507 results about "Dyslipidemia" patented technology

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention relates to application of fermentation lactobacillus mucus LFPerfectuus001 in preparation of a product for improving metabolic syndrome caused by high-fat and high-sugar diet, and belongs to the technical field of microorganisms. The invention provides application of fermented lactobacillus mucus LFPerfecus001 in preparation of a product for improving metabolic syndrome, the fermented lactobacillus mucus LFPerfecus001 is preserved in Guangdong Microbial Culture Collection Center on April 13, 2022, and the preservation number is GDMCC No: 62335. The invention further provides a preparation method of the fermented lactobacillus mucus LFPerfecus001. Animal experiments report that the fermented lactobacillus mucus LFPerfectus001 has the effects of reducing fat, increasing muscle, improving obesity, hyperglycemia, insulin resistance, dyslipidemia, hyperuricemia and fatty liver for the first time, and can well improve metabolic syndrome caused by high fat and high glucose.

The invention relates to pediococcus pentosaceus with a cholesterol lowering function and application thereof, and belongs to the technical field of microorganisms. The invention discloses pediococcus pentosaceus with a cholesterol lowering function and application of the pediococcus pentosaceus. The pediococcus pentosaceus R5 (GDMCC No.65659) is separated from special fermented food stinky acid in Guizhou. The in-vitro cholesterol removal rate of the pediococcus pentosaceus R5 can reach 59%, and the pediococcus pentosaceus R5 has the characteristics of acid / cholate resistance, no hemolysis and sensitivity to common antibiotics; an in-vivo lipid-lowering experiment is carried out on a hyperlipidemia model mouse, and the result shows that the strain R5 can remarkably improve the in-vivo dyslipidemia state of the mouse, reduce liver fat accumulation and protect the liver at the same time, and can be used for developing lipid-lowering related probiotic functional products. The strain R5 provided by the invention provides a natural and safe probiotic for preventing and / or treating hyperlipemia.

The invention discloses an application of an HERP gene knockout mouse model in obesity and metabolic disorder diseases. The invention finds that compared with a wild type high-fat group, HERP gene knockout can cause phenotypes such as early obesity, more serious obesity degree, increase of fat weight ratio, aggravation of adipose tissue inflammation, dyslipidemia and glucose metabolism disorder of mice during high-fat feeding. And the HERP gene is knocked out, so that the adipocyte differentiation is increased. The HERP gene knockout mouse is more sensitive to nutrition, obesity can occur more quickly during high-fat feeding, symptoms such as fat amplification, fat inflammation and glucose and lipid metabolism disorder are more serious, and the HERP gene knockout mouse can be used for molecular mechanism research and drug screening of obesity, fat tissue and glucose and lipid metabolism disorder. It is further found that cilostazol can significantly relieve mouse obesity and lipid metabolism disorder caused by HERP gene defects, but has no obvious weight losing effect on normal genotype mice, and a new strategy is provided for precise treatment.

The present invention provides a method for increasing glycemic control in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. The present invention provides a method for improving weight management in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. Further providing a method for treating a condition selected from atherosclerosis, chronic kidney disease, NAFLD, and NASH. Further provided is a method to prevent or induce remission of diabetes comprising administration of tirzepatide, or a pharmaceutically acceptable salt thereof. Further provided is a dosing regimen for increasing glycemic control, improving weight management, and / or treating dyslipidemia.

The present disclosure relates to RNAi agents, e.g., double stranded RNAi agents such as siRNAs, able to Inhibin Subunit Beta E (INHBE) gene expression. Also disclosed are pharmaceutical compositions that include INHBE RNAi agents and methods of use thereof. The INHBE RNAi agents disclosed herein may be conjugated to targeting ligands to facilitate the delivery to cells, including to hepatocytes. Delivery of the INHBE RNAi agents in vivo provides for inhibition of INHBE gene expression. The RNAi agents can be used in methods of treatment of diseases, disorders, or symptoms mediated in part by INHBE gene expression, such as obesity, diabetes, liver inflammation, dyslipidemia, or metabolic disease.

The invention discloses a polypeptide or a pharmaceutically acceptable salt thereof. The polypeptide has an amino acid sequence as shown in SEQ ID NO: 1 or an amino acid sequence in a conservative modification form thereof. The polypeptide or the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP1R and is used for effectively activating the GLP1R. The GLP1R activating polypeptide is obtained through precise calculation and deep learning model optimization, has a short sequence, has unique amino acid arrangement compared with a traditional GLP-1 analogue, can effectively activate a GLP1R receptor, can also be used for treating or preventing metabolic disorder related diseases, and has a good application prospect. For example, obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes, non-alcoholic fatty liver diseases and the like.

