifically, the linker can be combinations of one to four Glu or γGlu amino acids and one to four (2- [2- (2-amino-ethoxy) -ethoxy] -acetyl) moieties, or (2- [2- (2-amino-propyloxy) -ethoxy] -acetyl) moieties, or (2- [2- (2-amino-ethoxy) -propyloxy] -acetyl) moieties, or (2- [2- (2-amino-ethoxy) -ethoxy] -propionyl) moieties. In other instances, the linker can be combinations of one or two γGlu amino acids and one or two (2- [2- (2-amino-ethoxy) -ethoxy] -acetyl) moieties or (2- [2- (2-amino-propyloxy) -ethoxy] -acetyl) moieties, or (2- [2- (2-amino-ethoxy) -propyloxy] -acetyl) moieties, or (2- [2- (2-amino-ethoxy) -ethoxy] -propionyl) moieties.
[0080] In instances in which the linker includes at least three amino acids, the amino acid can be one to four Glu or γGlu amino acid residues, one to four lysine; the amino acid can be one to four Glu or γGlu amino acid residues, one to four ornithine; the amino acid can be one to four Glu or γGlu amino acid residues, one to four (S) -2, 4-diamino butanoic acid; the amino acid can be one to four Glu or γGlu amino acid residues, two to four combination of lysine, Ornithine or (S) -2, 4-diamino butanoic acid. In some instances, the linker can include two to four of Glu or γGlu amino acid residues, including the D-forms thereof.
[0081] In a instance, the incretin analogs described herein have linker and fatty acid components having the structure of the following formula:
[0082] (2- [2- (2-amino-ethoxy) -ethoxy] -acetyl) a- (γGlu) b-CO- (CH2) c-CO2H, or (AEEA) a- (γGlu) b-CO- (CH2) c-CO2H
[0083] wherein a is 0, 1 or 2, b is 1 or 2, and c is 15, 16, 17 or 18. In a particular instance, a is 1, b is 1, and c is 18.
[0084] In another instance, the incretin analogs described herein have linker and phosphonic acid components having the structure of the following formula:
[0085] (2- [2- (2-amino-ethoxy) -ethoxy] -acetyl) a- (γGlu) b-CO- (CH2) c-PO3H2, or (AEEA) a- (γGlu) b-CO- (CH2) c-PO3H2,
[0086] wherein a is 0, 1 or 2, b is 1 or 2, and c is 15, 16, 17, 18 or 19. In a particular instance, a is 1, b is 1, and c is 16, 17, 18 or 19.
[0087] In another instance, the incretin analogs described herein have linker and diacid components having the structure of the following formula:
[0088] (2- [2- (2-amino-ethoxy) -ethoxy] -acetyl) a- (γGlu) b-CO- (CH2) c-B, or , (AEEA) a- (γGlu) b-CO- (CH2) c-B, wherein Ra and Rb are each independently o and p are each independently selected from 1-6, and a is 0, 1 or 2, b is 1 or 2, and c is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a is 1, b is 1, and c is 14, 15 or16, p and o are both 1.
[0089] In a instance, the incretin analogs described herein have linker and fatty acid components having the structure of the following formula:
[0090] (Lys) a- (γGlu) b-CO- (CH2) c-CO2H,
[0091] wherein a is 1, 2, or 3, b is 1 or 2, and c is 15, 16, 17 or 18. In a particular instance, a is 2, b is 1, and c is 16, 17 or 18.
[0092] In a instance, the incretin analogs described herein have linker and phosphonic acid components having the structure of the following formula:
[0093] (Lys) a- (γGlu) b-CO- (CH2) c-PO3H2,
[0094] wherein a is 1, 2 or 3, b is 1 or 2, and c is 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a is 2, b is 1, and c is 16, 17 or 18.
[0095] In a instance, the incretin analogs described herein have linker and fatty acid components having the structure of the following formula:
[0096] (Orn) a- (γGlu) b-CO- (CH2) c-CO2H,
[0097] wherein a is 1, 2 or 3, b is 1 or 2, and c is 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a is 2, b is 1, and c is 16, 17 or 18.
[0098] In a instance, the incretin analogs described herein have linker and phosphonic acid components having the structure of the following formula:
[0099] (Orn) a- (γGlu) b-CO- (CH2) c-PO3H2,
[0100] wherein a is 1, 2 or 3, b is 1 or 2, and c is 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a is 2, b is 1, and c is 16, 17 or 18.
[0101] In a instance, the incretin analogs described herein have linker and fatty acid components having the structure of the following formula:
[0102] (Dab) a- (γGlu) b-CO- (CH2) c-CO2H,
[0103] wherein a is 1, 2 or 3, b is 1 or 2, and c is 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a is 2, b is 1, and c is 16, 17 or 18.
[0104] In a instance, the incretin analogs described herein have linker and phosphonic acid components having the structure of the following formula:
[0105] (Dab) a- (γGlu) b-CO- (CH2) c-PO3H2,
[0106] wherein a is 1, 2 or 3, b is 1 or 2, and c is 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a is 2, b is 1, and c is 16, 17 or 18.
[0107] In a instance, the incretin analogs described herein have linker and fatty acid components having the structure of the following formula:
[0108] (Orn) a- (Lys) a1- (γGlu) b-CO- (CH2) c-CO2H,
[0109] wherein a is 1, or 2, a1 is 1, or 2, b is 1 or 2, and c is 15, 16, 17, 18 or 19. In a particular instance, a is 1, a1 is 1, b is 1, and c is 16, 17 or 18.
[0110] In another instance, the incretin analogs described herein have linker and phosphonic acid components having the structure of the following formula:
[0111] (Orn) a- (Lys) a1- (γGlu) b-CO- (CH2) c-PO3H2,
[0112] wherein a is 1 or 2, a1 is 1 or 2, b is 1 or 2, and c is 15, 16, 17, 18 or 19. In a particular instance, a is 1, a1 is 1, b is 1, and c is 16, 17 or 18.
[0113] In a instance, the incretin analogs described herein have linker and fatty acid components having the structure of the following formula:
[0114] (Dab) a- (Lys) a1- (γGlu) b-CO- (CH2) c-CO2H,
[0115] wherein a is 1, or 2, a1 is 1 or 2 , b is 1 or 2, and c is 15, 16, 17, 18 or 19. In a particular instance, a is 1, B is 1, b is 1, and c is 16, 17 or 18.
[0116] In another instance, the incretin analogs described herein have linker and phosphonic acid components having the structure of the following formula:
[0117] (Dab) a- (Lys) a1- (γGlu) b-CO- (CH2) c-PO3H2,
[0118] wherein a is 1 or 2, a1 is 1 or 2 b is 1 or 2, and c is 15, 16, 17, 18 or 19.
[0119] In a particular instance, a is 1, a1 is 1, b is 1, and c is 16, 17 or 18.
[0120] In another instance, the incretin analogs described herein have linker and components having the structure of the following formula:
[0121] (Lys) a- (γGlu) b-CO- (CH2) c-B, or (AEEA) a- (γGlu) b-CO- (CH2) c-B, wherein Ra and Rb are each independently o and p are each independently selected from 1-6, and
[0122] a is 1 or 2, b is 1 or 2, and c is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a is 2, b is 1, and c is 13, 14, 15 or 16, p and o are both 1.
[0123] In another instance, the incretin analogs described herein have linker and components having the structure of the following formula:
[0124] (Orn) a- (γGlu) b-CO- (CH2) c-B, or (AEEA) a- (γGlu) b-CO- (CH2) c-B, wherein Ra and Rb are each independently o and p are each independently selected from 1-6, and
[0125] a is 1 or 2, b is 1 or 2, and c is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a is 2, b is 1, and c is 13, 14, 15 or 16, p and o are both 1.
[0126] In another instance, the incretin analogs described herein have linker and components having the structure of the following formula:
[0127] (Dab) a- (γGlu) b-CO- (CH2) c-B, or (AEEA) a- (γGlu) b-CO- (CH2) c-B, wherein Ra and Rb are each independently o and p are each independently selected from 1-6, and
[0128] a is 1 or 2, b is 1 or 2, and c is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a is 2, b is 1, and c is 13, 14, 15 or 16, p and o are both 1.
[0129] In another instance, the incretin analogs described herein have linker and components having the structure of the following formula:
[0130] (Dab) a1- (Orn) a2- (Lys) a3- (γGlu) b-CO- (CH2) c-B, or (AEEA) a- (γGlu) b-CO- (CH2) c-B, wherein Ra and Rb are each independently o and p are each independently selected from 1-6, and
[0131] a1, a2, a3 are 0, 1 or 2, b is 1 or 2, and c is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19. In a particular instance, a1 is 2, a2 is 0, a3 is 1, b is 1, and c is 13, 14, 15 or 16, p and o are both 1.
[0132] In a specific instance, the incretin analogs described herein have linker and fatty acid or phosphonic acid, or diacids components having the structure examplified but not limited as follows, also termed as a substituents or a side chain in the incretin analogs.
[0133] In some embodiments, the linker and fatty acid or phosphonic acid or the diacid components are the substituents or side chains used in the incretin analogs. Preferably, any of the substituents or side chains is attached to the peptide shown in
[0134] YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) at position 17 ‘sLys, homoLys, oxyOrn, Dab, Orn, or OxyLys. The hairpin line indicates the amide bond formed between the side chain and the distal amino group of K, homoK, Dab, Orn, OxyK, or OxyOrn at X17 position of YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS-NH2 (SEQ ID NO:5, wherein the C-terminal amino acid S is amidated) .
[0135] In some embodiments, the side chains are attached to the distal amino group of K, Dab, homoK, Orn, OxyK, or OxyOrn at X17 position.
[0136] In some embodiments, the substituent or side chain is attached to the peptide shown in YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS-NH2 (SEQ ID NO:5, wherein the C-terminal amino acid S is amidated) , wherein X13 is cbLeu or cpLeu; In some embodiments, the substituent or side chain is attached to the peptide shown in YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS-NH2 (SEQ ID NO: 5, wherein the C-terminal amino acid S is amidated) , wherein X14 is αMecbLeu or αMecpLeu.
[0137] In some embodiments, the substituent or side chain is attached to the peptide shown in YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS-NH2 (SEQ ID NO: 5, wherein the C-terminal amino acid S is amidated) , wherein X17 is Dab, Orn, homoLys, OxyOrn, or OxyLys.
[0138] In some embodiments, the substituent or side chain is attached to the peptide shown in YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS-NH2 (SEQ ID NO: 5, wherein the C-terminal amino acid S is amidated) , wherein X26 is cbLeu or cpLeu; In some embodiments, the substituent or side chain is attached to the peptide shown in YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS-NH2 (SEQ ID NO: 5, wherein the C-terminal amino acid S is amidated) , wherein X27 is cbLeu or cpLeu;
[0139] In the preparation of the incretin analogs of the present invention, building blocks of the substituents or side chains are used. The side chains shown but not limited to the following are attached to the K17 distal amino group via an amide bond after the whole peptide backbone is synthesized and the K-17 distal amino group is deprotected. The protecting groups are then removed and the naked poly-peptide is purified to afford the incretin analogs.
[0140] Alternatively the side chain building blocks are treated as single amino acid in the solid phase synthesis of certain incretin analogs. Building blocks of the substituents or side chains used in the preparation of some of the incretin analogs are exemplified as follows.
[0141] EXAMPLES
[0142] This experimental part starts with a general method for synthesizing and characterizing the triple agonists as described herein. Then follows a number of examples which relate to preparation of specific triple agonists, and at the end a number of examples relating to the activity and properties of the triple agonists.
[0143] Examples serve to illustrate the invention.
[0144] In the present application, when the name of a compound (including those described using the three letter amino acid codes) is inconsistent with its structural formula, the structure represented by the formula shall prevail.
[0145] LIST OF ABBREVIATIONS
[0146] The following abbreviations are used in the following, in alphabetical order:
[0147] Ac: acetyl
[0148] Aib: alpha-aminoisobutyric acid (or α-aminoisobutyric acid)
[0149] APl-ES: atmospheric pressure ionization-electrospray
[0150] AUC: area under the curve
[0151] BHK: baby hamster kidney
[0152] Boc: tert-butyloxycarbonyl
[0153] BW: body weight
[0154] Cl-HOBt: 6-chloro-1-hydroxybenzotriazole
[0155] CRE: CAMP response element
[0156] Dab: L-2, 4-diaminobutyric acid
[0157] DCM: dichloromethane
[0158] DDE: 2-acetyl-5, 5-dimethylcyclohexane-1, 3-dione
[0159] DIC: diisopropylcarbodimide
[0160] DIPEA: N, N-disopropylethylamine
[0161] DMEM: Dulbecco's Modified Eagle's Medium
[0162] DPBS: Dulbecco's phosphate buffered saline
[0163] EDTA: ethylenediamine tetraacetic acid
[0164] ELISA: enzyme linked immunosorbent assay
[0165] equiv: molar equivalent
[0166] FBS: fetal bovine serum
[0167] Fmoc: 9-fluorenylmethyloxycarbonyl
[0168] Gcg: glucagon
[0169] GcgR: glucagon receptor
[0170] GIP: glucose-dependent insulinotropic polypeptide
[0171] GIPR: glucose-dependent insulinotropic polypeptide receptor
[0172] GLP-1: glucagon-like peptide 1
[0173] GLP-1R: glucagon-like peptide 1 receptor
[0174] HEPES: 4- (2-hydroxyethyl) -1-piperazine ethanesulfonic acid
[0175] HFIP: 1, 1, 1, 3, 3, 3-hexafluoro-2-propanol or hexafluoroisopropanol
[0176] hGcgR: human glucagon receptor
[0177] hGIPR: human glucose-dependent insulinotropic polypeptide receptor
[0178] hGLP-1R: human glucagon-like peptide 1 receptor
[0179] HPLC: high performance liquid chromatography
[0180] i.p: intraperitonea
[0181] IPGTT: intraperitoneal glucose tolerance test
[0182] i.v. intravenously
[0183] LCMS: liquid chromatography mass spectroscopy
[0184] MeCN: acetonitrile
[0185] mM: millimolar
[0186] mmol: millimoles
[0187] min: minutes
[0188] Mtt: 4-methyltrity
[0189] MW: molecular weight
[0190] nM: nanomolar
[0191] NMP: 1-methyl-pyrrolidin-2-one
[0192] OtBu: tert-butyl ester
[0193] Oxyma pure: Ethyl 2-cyano-2- (hydroxyimino) acetate
[0194] PBS: phosphate buffered saline
[0195] PK: pharmacokinetic
[0196] pM: picomolar
[0197] rpm: rounds per minute
[0198] Rt: retention time
[0199] SEM: standard error of the mean
[0200] SPPS : solid phase peptide synthesis
[0201] tBu: tert-butyl
[0202] TFA: trifluoroacetic acid
[0203] TIS: trisopropylsilane
[0204] Trt: triphenylmethyl or trityl
[0205] Trx: tranexamic acid
[0206] TSTU: O- (N-succinimidyl) -1, 1, 3, 3-tetramethyluronium tetrafluoroborate
[0207] FBS: fetal bovine serum
[0208] Fmoc: 9-fluorenylmethyloxycarbonyl
[0209] General Methods of Preparation
[0210] Preparation of unnatural amino acids and phosphonic acid side chains used in the invention
[0211] Preparation 1: (R) -D3Aib and (S) -D3Aib
[0212] SM-1A was prepared as described by Yi Hsiao and Louis S. Hegedus (J. Org. Chem. 1997, 62, 3586-3591) . It was then alkylated with CD3I stereospecifically and then hydrolyzed to give (R) -D3Aib similarly as described Yi Hsiao and Louis S. Hegedus (J. Org. Chem. 1997, 62, 3586-3591) .
[0213] (S) -D3Aib was prepared in identical manner.
[0214] Preparation 2: (D) -αMedhL / (D) -αMedhLeu and αMedhL / αMedhLeu
[0215] In the same manner as described in Preparation 1, using 2-methylallyl bromide instead CD3I as the alkylation reagent to react with SM-1A or SM-1B, followed by extensive hydrolysis affored (D) -αMedehydroleucine ( (D) -αMedhL / (D) -αMedhLeu) or αMedehydroleucine (αMedhL / αMedhLeu) .
[0216] 1H NMR (400 MHz, Methanol-d4) δ 5.08 (s, 1H) , 4.97 (s, 1H) , 2.82 (d, J = 14.2 Hz, 1H) , 2.57 (d, J = 14.3 Hz, 1H) , 1.80 (s, 3H) , 1.61 (s, 3H) .
[0217] Preparation 3: (L) -αMecpL / (D) -αMecpLeu and Fmoc- (L) -αMecpL / Fmoc- (D) -αMecpLeu
[0218] The racemic αMecyclopropyl leucine was prepared according to the reported procedure in Martínez-Mingo, Mario; García-Viada, Andrés; Prendes, Daniel Sowa; Alonso, Inés; Rodríguez, Nuria; Arrayás, Ramón Gómez; Carretero, Juan C. [Angewandte Chemie-International Edition, 2022, vol. 61, #47, art. no. E202209865] [Angew. Chem., 2022, vol. 134, #47] or WO2014086805A1. The racemic amino acid tButyl ester is then resolved with Di-p-toluoyl-L-tartaric acid and Di-p-toluoyl-D-tartaric acid, and then the ester is hydrolyzed and Fmoc protected to give (L) -αMecpL / (D) -αMecpLeu and Fmoc- (L) -αMecpL / Fmoc- (D) -αMecpLeu.
[0219] Preparation 4: (L) -αMecbL / (D) -αMecbLeu and Fmoc- (L) -αMecbL / Fmoc- (D) -αMecbLeu
[0220] Using the same methods described in Preparation 3, (L) -αMecbL / (D) -αMecbLeu and Fmoc- (L) -αMecbL / Fmoc- (D) -αMecbLeu were prepared.
[0221] Preparation 5: (L) / (D) -cpL / (L) / (D) -cpLeu and cpL / cpLeu
[0222] (L) / (D) -cpL / (L) / (D) -cpLeu and cpL / cpLeu were prepared as reported by Hamon, Christian;
[0223] Rawlings, Bernard J. in “A Convenient Synthesis Of (L) -β-Cyclopropylalanine” [Synthetic Communications, 1996, vol. 26, #6, p. 1109-1115] .