The invention relates to the field of medicine synthesis, and discloses a GCG-GLP-1 dual agonist compound. The GCG-GLP-1 dual-agonist compound provided by the invention is used for preparing a pharmaceutical composition for treating diseases, and the application of the pharmaceutical composition in preparing a medicine for treating at least one of the following diseases, the diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The invention discloses a long-acting polypeptide analogue and application thereof, the polypeptide analogue can act on a GLP-1 receptor, a GIP receptor and a Y2 receptor at the same time, and can play the biological activities of GLP-1, GIP and PYY3-36 at the same time; the PYY3-36 GLP-1 has the treatment effect of GLP-1 on diabetes mellitus, also has the beneficial effect of GIP on glucose and lipid metabolism and appetite inhibition, and also has the beneficial effect of PYY3-36 on appetite inhibition, so that the PYY3-36 GLP-1 has a synergistic effect on glucose, lipid and energy metabolism; the application of the compound in preparation of drugs for treating metabolic syndromes, such as diabetes, obesity and dyslipidemia, has greater potential in preparation of drugs for treating diseases such as diabetes, obesity and dyslipidemia.

The invention relates to the field of medicine synthesis, and discloses a GLP-1 / GIP / GCG tri-agonist compound. The GLP-1 / GIP / GCG three-agonist compound is used for preparing a medicine composition for treating diseases, and the application of the medicine composition in preparing a medicine for treating at least one of the following diseases, namely, the GLP-1 / GIP / GCG three-agonist compound, and the GLP-1 / GIP / GCG three-agonist compound. The diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The invention relates to the field of medicine synthesis, and discloses a GLP-1 / GIP / GCG tri-agonist compound. The GLP-1 / GIP / GCG three-agonist compound is used for preparing a medicine composition for treating diseases, and the application of the medicine composition in preparing a medicine for treating at least one of the following diseases, namely, the GLP-1 / GIP / GCG three-agonist compound, and the GLP-1 / GIP / GCG three-agonist compound. The diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The invention discloses animal bifidobacterium subsp. Lactis BA-C9 capable of improving diabetes and application of the animal bifidobacterium subsp. Lactis BA-C9, the animal bifidobacterium subsp. Lactis BA-C9 is preserved in China Center for Type Culture Collection on March 11, 2024, and the preservation number is CCTCC NO: M2024457. The product prepared from the animal bifidobacterium subsp. Lactis BA-C9 has the beneficial effect of improving diabetes mellitus, can reduce fasting blood-glucose and liver injury, and has the capabilities of improving insulin resistance, glucose tolerance and dyslipidemia.

The invention provides an intelligent intervention method for dyslipidemia based on multi-omics analysis, and aims to provide scientific and personalized treatment and lifestyle guidance for dyslipidemia patients. And the predictive ability of the deep learning model is combined with the interpretability and security verification mechanism of the knowledge graph and the rule engine, so that the scientificity, interpretability and security of each intervention scheme are ensured. An intervention scheme is generated through a deep learning model, and meanwhile, a knowledge graph and a rule engine are introduced, so that the interpretability, the safety and the dynamic adaptability of the scheme are ensured. By dynamically analyzing individualized genes, proteins and clinical characteristics, individualized treatment and lifestyle intervention suggestions are provided for patients. The model not only can significantly improve the curative effect and reduce the risk of adverse reactions, but also can realize continuous improvement of an individualized intervention scheme through real-time feedback and dynamic optimization, and provides an efficient blood fat management tool for doctors and patients.

The invention relates to the field of medicine synthesis, and discloses a GLP-1 / GCG dual-agonist compound. The GLP-1 / GCG dual-agonist compound provided by the invention is used for preparing a pharmaceutical composition for treating diseases, and application of the pharmaceutical composition in preparation of a medicine for treating at least one of the following diseases, the diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The present disclosure relates to a stable pharmaceutical composition comprising a fixed dose combination of olbistetrapib and ezetimibe or a salt, solvate, or derivative of olbistetrapib and ezetimibe. The disclosure further describes the use of ezetimibe and Eubiquitrapib, for example in such fixed dose combinations, for the preparation of an agent for the treatment of a subject in need of lowering LDL-cholesterol or a subject suffering from hyperlipidemia or mixed dyslipidemia, and methods of treatment for the subject.

Incretin analogs are provided that have activity at each of the glucose-dependent insulinotropic polypeptide (GIP), glucagon-like peptide-1 (GLP-1) and glucagon (GCG) receptors. The incretin analogs have structural features resulting in balanced activity and extended duration of action at each of these receptors. Methods also are provided for treating diseases such as type 2 diabetes mellitus, dyslipidemia, metabolic syndrome, non-alcoholic fatty liver disease, non-alcoholic steatohepatitis and obesity.