[0224] 1H NMR (400 MHz, DMSO-d6) δ 12.51 (s, 1H) , 7.86 (d, J = 7.5 Hz, 2H) , 7.70 (dd, J = 7.5, 2.7 Hz, 2H) , 7.64 (d, J = 8.1 Hz, 1H) , 7.38 (td, J = 7.4, 1.1 Hz, 2H) , 7.29 (tt, J = 7.4, 1.4 Hz, 2H) , 4.28 - 4.15 (m, 3H) , 3.97 (td, J = 8.8, 4.8 Hz, 1H) , 1.62 (ddd, J = 13.9, 9.3, 6.4 Hz, 1H) , 1.43 (ddd, J = 13.9, 7.7, 4.9 Hz, 1H) , 0.76 (tt, J = 7.8, 4.9 Hz, 1H) , 0.44 - 0.29 (m, 2H) , 0.18 -0.08 (m, 1H) .
[0225] Preparation 6: (D) -cbL / (D) -cbLeu and cbL / cbLeu
[0226] (L) / (D) -cbL / (L) / (D) -cbLeu and cbL / cbLeu were prepared as Preparation 5.
[0227] 1H NMR (400 MHz, DMSO-d6) δ 12.54 (s, 1H) , 7.90 (d, J = 7.5 Hz, 2H) , 7.73 (dd, J = 7.6, 2.7 Hz, 2H) , 7.58 (d, J = 8.2 Hz, 1H) , 7.42 (td, J = 7.5, 1.1 Hz, 2H) , 7.33 (t, J = 7.4 Hz, 2H) , 4.37 -4.14 (m, 3H) , 3.92 - 3.74 (m, 1H) , 2.35 (hept, J = 7.9 Hz, 1H) , 1.97 (dtp, J = 11.4, 7.4, 3.9 Hz, 2H) , 1.87 - 1.49 (m, 6H) .
[0228] Preparation 7: DDE-Fmoc oxyOrn
[0229] Commercially available SM-7A was alkylated with bromoacetonitrile as reported in Example 12 of CN106543227A. The resulting nitrile is hydrogenated to afford the alpha amino Boc protected oxyornithine SM-7C, the free amino group is protected by DDE and the Boc protecting group is then deprotected and the resulting amino group is reprotected with Fmoc to afford SM-7F / DDE-Fmoc oxyOrn after purification. 1H NMR (400 MHz, Chloroform-d) δ13.50 (s, 1H) , 8.58 (s, 1H) , 7.78 (d, J = 7.5 Hz, 2H) , 7.66 (dd, J = 7.5, 5.0 Hz, 2H) , 7.41 (t, J =7.5 Hz, 2H) , 7.31 (tdd, J = 7.5, 2.5, 1.2 Hz, 2H) , 6.41 (d, J = 8.3 Hz, 1H) , 4.69 - 4.59 (m, 1H) , 4.45 (dd, J = 10.4, 7.2 Hz, 1H) , 4.34 (dd, J = 10.4, 7.5 Hz, 1H) , 4.26 (t, J = 7.3 Hz, 1H) , 4.09 (dd, J = 9.4, 3.3 Hz, 1H) , 3.84 (dd, J = 9.4, 2.9 Hz, 1H) , 3.79 - 3.68 (m, 2H) , 3.60 (d, J = 6.0 Hz, 2H) , 2.57 (s, 3H) , 2.38 (s, 4H) , 0.99 (s, 6H) .
[0230] Preparation 8: DDE-Fmoc oxyLys
[0231] Commercially available SM-8A was alkylated with Acrylonitrile as reported in Climie, I.J.; Evans, D.A. in “13C-Nuclear Magnetic Resonance spectroscopy as a probe of enzyme environment-II: Effect of solvent and pH on 13C-chemical shifts in derivatized amino-acid models” [Tetrahedron, 1982, vol. 38, p. 697] . The resulting nitrile is hydrogenated to afford the alpha amino Boc protected oxylys SM-8C, the free amnio group is protected by DDE and the Boc protecting group is then deprotected and the resulting amino group is re-protected with Fmoc to afford SM-8F / DDE-Fmoc oxyLys. 1H NMR (400 MHz, Chloroform-d) δ 13.33 (d, J = 5.2 Hz, 1H) , 7.78 (d, J = 7.5 Hz, 2H) , 7.67 (t, J = 7.3 Hz, 2H) , 7.42 (t, J = 7.5 Hz, 2H) , 7.33 (t, J = 7.4 Hz, 2H) , 6.41 (d, J = 8.5 Hz, 1H) , 4.60 (dt, J = 8.9, 3.3 Hz, 1H) , 4.41 (qd, J = 10.6, 7.3 Hz, 2H) , 4.27 (t, J = 7.3 Hz, 1H) , 3.94 (dd, J = 9.3, 3.1 Hz, 1H) , 3.83 - 3.66 (m, 2H) , 3.55 (tdq, J = 19.6, 13.8, 7.2, 6.5 Hz, 3H) , 2.56 (s, 3H) , 2.42 (s, 4H) , 2.10 - 1.86 (m, 2H) , 1.03 (s, 6H) .
[0232] Preparation 9: 19- (bis (benzyloxy) phosphoryl) nonadecanoic acid
[0233] Commercially available SM-9A was refluxed in methanol with 2 equivalents of thionyl chloride. The resulting esterified solution was concentrated and worked up to afford the methyl ester, which was reacted with methanesulfonyl chloride to afford the Ms ester. The Ms ester was then reacted with Dibenzyl phosphite and Cs2CO3 in DMF at 60-80℃ to afford the phosphonate. The phosphonate was then selectively hydrolyzed with LiOH in water and ethanol mixture at room temperature to afford 19- (bis (benzyloxy) phosphoryl) nonadecanoic acid after silica gel chromatography purification. 1H NMR (400 MHz, Chloroform-d) δ 7.47 - 7.27 (m, 9H) , 5.08 (dd, J = 11.9, 8.8 Hz, 2H) , 4.99 (dd, J = 11.9, 8.0 Hz, 2H) , 2.36 (t, J = 7.5 Hz, 2H) , 1.77 (ddd, J = 18.1, 9.7, 6.2 Hz, 2H) , 1.70 - 1.50 (m, 4H) , 1.26 (d, J = 12.3 Hz, 28H) .
[0234] 20- (bis (benzyloxy) phosphoryl) icosanoic acid; 18- (bis (benzyloxy) phosphoryl) octadecanoic acid; 17- (bis (benzyloxy) phosphoryl) heptadecanoic acid; 16- (bis (benzyloxy) phosphoryl) hexadecanoic acid; 15- (bis (benzyloxy) phosphoryl) pentadecanoic acid were prepared in the same manner.
[0235] Preparation 10: oxyOrn { (AEEA) - (γ-GluCOOtBu) -CO- (CH2) 17-PO (OBn) 2}
[0236] Comercially available SM-10A was coupled with SM-10B under syandard peptide coupling conditions to give SM-10C, the Cbz protecting group was removed and the resulting amino group was reacted with SM-9C to afford intermediate SM 10E / oxyLys { (AEEA) - (γ-GluCOOtBu) -CO- (CH2) 17-PO (OBn) 2} after chromatography purification. SM 10 E can be used in peptide solid phase amide formation after the polypeptide backbone synthesis is complete and the K-17 amino group is deprotected; alternatively, SM 10E is reacted with K-17 distal amino group to yield SM 10F, which can be used directly in the polypeptide solid phase synthesis. SM 10F / [PO (OBn) 2) ] - (CH2) 17-CO- (γ-GluCOOtBu) -AEEA-CO-Fmoc-oxyLys. 1H NMR (400 MHz, Chloroform-d) δ 7.72 (d, J = 7.5 Hz, 2H) , 7.59 (d, J = 7.4 Hz, 2H) , 7.37 (s, 2H) , 7.34 (s, 10H) , 7.25 (d, J = 7.6 Hz, 2H) , 6.79 (s, 1H) , 6.39 (s, 1H) , 5.10 - 4.84 (m, 6H) , 4.28 (d, J = 89.2 Hz, 6H) , 4.08 - 3.43 (m, 14H) , 2.35 - 1.77 (m, 8H) , 1.70 (d, J = 8.8 Hz, 2H) , 1.43 (s, 9H) , 1.24 (d, J = 15.6 Hz, 30H) .
[0237] The following intermediates were prepared in the same manner.
[0238] Example 1: Synthesis of compounds
[0239] Below is a depiction of the structure of the current incretin analogs using the standard single letter or the three letters amino acid codes with the exception of residues Aib2, αMeL13, K17, αMeK20 and Aib29, where the structures of these amino acid residues have been expanded. The peptide backbone of the current incretin analogs is synthesized using Fluorenyimethyloxycarbonyl (Fmoc) / tert-Buty (t-Bu) chemistry on Fmoc-Rink Amide AM-Resin (Sub=0.3-0.4mmol / g) beads manually.
[0240] The resin consists of 1%DVB cross-linked polystyrene (Fmoc-Rink-MBHA Low Loading Resin, 100-200 mesh, at a substitution of Sub=0.3-0.4mmol / g, Motif Biotech, Suzhou China) . Standard side-chain protecting groups are used. Synthesis of the side chain at position 17 are conducted by two methods: 1) . Standard side-chain protecting groups are used. Fmoc-Lys (Mtt) -OH) , Fmoc-oxyLys (Mtt) -OH) , Fmoc-Orn (Mtt) -OH) , or Fmoc-oxyOrn (Mtt) -OH) , are used for the lysine, ornithine, orxyOrnithine or oxylysine at position 17; 2) . Fully protected side chain attached Fmoc-Lys, Fmoc-Orn, Fmoc-OxyOrn, Fmoc-OxyLys mentioed above are used as fully protected amino acids for lysine, ornithine, oxy ornithine or oxylysine at position 17; and Boc-Tyr (tBu) -OH) is used for the tyrosine at position 1. Fmoc groups are removed prior to each coupling step (2x7 minutes) using 20%piperidine in DMF. All standard amino acid couplings are performed for 1 hour to a primary amine and 3 hour to a secondary amine, using an equal molar ratio of Fmoc amino acid (0.3 mM) , diisopropylcarbodiimide (0.9 mM) and HOBt (0.9 mM) , at a 9-fold molar excess over the theoretical peptide loading. Exceptions are couplings to Ca-methylated amino acids, which are coupled for 3 hours. After completion of the synthesis of the peptide backbone, the resin is thoroughly washed with DCM for 6 times to remove residual DMF. When using method 1) the Mtt protecting group on the lysine, ornithine, oxy ornithine or oxylysine at position 17 is selectively removed from the peptide resin using two treatments of 30%hexafluoroisopropanol in DCM (2×40-minute treatment) . Subsequent attachment of the fatty acid-linker moiety or phosphonic acid-linker moiety is accomplished by coupling of the corresponding side chain acids mentioed above. 3-fold excess of reagents (AA: PyAOP: DIPEA=1: 1: 1 mol / mol) are used for each coupling that lasted for 1 hour.
[0241] After the synthesis is complete, the peptide resin is washed with DCM, and then thoroughly air-dried. The dry resin is treated with 10 mL of cleavage cocktail (trifluoro-acetic acid: water : triisopropylsilane. 95: 2.5: 2.5 v / v) for 2 hours at room temperature. The resin is filtered off, washed twice each with 2 mL of neat TFA, and the combined filtrates are treated with 5-fold cold diethyl ether (-20℃) to precipitate the crude peptide. The peptide / ether suspension is then centrifuged at 3500 rpm for 2 min to form a solid pellet, the supernatant is decanted, and the solid pellet is triturated with ether two additional times and dried in vacuo. The crude peptide is solubilized in 20%acetonitrile / 20%acetic acid / 60%water and purified by RP-HPLC on a Luna 5 μm Phenyl-Hexyl Preparative Column (21×250 mm, Phenomenex) with linear gradients of 100%acetonitrile and 0.1%TFA / water buffer system (30-50%acetonitrile in 60min) . The purity of peptide is assessed using analytical RP-HPLC and pooling criteria is >95%. Subsequent lyophilization of the final main product pool yields the lyophilized peptide TFA salt. The molecular weight is determined by LC-MS.
[0242] Salt exchange from TFA to sodium salt:
[0243] The freeze-dried, purified peptide was dissolved to 3-20 mg / mL in an appropriate aqueous buffer such as, but not limited to, 4: 1 water / MeCN, 0.2 M sodium acetate, or 50 mM HEPES buffer pH 7.4. The solution pH was adjusted with aqueous NaOH if necessary to achieve full solubility. The buffered solutions containing the peptide were salt exchanged using a C18 cartridge (0.5-5 g) . The cartridge was first equilibrated with isopropanol, then MeCN, then water. The peptide solution was applied to the cartridge, and the flow through was reapplied to ensure complete retention of peptide. The cartridge was washed with water, then a buffer solution (e. g. pH 7.5) containing such as, but not limited to, NaHCO3, NaOAc, or Na2 HPO4. The cartridge was then washed with water, and the peptide was eluted with 50-80% (v / v) MeCN in water. The peptide-containing eluent was freeze-dried to afford the peptide sodium salt as a white solid, which was used as such.
[0244] The compounds are in the following described using the three letter amino acid codes, except for unnatural amino acids depicted in the present invention. The substituent is included after the X17 residue to which it is attached.
[0245] Compound No. 1
[0246] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMedhLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0247] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0248] Compound No. 1A
[0249] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- { (D) -αMedhLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0250] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0251] MS: Obsd. 4729.60; Calc, 4730.33
[0252] Compound No. 2
[0253] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αD3MeLeu} -Leu-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0254] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0255] MS: Obsd: 4735.05; Calc 4735.70
[0256] Compound No. 3
[0257] Tyr- { (R) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMe-Leu} -Leu-Asp-Lys-
[0258] {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr- {cpLeu} -Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0259] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0260] MS: Obsd. 4731.60; Calc, 4731.30
[0261] Compound No. 4
[0262] Tyr- { (R) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMe-Leu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu- {cbLeu} -Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0263] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0264] MS: Obsd. 4745.60; Calc, 4745.30
[0265] Compound No. 5
[0266] Tyr- { (R) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {α-Me-Leu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr- {cbLeu} -Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0267] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0268] MS: obsd: 4745.40; Calc 4745.46
[0269] Compound No. 6
[0270] Tyr- { (R) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {α-Me-Leu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu- {cpLeu} Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0271] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0272] MS: Obsd. 4731.40; Calc, 4731.30
[0273] Compound No. 7
[0274] Tyr- { (R) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αD3MeL} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0275] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0276] MS: Obsd: 4737.00; Calc 4737.50
[0277] Compound No. 7A
[0278] Tyr- { (R) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {D-αMeL} -cpLeu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0279] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0280] MS: Obsd: 4732.80; Calc. 4733.30
[0281] Compound No. 7B
[0282] Tyr- { (R) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMeL} -cbLeu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0283] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0284] MS: Obsd: 4746.60; Calc. 4747.20
[0285] Compound No. 8
[0286] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMeLeu} - {cpLeu} -Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0287] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0288] MS: Obsd. 4730.00; Calc. 4731.33.
[0289] Compound No. 8A
[0290] Tyr- { (S) -D3Aib) -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMeLeu} - {cpLeu} -Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0291] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0292] MS: Obsd. 4731.80; Calc, 4731.84
[0293] Compound No. 8B
[0294] Tyr- (Aib) -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMecbLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0295] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0296] MS: Obsd. 4742.80; Calc. 4742.87
[0297] Compound No. 8C
[0298] Tyr- { (R) -D3Aib) -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMeLeu} - {cpLeu} -Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0299] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0300] MS: Obsd. 4732.50; Calc, 4733.00
[0301] Compound No. 9
[0302] Tyr- { (S) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMeLeu} - {cbLeu} -Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0303] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0304] MS: obsd: 4746.00; Calc 4745.84
[0305] Compound No. 10
[0306] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMeLeu} -cbLeu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0307] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0308] MS: Obsd. 4743.40; Calc. 4743.33,
[0309] Compound No. 10A
[0310] Tyr- { (R) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {D-αMecbLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0311] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0312] MS: Obsd. 4746.40; Calc, 4747.20
[0313] Compound No. 11
[0314] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMecpLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0315] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0316] MS: Obsd. 4728.30; Calc. 4726.69,
[0317] Compound No. 11A
[0318] Tyr- { (R) -D3Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {D-αMecpLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0319] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0320] MS: Obsd, 4732.75; Calc 4733.70
[0321] Compound No. 12
[0322] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- { (D) -αMecbLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu- {cpLeu} -Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0323] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0324] MS: Obsd: 4741.50; Calc 4742.00
[0325] Compound No. 13
[0326] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- { (D) -αMecbLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu- {cbLeu} -Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0327] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0328] MS: Obsd: 4755.80; Calc 4756.00
[0329] Compound No. 14
[0330] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- { (D) -αMecpLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu- {cpLeu} -Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0331] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0332] MS: Obsd. 4727.80; Calc. 4727.85
[0333] Compound No. 15
[0334] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- { (D) -αMecpLeu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu- {cbLeu} -Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0335] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0336] MS: Obsd. 4741.75; Calc 4741.05
[0337] Compound No. 16
[0338] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMe-Leu} -Leu-Asp-Lys- {diacid-C20-γ-Glu- (AEEA) -Lys} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu- {cbLeu} -Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0339] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0340] MS: Obsd: 4742.80; Calc 4743.00
[0341] Compound No. 17
[0342] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMe-Leu} -Leu-Asp-Lys-Lys { (AEEA) - (γ-Glu) -CO- (CH2) 18-PO3H2) } -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu- {cbLeu} -Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0343] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0344] MS: Obsd. 4779.00; Calc. 4779.76,
[0345] Compound No. 18
[0346] Tyr- {Aib} -Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- {αMe-Leu} -Leu-Asp-Lys-Lys { (AEEA) 2- (γ-Glu) -CO- (CH2) 18-PO3H2) } -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu- {cbLeu} -Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0347] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0348] MS: Obsd. 4924.00; Calc. 4924.92,
[0349] Compound No. 19
[0350] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Lys-Lys- (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-cbLeu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0351] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0352] Compound No. 20
[0353] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Orn-Orn- (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-cbLeu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0354] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0355] Compound No. 21
[0356] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Dab-Dab- (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-cbLeu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0357] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0358] Compound No. 22
[0359] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Lys-Lys- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-cbLeu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0360] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0361] Compound No. 23
[0362] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Dab-Dab- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-cbLeu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0363] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0364] Compound No. 24
[0365] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-OxyLys { (AEEA) - (γ-Glu) -CO- (CH2) 15-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0366] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0367] Compound No. 25
[0368] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Lys-Lys- (γ-Glu) - [4- (carboxyl) cyclohexane-1-methylamino] -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-cbLeu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0369] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0370] Compound No. 26
[0371] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn { (AEEA) - (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-cbLeu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0372] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0373] Compound No. 27
[0374] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-OxyLys { (AEEA) - (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-cbLeu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0375] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0376] Compound No. 28
[0377] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Dab { (AEEA) 2- (γ-Glu) -CO- (CH2) 19-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0378] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0379] Compound No. 29
[0380] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Dab { (AEEA) - (γ-Glu) -CO- (CH2) 19-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0381] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0382] Compound No. 30
[0383] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) - (γ-Glu) -CO- (CH2) 17-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0384] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0385] Compound No. 31
[0386] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Lys-Lys- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0387] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0388] Compound No. 32
[0389] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Orn-Orn- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0390] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0391] Compound No. 33
[0392] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Dab-Dab- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0393] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0394] Compound No. 34
[0395] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Orn-Lys- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0396] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0397] Compound No. 35
[0398] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Dab-Lys- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0399] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0400] Compound No. 36
[0401] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Dab-Dab-Dab- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0402] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0403] Compound No. 37
[0404] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (AEEA) 2- { (γ-Glu) - [4- (carboxyl) cyclohexane-1-methylamino] -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0405] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0406] Compound No. 38
[0407] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (AEEA) - { (γ-Glu) - [4- (carboxyl) cyclohexane-1-methylamino] -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0408] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0409] Compound No. 39
[0410] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Lys-Lys- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0411] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0412] Compound No. 40
[0413] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Orn-Orn- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0414] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0415] Compound No. 41
[0416] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Dab-Dab- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0417] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0418] Compound No. 42
[0419] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Orn-Lys- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0420] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0421] Compound No. 43
[0422] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Dab-Lys- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0423] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0424] Compound No. 44
[0425] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Dab-Dab- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0426] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0427] Compound No. 45
[0428] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn { (AEEA) 2- { (γ-Glu) - [4- (carboxyl) cyclohexane-1-methylamino] -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0429] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0430] Compound No. 46