The invention relates to the technical field of biological medicine, and discloses an intestinal insulinotropic analogue with multiple biological activities, a synthesis method, a pharmaceutical composition and application, the synthesized intestinal insulinotropic analogue has triple agonist activity of a GLP-1 receptor, a glucagon receptor and a CCK-1 receptor, not only has the treatment effect of GLP-1 on diabetes, but also has the treatment effect of GLP-1 on CCK-1, and also has the effect of GLP-1 on CCK-1 on CCK-1. The traditional Chinese medicine composition also has the regulating effect of glucagon on lipolysis and energy metabolism and the beneficial effect of CCK on appetite inhibition, so that a synergistic effect is generated on sugar, fat and energy metabolism; the application has great potential in preparation of drugs for treating metabolic syndromes, such as diabetes, obesity, non-alcoholic fatty liver diseases, dyslipidemia and other diseases.

The present application relates to heterobicyclic compounds having glucagon-like peptide receptor (GLP-1R) agonist activity, processes for their preparation, pharmaceutical compositions comprising them and their use as GLP-1R agonists or for the treatment or prophylaxis of GLP-1R associated diseases or disorders. In particular, the compounds of the present application are useful for body weight management, for lowering blood sugar and / or for the treatment or prevention of diabetes, diabetic complications, obesity, overweight, dyslipidemia, fatty liver diseases (e.g., non-alcoholic fatty liver disease (NAFLD) and non-alcoholic steatohepatitis (NASH)), metabolic diseases, cardiovascular diseases, nervous system disorders, mental disorders, kidney diseases, etc. , gastrointestinal diseases, autoimmune diseases, inflammatory diseases, lung diseases, hypothalamic-pituitary-gonad axis related diseases or disorders, cancers and the like.

The invention discloses mesenchymal stem cells, a screening and identifying method of lipoprotein particles secreted by the mesenchymal stem cells and application of the mesenchymal stem cells. The screening and identifying method of the mesenchymal stem cells comprises the steps of cell culture, genotype identification, multiplication capacity identification, pluripotency and self-renewal capacity identification, differentiation capacity identification, lipid droplet identification after high fat induction, APOE lipoprotein secretion capacity identification and the like. The screening and identifying method of the lipoprotein particles comprises the steps of high-fat-induced lipoprotein secretion, lipoprotein separation and purification, lipoprotein particle size identification, lipoprotein particle content identification and the like, and target cells and target lipoprotein particles can be rapidly and accurately screened through the systematic screening and identifying method. The screened target lipoprotein particles can improve the dyslipidemia of APOE4 / 4 genotype Alzheimer's disease. Compared with the prior art, the method not only can avoid the gene manipulation risk faced by APOE gene editing, but also can provide a new standard for identification of mesenchymal stem cells and lipoprotein particles secreted by the mesenchymal stem cells, and can screen wider and easier therapeutic cell sources for later application.

The present invention is directed to substituted 1-(1H-imidazol-1-yl)-3-methyl-2- phenylbutan-2-ol and 1-cyclopentyl-2-(1H-imidazol-1-yl)-1-phenylethan-1-ol compounds useful as agonists of 8-oxo-guanine DNA glycosylase (OGG1) in humans, as well as pharmaceutical compositions comprising them and methods of their use in treating diseases, including metabolic syndrome, obesity, fatty liver disease, dyslipidemia, insulin resistance, neurodegenerative disorders and cancers.

The present disclosure relates to stable pharmaceutical compositions comprising fixed dose combination of obicetrapib and ezetimibe, or their salts, solvates or derivatives thereof. The disclosure further describes the use of ezetimibe and obicetrapib, e.g. in the form of such fixed dose combinations, for preparation of medicaments and method of treatment of subjects requiring reduction in LDL-cholesterol or those suffering from hyperlipidemia or mixed dyslipidemia.

The invention discloses an intestinal insulinotropic analogue and application thereof, the intestinal insulinotropic analogue can simultaneously act on a GLP-1 receptor, a glagon receptor and a GIP receptor, and can simultaneously play the activities of the GLP-1, the glagon and the GIP; according to the present invention, the GLP-1 has the diabetes treatment effect, the glucagon has the beneficial effects of weight, energy metabolism and lipid metabolism, and the GIP has the beneficial effects of sugar, lipid metabolism and appetite inhibition so as to produce the synergistic effect on sugar, lipid and energy metabolism; the application of the polypeptide to preparation of drugs for treating metabolic syndromes, such as diabetes, dyslipidemia, fatty liver diseases, obesity and the like, has greater potential.

The present disclosure provides GLP-1 / GIP and GLP-1 / GCG dual receptor agonists comprising incretin analog polypeptides and use thereof in the treatment or prevention of Type 2 diabetes mellitus (T2DM), hyperlipidemia / dyslipidemia, metabolic syndromes, metabolic dysfunction-associated steatotic liver disease (MASLD), metabolic dysfunction- associated steatohepatitis (MASH), neurodegenerative disorders, fibrosis, cardiovascular risks, and / or obesity.