[0431] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn { (AEEA) 2- { (γ-Glu) - [4- (carboxyl) cyclohexane-1-methylamino] -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0432] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0433] Compound No. 47
[0434] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys {Lys-Lys- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0435] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0436] Compound No. 48
[0437] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys {Orn-Orn- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0438] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0439] Compound No. 49
[0440] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys {Dab-Dab- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0441] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0442] Compound No. 50
[0443] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys {Orn-Lys- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0444] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0445] Compound No. 51
[0446] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys {Dab-Lys- (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0447] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0448] Compound No. 52
[0449] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys {Dab-Dab- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0450] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0451] Compound No. 53
[0452] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) 2- { (γ-Glu) - [4- (carboxyl) cyclohexane-1-methylamino] -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0453] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0454] Compound No. 54
[0455] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) - { (γ-Glu) - [4- (carboxyl) cyclohexane-1-methylamino] -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0456] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0457] Compound No. 55
[0458] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Dab-Dab-Dab- (γ-Glu) -CO- (CH2) 18-COOH} --Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0459] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0460] Compound No. 56
[0461] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys {2- (2-acetyl-ethoxyamino) -Dab-Dab-γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0462] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0463] Compound No. 57
[0464] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-Lys { (AEEA) 2- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0465] Peptide backbone: SEQ ID NO: 5, C-terminal amide, MS:
[0466] Compound No. 57A
[0467] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cpLeu-Asp-Lys-Lys { (AEEA) 2- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0468] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0469] Compound No. 58
[0470] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cpLeu-Asp-Lys- {oxyOrn- (AEEA) - { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0471] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0472] Compound No. 58A
[0473] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys- {oxyOrn- (AEEA) - { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0474] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0475] Compound No. 59
[0476] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-Lys {Lys-Lys- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0477] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0478] Compound No. 60
[0479] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-Lys {Orn-Orn- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0480] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0481] Compound No. 61
[0482] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-Lys {Dab-Dab- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0483] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0484] Compound No. 62
[0485] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Dab-Dab-Dab- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0486] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0487] Compound No. 63
[0488] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (Acetyl-ethoxyamino) -Dab-Dab- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0489] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0490] Compound No. 64
[0491] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-Lys { (AEEA) 2- { (γ-Glu) - [4- (carboxyl) cyclohexane-1-methylamino] -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0492] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0493] Compound No. 65
[0494] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (AEEA) - { (γ-Glu) - [4- (carboxyl) cyclohexane-1-methylamino] -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0495] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0496] Compound No. 66
[0497] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-oxyOrn { (AEEA) 2- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0498] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0499] Compound No. 66A
[0500] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cpLeu-Asp-Lys-oxyOrn { (AEEA) 2- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0501] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0502] Compound No. 67
[0503] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-oxyOrn { (AEEA) - { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0504] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0505] Compound No. 67A
[0506] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cpLeu-Asp-Lys-oxyOrn { (AEEA) - { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0507] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0508] Compound No. 68
[0509] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-oxyOrn {Lys-Lys- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0510] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0511] Compound No. 69
[0512] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-oxyOrn {Orn-Orn- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0513] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0514] Compound No. 70
[0515] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-oxyOrn {Dab-Dab- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0516] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0517] Compound No. 71
[0518] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-oxyLys { (AEEA) 2- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0519] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0520] Compound No. 71A
[0521] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cpLeu-Asp-Lys-oxyLys { (AEEA) 2- { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0522] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0523] Compound No. 72
[0524] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cbLeu-Asp-Lys-oxyLys { (AEEA) - { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0525] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0526] Compound No. 72A
[0527] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cpLeu-Asp-Lys-oxyLys { (AEEA) - { (γ-Glu) -CO- (CH2) 18-COOH} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0528] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0529] Compound No. 73
[0530] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (AEEA) 2- { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0531] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0532] MS: Obsd. 4912.50; Calc. 4913.13,
[0533] Compound No. 74
[0534] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (AEEA) - { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0535] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0536] MS: obsd: 4767.60; Calc 4767.76
[0537] Compound No. 75
[0538] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Lys-Lys- { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0539] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0540] MS: Obsd. 4878.80; Calc, 4878.95
[0541] Compound No. 76
[0542] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Orn-Orn- { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0543] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0544] MS: Obsd. 4850.40; Calc. 4850.90,
[0545] Compound No. 77
[0546] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Dab-Dab- { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0547] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0548] MS: Obsd. 4822.00; Calc. 4822.00,
[0549] Compound No. 78
[0550] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Orn-Lys- { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0551] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0552] Compound No. 79
[0553] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Dab-Lys- { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0554] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0555] Compound No. 80
[0556] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cpLeu-Asp-Lys-Lys { (AEEA) - { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0557] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0558] MS: Obsd. 4765.80; Calc. 4766.14,
[0559] Compound No. 80A
[0560] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -cpLeu-Asp-Lys-Lys { (AEEA) - { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0561] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0562] MS: Obsd. 4778.80; Calc. 4778.14,
[0563] Compound No. 81
[0564] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (AEEA) 2- [ (4) -carboxyl-cyclohexane-methylamino] - { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0565] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0566] Compound No. 82
[0567] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys ( (AEEA) - [ (4) -carboxyl-cyclohexane-methylamino] - { (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0568] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0569] Compound No. 83
[0570] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys {Dab-Dab-Dab- (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0571] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0572] Compound No. 84
[0573] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Orn-Lys- (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0574] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0575] Compound No. 85
[0576] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Dab-Lys- (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0577] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0578] Compound No. 86
[0579] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Orn-Lys-γ-Glu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0580] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0581] Compound No. 87
[0582] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Dab-Lys- (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0583] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0584] Compound No. 88
[0585] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn {Dab-Dab- (γ-Glu) -CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0586] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0587] Compound No. 89
[0588] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn { (AEEA) 2-γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0589] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0590] Compound No. 90
[0591] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn { (AEEA) -γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0592] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0593] MS: Obsd. 4769.60; Calc. 4769.94,
[0594] Compound No. 91
[0595] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) -γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0596] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0597] MS: Obsd. 4783.00; Calc. 4783.27,
[0598] Compound No. 92
[0599] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) 2-γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0600] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0601] Compound No. 93
[0602] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Dab { (AEEA) 2-γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0603] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0604] Compound No. 94
[0605] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Orn { (AEEA) -γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0606] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0607] Compound No. 95
[0608] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Orn { (AEEA) 2-γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0609] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0610] Compound No. 96
[0611] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Dab { (AEEA) 2-γGlu-CO- (CH2) 20-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0612] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0613] Compound No. 97
[0614] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-DAB { (AEEA) -γGlu-CO- (CH2) 20-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0615] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0616] Compound No. 98
[0617] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Orn { (AEEA) 2-γGlu-CO- (CH2) 19-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0618] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0619] Compound No. 99
[0620] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Orn { (AEEA) -γGlu-CO- (CH2) 19-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0621] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0622] MS: Obsd. 4768.00; Calc. 4768.20,
[0623] Compound No. 100
[0624] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) -γGlu-CO- (CH2) 17-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0625] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0626] MS: Obsd. 4770.00; Calc. 4769.94,
[0627] Compound No. 101
[0628] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) 2-γGlu-CO- (CH2) 17-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0629] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0630] Compound No. 102
[0631] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) -γGlu-CO- (CH2) 17-CO2H} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0632] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0633] Compound No. 103
[0634] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) 2-γGlu-CO- (CH2) 17-CO2H} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0635] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0636] Compound No. 104
[0637] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn { (AEEA) -γGlu-CO- (CH2) 18-CO2H} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0638] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0639] MS: Obsd. 4732.50; Calc. 4732.60,
[0640] Compound No. 105
[0641] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn { (AEEA) 2-γGlu-CO- (CH2) 18-CO2H} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0642] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0643] Compound No. 106
[0644] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Orn { (AEEA) -γGlu-CO- (CH2) 19-CO2H} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0645] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0646] Compound No. 107
[0647] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Orn { (AEEA) 2-γGlu-CO- (CH2) 19-CO2H} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0648] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0649] Compound No. 108
[0650] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (APEA) -γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0651] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0652] Compound No. 108A
[0653] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (AEPA) -γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0654] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0655] Compound No. 108B
[0656] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (AEEP) -γGlu-CO- (CH2) 18-PO3H2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0657] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0658] Compound No. 109
[0659] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (AEEA) -γGlu-CO- (CH2) 16-CH (CH2PO3H2) 2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0660] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0661] MS: Obsd. 4861.05; Calc. 4861.00,
[0662] Compound No. 110
[0663] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) -γGlu-CO- (CH2) 16-CH (CH2COOH) 2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0664] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0665] MS: Obsd. 4805.00; Calc. 4806.00,
[0666] Compound No. 111
[0667] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn { (AEEA) -γGlu-CO- (CH2) 16-CH (CH2PO3H2) 2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0668] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0669] Compound No. 112
[0670] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyOrn { (AEEA) -γGlu-CO- (CH2) 16-CH (CH2COOH) 2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0671] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0672] MS: Obsd. 4790.85; Calc. 4792.03,
[0673] Compound No. 113
[0674] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-oxyLys { (AEEA) -γGlu-CO- (CH2) 16-CH (CH2PO3H2) 2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0675] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0676] Compound No. 114
[0677] Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile- (αMeL) -Leu-Asp-Lys-Lys { (APEA) -γGlu-CO- (CH2) 16-CH (CH2COOH) 2} -Ala-Gln- {Aib} -Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[0678] Peptide backbone: SEQ ID NO: 5, C-terminal amide
[0679] Example 2: In Vitro Function Assay
[0680] GLP-1R / GIPR / GCGR binding assay
[0681] Radioligand competition binding assays are run to determine the equilibrium dissociation constant for exemplary compounds and comparator molecules. Such assay use scintillation proximity assay (SPA) methods and membranes prepared from transfected HEK293 or CHO-K1 cells overexpressing the human GIP receptor (GIPR) , GLP-1 receptor (GLP-1R) or human glucagon receptor (GcgR) .
[0682] Specifically, membrane were extracted from GLP-1R / HEK293, GIPR / CHO-K1 and GCGR / HEK293 cells. The reference compounds and screening compounds were 4-fold serially diluted in 100%Assay Buffer for 8 points. Transfer 25 μL of serial diluted references and screening compounds to the assay plates. Then add 25 μL / well of membrane and 100 μL / well of radio ligand 125I-GLP-1 (7-36) / 125I-GIPR / 125I-Glucagon. Incubate at room temperature for 1 hour. Filter the reaction mixture through GF / C plate using PerkinElmer Filtermate Harvester and wash the plates. Dry the filter plate for 1 hour at 50 ℃. Seal the bottom of the filter plate using Perkin Elmer Unifilter-96 backing seal tape. Add 50 μL of Perkin Elmer Microscint 20 cocktail to each well of assay plate and count 3H trapped on filter plate using Perkin Elmer MicroBeta2 Reader.
[0683] The assays are performed in the presence of bacitracin as a non-specific blocking agent to prevent acylated moieties of test analogs from binding to protein components used in standard assay buffers (e.g., albumin) .
[0684] Competition curves are plotted as the percent specific inhibition (y-axis) versus log concentration of compound (x-axis) and analyzed using a four parameter nonlinear regression fit with variable slope (ABase or Genedata) . Ki values are calculated according to the equation Ki=IC50 / (1+ (D / Ka) ) , where IC50 is the concentration of compound resulting in 50%inhibition of binding, D is the concentration of radioligand used in the assay, and Ka is the equilibrium dissociation constant for the receptor and the radioligand, determined from saturation binding analysis (shown in Table 1 below) .
[0685] As seen in Table 1, exemplary analogs have binding affinity at each of the GIP, GLP-1 and glucagon receptors. Ki values of exemplary analogs and comparator molecules are shown in Table 1.
[0686] TABLE 1
[0687] GLP-1R / GIPR / GCGR cAMP assay
[0688] The cAMP functional assays are conducted in HEK293 cells expressing the human GLP-1, GIP and glucagon receptors. Using homogeneous time resolved fluorescence methods, assays are conducted to determine the intrinsic potency of exemplary analogs and comparator molecules performed in the presence of casein (instead of serum albumin) as a nonspecific blocker, which does not interact with the fatty acid moieties of the analyzed molecules.
[0689] Speciafically, Suspension cells were harvested and resuspended in assay buffer (5 mM HEPES, 500 μM IBMX, 0.1%casein) according to the following procedure: 5 μL of 2X cell suspension were added to each well, where the optimal cell density was 1, 000 cells per well (2, 000 cells per well for GIPR) in a low volume 384-well plate. Agonist serial dilutions in a separate 384 well dilution plate in a 10-point series of 4X dilutions of agonist in assay buffer were performed as follows. 40 μL of the highest concentration of Agonist / DMSO was added to well No. 1.10 μL was removed from well No. 1 and added it to well No. 2, followed by gentle mixing. 10 μL was removed from well No. 2 and added it to well No. 3, followed by gentle mixing. This process was repeated until well No. 10. Additional serial dilutions for additional agonists were set up in a similar manner. 5 μL of each 2X agonist serial dilution was added in duplicate to the designated agonist rows of the assay plate using the Bravo (Agilent Technologies, BravoV11) . Assay plate was incubated for 30 minutes at room temperature. Following agonist incubation, a stock of cAMP Working Detection Solution in a separate 15 ml polypropylene tube was prepared by mixing 38 parts of cAMP Lysis Buffer, 1 parts of cAMP-D2, 1 part anti-cAMP cryptate reagent (Cisbio #62AM4PEJ) ) . 10 μL of cAMP Working Detection Solution was added to all wells of the assay plate. Assay plate was incubated for 1 hour at room temperature in the dark for the immunocompetition reaction to occur. Samples were read on Envision (PerkinElmer, Envision2015) .
[0690] Intracellular cAMP levels are determined by extrapolation using a standard curve. Dose response curves of compounds are plotted as the percentage of stimulation normalized to minimum (buffer only) and maximum (maximum concentration of each control ligand) values and analyzed using a four parameter non-linear regression fit with a variable slope (Genedata Screener 13) . EC50 is the concentration of compound causing half-maximal simulation in a dose response curve.
[0691] Data are provided below in Table 2. As seen in Table 2, exemplary analogs stimulate cAMP from human GTP, GLP-1 and glucagon receptors in the presence of 0.1%casein.
[0692] TABLE 2
[0693] Example 3: Pharmacokinetic study in SD rats
[0694] The purpose of this example is to determine the Pharmacokinetic parameters of the examplary compounds as described herein after SC administration to SD rats. This is done in a pharmacokinetic (PK) study, where the PK parameters of the examplary compounds are determined.
[0695] Study
[0696] Male and Female SD rats were obtained from Charles River Laboratories (China) approximately 6-8 weeks of age and weighing from approximately 200-300g were used in the studies. 1M+1F / compound, total 3M+3F, Animals will be acclimated to the study room for a minimum of 3 days prior to initiation of dosing.
[0697] Food and water were available ad libitum (Suzhou Frontage New Drug Development Co., Ltd. ) . The the examplary compounds were dissolved in saline to a concentration of 0.05-0.15 mg / mL, The respective examplary compounds were administered by subcutaneous injection at 5mL / kg, and blood was sampled at predefined time points for up to 72 hours post dosing (jugular vein puncture) . Blood samples (for example 220 μL) were collected into pre-cooled EDTA-K2 tubes and then centrifuged at 4 ℃ and 4000g for 5 minutes.
[0698] Sampling and analysis
[0699] Sample analysis will be performed by Frontage Laboratories (China) Bioanalytical staff. The concentrations of the analyte in the plasma samples and dosing solutions will be detected with a LC-MS / MS method based on multiple reaction monitoring (MRM) of fragment ions for the rats pharmacokinetic study. Samples will be analyzed complies with Tier 2 in the SOP Number BIO-427-R0 developed by Suzhou Frontage New Drug Development Co., Ltd. Tier 2 assay consist of two separate standard curves, one placed at the beginning of the analytical run and the other arranged towards the end of the sample analysis. Three levels of QCs (low, medium and high) will be used to ensure reliability of the assay. The concentrations of the analytes present in plasma will be determined using the standard calibration curves.
[0700] Sampling and analysis
[0701] Plasma was pipetted into Micronic tubes on dry ice and kept at -20℃ until analysed for plasma concentration of the triple agonists using LCMS. Individual plasma concentration-time profiles were analysed by a non-compartmental model in Phoenix WinNonLin ver. 6.4. (Pharsight Inc., Mountain View, CA, USA) , and the resulting terminal half-lives (harmonic mean) determined. Results
[0702] TABLE 3
[0703] Example 4: Pharmacokinetic study in Cynomolgus Monkeys
[0704] The purpose of this example is to determine the PK profiles of the examplary compounds as described herein after SC administration at ~0.2 mg / kg to monkeys.