The present disclosure relates to RNAi agents, e.g., double stranded RNAi agents such as siRNAs, able to Inhibin Subunit Beta E (INHBE) gene expression. Also disclosed are pharmaceutical compositions that include INHBE RNAi agents and methods of use thereof. The INHBE RNAi agents disclosed herein may be conjugated to targeting ligands to facilitate the delivery to cells, including to hepatocytes. Delivery of the INHBE RNAi agents in vivo provides for inhibition of INHBE gene expression. The RNAi agents can be used in methods of treatment of diseases, disorders, or symptoms mediated in part by INHBE gene expression, such as obesity, diabetes, liver inflammation, dyslipidemia, or metabolic disease.

The present disclosure relates to RNAi agents, e.g., double stranded RNAi agents such as small interfering RNA (siRNA) molecules, able to inhibit proprotein convertase subtilisin kexin 9 (PCSK9) gene expression. Also disclosed are pharmaceutical compositions that include PCSK9 RNAi agents and methods of use thereof. The PCSK9 RNAi agents disclosed herein may be conjugated to targeting ligands, including ligands that comprise N-acetyl-galactosamine, to facilitate the delivery to hepatocyte cells. Delivery of the PCSK9 RNAi agents in vivo provides for in vivo provides for inhibition of PCSK9 gene expression and thereby reduction of PCSK9 protein. The RNAi agents can be used in methods of treatment of diseases or disorders mediated at least in part by PCSK9 gene expression, including among others hypercholesterolemia, familial hypercholesterolemia including heterozygous familial hypercholesterolemia (HeFH) and homozygous familial hypercholesterolemia (HoFH), familial hypobetalipoproteinemia, hyperlipidemia, coronary artery disease, polygenic dyslipidemia, heart disease, cardiovascular disease (CVD) including clinical atherosclerotic cardiovascular disease (ASCVD).

Disclosed herein are FABP inhibitor compounds and their use in pharmaceutical compositions for treating diseases including cancers that highly express any of these FABPs, in particular triple-negative breast cancer (TNBC) and other inflammation-induced diseases including cardiovascular disease, obesity or an obesity-related disorders, diabetes, dyslipidemia, impaired glucose tolerance or impaired fasting glucose, vitiligo, psoriasis, autoimmune disorders, pain and dementia. Also disclosed herein are methods for preparing the disclosed compounds.

Provided herein are therapeutic methods of treatment using agonist leptin receptor (LEPR) antibodies, antigen-binding fragments thereof, or compositions comprising the LEPR antibodies or antigen-binding fragments thereof. Such therapeutic methods include treatment for conditions related to metabolic dysfunction, including for example, lipodystrophy, adiposity or obesity, reducing body weight, non-alcoholic fatty liver disease, hyperphagia, hyperglycemia, insulin resistance, dyslipidemia, hepatic steatosis, and infertility.

A dual function protein is disclosed. The dual function protein may be prepared by linking a biologically active protein and an FGF mutant protein to an Fc region of an immunoglobulin. The dual function protein has improved pharmacological efficacy, in vivo duration and protein stability. The dual function protein exhibits improved pharmacological efficacy, in vivo duration and protein stability. A pharmaceutical composition containing the dual function protein as an active ingredient may be effectively used as a therapeutic agent for diabetes, obesity, dyslipidemia, metabolic syndrome, non-alcoholic fatty liver diseases, non-alcoholic steatohepatitis or cardiovascular diseases.

The present invention provides methods for treating patients suffering from familial hypercholesterolemia, including both HeFH and HoFH. The methods of the invention provide for lowering at least one lipid parameter in the patient by administering a therapeutically effective amount of an antibody or antigen-binding fragment thereof that specifically binds to ANGPTL3 in combination with a therapeutically effective amount of a statin, a first lipid lowering agent other than a statin, and a second lipid lowering agent other than a statin. The first non-statin lipid lowering agent is an agent that inhibits cholesterol uptake (e.g. ezetimibe) and the second non-statin lipid-lowering agent is an inhibitor of microsomal triglyceride transfer protein (e.g. lomitapide). The combination therapy is useful in treating hypercholesterolemia, as well as hyperlipidemia, hyperlipoproteinemia and dyslipidemia, including hypertriglyceridemia, chylomicronemia, and to prevent or treat diseases or disorders, for which abnormal lipid metabolism is a risk factor, such as cardiovascular diseases.

The present disclosure relates to methods of treating, preventing or managing cardiovascular and / or metabolic disorders selected from the group consisting of hypercholesteremia, dyslipidemia, hypertriglyceridemia, non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), type 2 diabetes and obesity in a human subject in need thereof by administering a human FGF21 protein variant.