[0705] Study
[0706] Male and Female Cynomolgus Monkeys were obtained from Huazhen Biotechnology Co. LTD (China) approximately 1.5-2 year of age and weighing from approximately 2.6-6kg were used in the studies. 1M+1F / compound, total 3M+3F, Animals were acclimated to the study room for a minimum of 3 days prior to initiation of dosing. Animals may be acclimated to study-specific experimental procedures to identify animals that exhibit increased levels of stress or resistance to the procedure. Animals considered healthy and acceptable for study will be sequentially assigned to study without randomization.
[0707] The water were available ad libitum. Food and fruit were given once a day (Suzhou Frontage New Drug Development Co., Ltd. ) .
[0708] The examplary compounds were dissolved in saline to a concentration of ~0.2 mg / mL, The examplary compounds were administered by subcutaneous injection at 1mL / kg and blood was sampled at predefined time points for up to 168 hours post dosing (Cephalic or saphenous veins (non-dosed vein) ) . Blood samples (for example 0.5 mL) were collected into pre-cooled EDTA-K2 tubes and then centrifuged at 4 ℃ and 4000g for 5minutes.
[0709] Sampling and analysis
[0710] Sample analysis will be performed by Frontage Laboratories (China) Bioanalytical staff. The concentrations of the analyte in the plasma samples and dosing solutions will be detected with a LC-MS / MS method based on multiple reaction monitoring (MRM) of fragment ions for the monkey pharmacokinetic study. Samples will be analyzed complies with Tier 2 in the SOP Number BIO-427-R0 developed by Suzhou Frontage New Drug Development Co., Ltd. Tier 2 assay consist of two separate standard curves, one placed at the beginning of the analytical run and the other arranged towards the end of the sample analysis. Three levels of QCs (low, medium and high) will be used to ensure reliability of the assay. The concentrations of the analytes present in plasma will be determined using the standard calibration curves.
[0711] Sampling and analysis
[0712] Plasma was pipetted into Micronic tubes on dry ice and kept at-20 ℃ until analysed for plasma concentration of the triple agonists using LCMS. Individual plasma concentration-time profiles were analysed by a non-compartmental model in Phoenix WinNonLin ver. 6.4. (Pharsight Inc., Mountain View, CA, USA) , and the resulting terminal half-lives (harmonic mean) determined.
[0713] Results
[0714] Table 4: Terminal half-life as measured after SC administration to monkeys
[0715] The tested triple agonists as described herein have very long half-lives as compared to native hormones. The half-lives of hGLP-1 and hGIP as measured in man are reported to be approximately 2-4 min and 5-7 min, respectively (Meier et al., Diabetes, 2004, 53 (3) : 654-662) . The half-life of glucagon as measured in man is reported to vary between 5 min and 30 min, depending on the route of administration (Pontiroli et al., Eur J Clin Pharmacol, 1993, 45: 555-558) .
[0716] TABLE 4
[0717] Monkey PK comparison of examplary compound 91 with RetatrutideIn this experiment Retatrutide and examplary compound 91 are mixed in equal ratio and dosed to the same monkeys either by I. V. or S. C. routes. The blood samples were collected, analyzed and PK parameters were calculated according to the procedures described above. The results are illustrated in Table 4A &4B.
[0718] Table 4A
[0719] Table 4B
[0720] These results indicating that Compound 91 and Retatrutide have comparable PK in monkeys.
[0721] Example 5. In vitro assay in the presence and absence of 2%HSA
[0722] GLP-1R / GIPR / GCGR receptor binding assay and GLP-1R / GIPR / GCGR cAMP functional assay were performed as described in Example 2 &3 in the presence and absence of 2%HSA to evaluate the incretin analog’s plasma protein binding ability. A large shift of IC50 / EC50 in the presence vs. absence of 2%HAS indicates a tight albumin binding and thus ensures a long half-life of the incretin analogs in animal or human bodies (Journal of Medicinal Chemistry, 2015, page 7370) . Data are provided below in Table 5.
[0723] TABLE 5
[0724] As seen in Table 5, exemplary incretin analogs showed dramatically reduced IC50 / EC50 shift compared to Retatrutide, yet they have comparable PK profiles as illustrated in Table 4A &4B. These results clearly demonstrate that the incretin analogs of the present invention are superior to Retatrutide. They have much less plasma protein binding, like the native ligand GLP-1, GIP or Glucogon, yet still have prolonged half-life in vivo like Retatrutide. The combined results could yield a potent and long acting incretin analogs when used in treating disease in human.
[0725] Example 6: Oral Dosing Pharmacokinetic study in Cynomolgus Monkeys of Compound 110 and Retatrutide
[0726] Preparation of tablets for oral administration: tablets containing the compounds of the present invention and reference compound Retatrutide used for the dosing described herein were immediate release SNAC-based tablets. Equal amount of the test compound and Retatrutide were freeze-dried as neutral sodium salt (pH 7-8) together. The proper amount of the compound of the present disclosure and Retatrutide, SNAC, magnesium stearate and other excipients were weighed, mixed on a rotor mixture over night. The dry mixture was then pressed into tablets containing 4mg of the compound of the present invention and 4mg of Retatrutide in each tablet. The tablets are dosed orally to the same group of monkeys. The blood samples were collected, analyzed and PK parameters were calculated according to the procedures described in Example 4. The results are illustrated in Table 6.
[0727] Table 6.
[0728] Table 6’s results clearly demonstrate that the compound of the present invention has improved oral bioavailability as measured by F%.
[0729] SEQUENCE LISTING
[0730] Human glucagon
[0731] SEQ ID NO: 1 HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
[0732] Human GLP-1 (7-36) amide
[0733] SEQ ID NO: 2 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
[0734] Human OXM
[0735] SEQ ID NO; 3 HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
[0736] Human GIP
[0737] SEQ ID NO: 4 YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
[0738] Incretin analog
[0739] SEQ ID NO: 5 YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS,
[0740] wherein
[0741] X2 is Aib, (S) -D3Aib, or (R) -D3Aib,
[0742] X13 is αMeL, αD3MeL, αMedhL / αMedhLeu, (D) -αMedhL / (D) -αMedhLeu, αMecpL / αMecpLeu, αMecbL / αMecbLeu, (D) -αMecpL / (D) -αMecpLeu, cpL / cpLeu, or cbL / cbLeu
[0743] X14 is L, cpL, or cbL,
[0744] X16 is K, Dab, Orn, OxyK, or OxyOrn, homoK,
[0745] X17 is K, Dab, homoK, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of a fatty diacid of the formula *HOOC- (C12-C20alkylene) -COOH, to the *HOOC group of a terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2, or to the *HOOC group of a *HOOC- (C6-C21alkylene) -B moiety, wherein Ra and Rb are each independently and o and p are each independently selected from 1-6,
[0746] X20 is Aib, (S) -D3Aib, or (R) -D3Aib,
[0747] X26 is L, cpL, or cbL,
[0748] X27 is L, cpL, or cbL,
[0749] the C-terminal amino acid S is optionally amidated
[0750] SEQ ID NO: 6 GPSSGAPPP
[0751] SEQ ID NO:7 GPSS-Aib(D3Aib)-APPPS
Claims
1.A GLP-1 / GIP / Gcg receptor triple agonist comprising a peptide, wherein the amino acid sequence of the peptide is:YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) , whereinX2 is Aib, (S) -D3Aib, or (R) -D3Aib,X13 is αMeL, αD3MeL, αMedhL / αMedhLeu, (D) -αMedhL / (D) -αMedhLeu, αMecpL / αMecpLeu, αMecbL / αMecbLeu, (D) -αMecpL / (D) -αMecpLeu, cpL / cpLeu, or cbL / cbLeuX14 is L, cpL, or cbL,X16 is K, Dab, Orn, OxyK, OxyOrn, or homoK,X17 is K, Dab, homoK, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of a fatty diacid of the formula *HOOC- (C12-C20alkylene) -COOH, to the *HOOC group of a terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2, or to the *HOOC group of a *HOOC- (C6-C21alkylene) -B moiety, wherein B=Ra and Rb are each independently and o and p are each independently selected from 1-6X20 is Aib, (S) -D3Aib, or (R) -D3Aib,X26 is L, cpL, or cbL,X27 is L, cpL, or cbL,and the C-terminal amino acid S is optionally amidated, or a pharmaceutically acceptable salt thereof.2.The GLP-1 / GIP / Gcg receptor triple agonist comprising a peptide according to claim 1, wherein the amino acid sequence of the peptide is:YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) , whereinX2 is Aib, (S) -D3Aib, or (R) -D3Aib,X13 is αMeL, αD3MeL, αMedhL / αMedhLeu, (D) -αMedhL / (D) -αMedhLeu, αMecpL / αMecpLeu, αMecbL / αMecbLeu, (D) -αMecpL / (D) -αMecpLeu, cpL / cpLeu, or cbL / cbLeuX14 is L, cpL, or cbL,X16 is K, Dab, Orn, OxyK, OxyOrn, or homoK,X17 is K, Dab, homoK, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of a terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2X20 is Aib, (S) -D3Aib, or (R) -D3Aib,X26 is L, cpL, or cbL,X27 is L, cpL, or cbL,and the C-terminal amino acid S is optionally amidated, or a pharmaceutically acceptable salt thereof.3.The GLP-1 / GIP / Gcg receptor triple agonist comprising a peptide according to claim 1, wherein the amino acid sequence of the peptide is:YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) , whereinX2 is Aib, (S) -D3Aib, or (R) -D3Aib,X13 is αMeL, αD3MeL, αMedhL / αMedhLeu, (D) -αMedhL / (D) -αMedhLeu, αMecpL / αMecpLeu, αMecbL / αMecbLeu, (D) -αMecpL / (D) -αMecpLeu, cpL / cpLeu, or cbL / cbLeuX14 is L, cpL, or cbL,X16 is K, Dab, Orn, OxyK, OxyOrn, or homoK,X17 is K, homoK, Dab, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of the *HOOC- (C6-C21alkylene) -B moiety , wherein B=Ra and Rb are each independently AND o and p are each independently selected from 1-6,X20 is Aib, (S) -D3Aib, or (R) -D3Aib,X26 is L, cpL, or cbL,X27 is L, cpL, or cbL,and the C-terminal amino acid S is optionally amidated, or a pharmaceutically acceptable salt thereof.4.The GLP-1 / GIP / Gcg receptor triple agonist comprising a peptide according to claim 1, wherein the amino acid sequence of the peptide is:YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) , whereinX2 is Aib, (S) -D3Aib, or (R) -D3Aib,X13 is αMeL, αD3MeL, αMedhL / αMedhLeu, (D) -αMedhL / (D) -αMedhLeu, αMecpL / αMecpLeu, αMecbL / αMecbLeu, (D) -αMecpL / (D) -αMecpLeu, cpL / cpLeu, or cbL / cbLeuX14 is cpL, or cbL,X16 is K, Dab, Orn, OxyK, OxyOrn, or homoK,X17 is K, Dab, homoK, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of a fatty diacid of the formula *HOOC- (C12-C20alkylene) -COOH,X20 is Aib, (S) -D3Aib, or (R) -D3Aib,X26 is L, cpL, or cbL,X27 is L, cpL, or cbL,and the C-terminal amino acid S is optionally amidated, or a pharmaceutically acceptable salt thereof.5.The GLP-1 / GIP / Gcg receptor triple agonist comprising a peptide according to claim 1, wherein the amino acid sequence of the peptide is:YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) , whereinX2 is Aib, (S) -D3Aib, or (R) -D3Aib,X13 is αMeL, αD3MeL, αMedhL / αMedhLeu, αMecpL / αMecpLeu, or αMecbL / αMecbLeu,X14 is L, cpL, or cbL,X16 is K or Orn,X17 is K, Dab, Orn, OxyK, OxyOrn, or homoK, , with the distal amino group conjugated optionally via a linker to the *HOOC group of a terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2,X20 is Aib, (S) -D3Aib, or (R) -D3Aib,X26 is L, cpL, or cbL,X27 is L, cpL, or cbL,and the C-terminal amino acid S is optionally amidated, or a pharmaceutically acceptable salt thereof.6.The GLP-1 / GIP / Gcg receptor triple agonist comprising a peptide according to claim 1, wherein the amino acid sequence of the peptide is:YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) , whereinX2 is Aib, (S) -D3Aib, or (R) -D3Aib,X13 is αMeL, αD3MeL, αMecpL / αMecpLeu, or αMecbL / αMecbLeu,X14 is cpL, or cbL,X16 is K, Dab, Orn, OxyK, OxyOrn, or homoK,X17 is K, Dab, homoK, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of a fatty diacid of the formula *HOOC- (C12-C20alkylene) -COOH,X20 is Aib, (S) -D3Aib, or (R) -D3Aib,X26 is L,X27 is L,and the C-terminal amino acid S is optionally amidated, or a pharmaceutically acceptable salt thereof.7.The GLP-1 / GIP / Gcg receptor triple agonist comprising a peptide according to claim 1, wherein the amino acid sequence of the peptide is:YX2QGTFTSDYSIX13X14DX16X17AQX20AFIEYX26X27EGGPSSGAPPPS (SEQ ID NO: 5) , whereinX2 is Aib, (S) -D3Aib, or (R) -D3Aib,X13 is αMeL, αD3MeL, αMecpL / αMecpLeu, or αMecbL / αMecbLeu,X14 is L, cpL, or cbL,X16 is K, Dab, Orn, OxyK, OxyOrn, or homoK,X17 is K, homoK, Dab, Orn, OxyK, or OxyOrn, with the distal amino group conjugated optionally via a linker to the *HOOC group of the *HOOC- (C11-C21alkylene) -B moiety, wherein B=Ra and Rb are each independentlyand o and p are each independently selected from 1-6,X20 is Aib, (S) -D3Aib, or (R) -D3Aib,X26 is L,X27 is L,and the C-terminal amino acid S is optionally amidated, or a pharmaceutically acceptable salt thereof.8.The GLP-1 / GIP / Gcg receptor triple agonist according to anyone of claims 1, 2 or 5, wherein the terminal carboxylic acid substituted phosphonic acid of the formula *HOOC- (C11-C21alkylene) -PO3H2 is selected from: 9.[Corrected under Rule 26, 06.06.2025]The GLP-1 / GIP / Gcg receptor triple agonist according to claim 1, wherein said peptide has a side chain at X17 position selected from: 10.The GLP-1 / GIP / Gcg receptor triple agonist according to claim 1, which is selected from: Compounds No. 1 to 114 or a pharmaceutically acceptable salt thereof.11.The GLP-1 / GIP / Gcg receptor triple agonist according to claim 1, which is selected from: Compounds No. 2, 3, 4, 6, 7, 7B, 8, 8A, 8B, 8C, 9, 10, 11, 12, 16, 18, 58, 58A, 67, 67A, 72, 72A, 73, 74, 75, 76, 77, 80, 80A, 90, 91, 99, 108, 108A, 108B, 109, 110, 111, 112, 113, 114, or a pharmaceutically acceptable salt thereof.12.The GLP-1 / GIP / Gcg receptor triple agonist according to claim 1, which is selected from: Compound No. 2, 7, 7A, 7B, 8, 8A, 8B, 8C, 9, 10, 11, 67, 67A, 72, 72A, or a pharmaceutically acceptable salt thereof.13.The GLP-1 / GIP / Gcg receptor triple agonist according to claim 1, which is selected from: Compound No. 58, 58A, 73, 74, 75, 76, 77, 80, 80A, 90, 91, 99, 108, 108A, 108B, 109, 110, 111, 112, 113, 114 , or a pharmaceutically acceptable salt thereof.14.The GLP-1 / GIP / Gcg receptor triple agonist according to claim 1, which is selected from: Compound No. 73, 77, 80, 80A, 90, 91, 109, 111, 113, or a pharmaceutically acceptable salt thereof.15.[Corrected under Rule 26, 06.06.2025]Acompound as a synthetic intermediate used in the preparation of incretin analogs, which is selected from the group consisting of: the *HOOC- (C11-C21alkylene) -B moiety, wherein B=is selected from:16.A pharmaceutical composition comprising the GLP-1 / GIP / Gcg receptor triple agonist according to any one of claims 1-14 and optionally at least one pharmaceutically acceptable excipient.17.A method of treating a disease selected from the group consisting of: A method of treating a disease or condition selected from the group consisting of diabetes mellitus, obesity, chronic weight management, metabolic fatty liver disease (MAFLD) , metabolic steatohepatitis (MASH) , dyslipidemia, metabolic syndrome, chronic kidney disease (CKD) , osteoarthritis (OA) , obesity-related sleep apnea (OSA) , polycystic ovary syndrome (PCOS) , Parkinson's disease and Alzheimer's disease in a patient in need thereof, comprising administering to the patient an effective amount of the GLP-1 / GIP / Gcg receptor triple agonist according to any one of claims 1-14, or a pharmaceutically acceptable salt thereof, preferably, the GLP-1 / GIP / Gcg receptor triple agonist according to any one of claims 1-14, or a pharmaceutically acceptable salt is administered every other day, three times a week, two times a week, one time a week (i.e., weekly) , biweekly (i.e., every other week) or monthly.18.[Corrected under Rule 26, 06.06.2025]A use of the GLP-1 / GIP / Gcg receptor triple agonist according to any one of claims 1-14, or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for the treatment of a disease selected from the group consisting of: diabetes mellitus, obesity, chronic weight management, metabolic fatty liver disease (MAFLD) , metabolic steatohepatitis (MASH) , dyslipidemia, metabolic syndrome, chronic kidney disease (CKD) , osteoarthritis (OA) , obesity-related sleep apnea (OSA) , polycystic ovary syndrome (PCOS) , Parkinson's disease and Alzheimer's disease.
Citation Information
Patent Citations
GLP-1, GIP and glucagon receptor triple agonists
CN116457002A
Compositions and methods for treating metabolic disorders and liver diseases
CN116710462A
GLP-1 / GCG / GIP tri-receptor agonists and uses thereof
CN117417411A
Pharmaceutical formulations and methods for the treatment of metabolic and liver disorders
WO2023141044A1
Compositions and methods for the treatment of metabolic and liver disorders
WO2024020372A1