1131 results about "Blood lipids" patented technology

The invention relates to selenium-rich health-care rice dumplings. The selenium-rich health-care rice dumplings are prepared from the following raw materials of selenium-rich glutinous rice, rose petals, haw tree parasitism, plum tree parasitism, radix rehmanniae, dendrobium candidum, vegetable oil, pork, mung beans, ground cinnamon and table salt. The selenium-rich glutinous rice is used as a main raw material, so that selenium elements in human bodies are complemented, and collective antioxidation is strengthened; besides, the glutinous rice and the mung beans are soaked in a traditional Chinese medicine extracting solution, and medical components in traditional Chinese medicines are absorbed, so that the selenium-rich health-care rice dumplings have the efficacies of clearing heat, promoting salivation, relieving restlessness, resolving stagnation, reducing blood lipid, promoting digestion and enhancing the immunity of organisms.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention relates to pediococcus pentosaceus with a cholesterol lowering function and application thereof, and belongs to the technical field of microorganisms. The invention discloses pediococcus pentosaceus with a cholesterol lowering function and application of the pediococcus pentosaceus. The pediococcus pentosaceus R5 (GDMCC No.65659) is separated from special fermented food stinky acid in Guizhou. The in-vitro cholesterol removal rate of the pediococcus pentosaceus R5 can reach 59%, and the pediococcus pentosaceus R5 has the characteristics of acid / cholate resistance, no hemolysis and sensitivity to common antibiotics; an in-vivo lipid-lowering experiment is carried out on a hyperlipidemia model mouse, and the result shows that the strain R5 can remarkably improve the in-vivo dyslipidemia state of the mouse, reduce liver fat accumulation and protect the liver at the same time, and can be used for developing lipid-lowering related probiotic functional products. The strain R5 provided by the invention provides a natural and safe probiotic for preventing and / or treating hyperlipemia.

The invention discloses pediococcus acidilactici and application thereof, and relates to the technical field of microorganisms. The pediococcus acidilactici is pediococcus acidilactici Mei.1103.1, the preservation unit is China General Microbiological Culture Collection Center, the preservation number is CGMCC NO.32564, the preservation date is November 11, 2024, the preservation address is Institute of Microbiology, Chinese Academy of Sciences, No. 3, No.1 Yard, Beichen West Road, Chaoyang District, Beijing, and the preservation number is CGMCC NO.32564. The pediococcus acidilactici Mei.1103.1 is CGMCC NO.32564. The pediococcus acidilactici Mei.1103.1. The invention also provides application of the fermented dry rice flour in preparation of products for reducing uric acid, preventing / treating hyperuricemia, regulating immunity, preventing / treating kidney injury and preventing / treating fatty liver and fermented dry rice flour. The bacterium can reduce uric acid and relieve hyperuricemia; regulating blood fat; kidney and liver injuries caused by hyperuricemia are repaired; the content of volatile flavor compounds in the fermented dry rice flour is increased.

The present invention provides a method for increasing glycemic control in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. The present invention provides a method for improving weight management in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. Further providing a method for treating a condition selected from atherosclerosis, chronic kidney disease, NAFLD, and NASH. Further provided is a method to prevent or induce remission of diabetes comprising administration of tirzepatide, or a pharmaceutically acceptable salt thereof. Further provided is a dosing regimen for increasing glycemic control, improving weight management, and / or treating dyslipidemia.

The invention relates to the field of biological medicine, in particular to application of hispidulin in preparation of a lipid de novo synthesis inhibitor or a metabolism-related fatty liver disease treatment or prevention product. The hispidulin disclosed by the invention has a chemical structure as shown in a formula (I). The hispidulin in the invention reverses liver cell lipid droplet excessive infiltration induced by high-dose fructose in a dose-dependent manner; furthermore, the hispidulin dose-dependent ameliorating obesity signs in HFD-induced MAFLD model mice, including liver weight, body weight, blood lipid level, liver fat content, and insulin resistance, without significantly reducing food intake.

The invention provides a hypoglycemic peptide which is prepared by taking bovine whey protein as a raw material and is stable in gastrointestinal digestion and absorption. In an in-vitro cell experiment, the peptide fragment can improve the uptake of insulin-resistant HepG2 hepatocytes and synthesize glycogen by using glucose, can promote intestinal endocrine cells NCI-H716 to secrete GLP-1, has a certain synergistic effect, and can further play the effects of promoting GLP-1 secretion and activating a GLP-1 receptor through combined use. An insulin resistance mouse model is constructed by utilizing high-fat diet, and the peptide fragment is adopted for intervention, so that the hypoglycemic peptide is further proved to have obvious effects on losing weight, reducing lipid accumulation and assisting in reducing blood fat, and meanwhile, the hypoglycemic peptide can be used for improving insulin resistance related symptoms. The milk peptide provided by the invention has gastrointestinal digestion stability and hypoglycemic activity, can be used as a functional milk base material for developing food, medicines or health care products with the effect of regulating blood sugar, and is wide in application prospect.

The invention discloses a polypeptide or a pharmaceutically acceptable salt thereof. The polypeptide has an amino acid sequence as shown in SEQ ID NO: 1 or an amino acid sequence in a conservative modification form thereof. The polypeptide or the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP1R and is used for effectively activating the GLP1R. The GLP1R activating polypeptide is obtained through precise calculation and deep learning model optimization, has a short sequence, has unique amino acid arrangement compared with a traditional GLP-1 analogue, can effectively activate a GLP1R receptor, can also be used for treating or preventing metabolic disorder related diseases, and has a good application prospect. For example, obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes, non-alcoholic fatty liver diseases and the like.

The invention relates to the field of medicine synthesis, and discloses a GCG-GLP-1 dual agonist compound. The GCG-GLP-1 dual-agonist compound provided by the invention is used for preparing a pharmaceutical composition for treating diseases, and the application of the pharmaceutical composition in preparing a medicine for treating at least one of the following diseases, the diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The invention relates to the field of medicine synthesis, and discloses a GLP-1 / GIP / GCG tri-agonist compound. The GLP-1 / GIP / GCG three-agonist compound is used for preparing a medicine composition for treating diseases, and the application of the medicine composition in preparing a medicine for treating at least one of the following diseases, namely, the GLP-1 / GIP / GCG three-agonist compound, and the GLP-1 / GIP / GCG three-agonist compound. The diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The invention relates to an application of an Sdccag3 gene in preparation of a weight-reducing medicine for regulating glucose and lipid metabolism. The Sdccag3 gene is used as an action target to be applied to preparation or screening of the weight-reducing medicine for regulating glucose and lipid metabolism, and the nucleotide sequence of the Sdccag3 gene is as shown in SEQ ID No. 1. According to the application disclosed by the invention, the specific overexpressed Sdccag3 in adipose tissues in a mouse body can obviously inhibit the increase of the blood fat level, and the overexpressed Sdccag3 can also obviously improve the poor glucose tolerance, improve the insulin sensitivity, reduce the levels of serum triglyceride, cholesterol and low-density lipoprotein cholesterol of an obese mouse, improve the poor glucose tolerance and improve the insulin sensitivity. The insulin sensitivity is improved, obesity-related glycolipid metabolism is effectively regulated and controlled, the effect of reducing blood lipid and blood sugar is achieved, and the compound can be used for preparing weight-losing drugs for reducing blood lipid and blood sugar.

The invention relates to the field of medicines, foods or health-care products, in particular to big-fruit hawthorn heteropolysaccharide as well as a preparation method and application thereof. The large-fruit hawthorn heteropolysaccharide is prepared from galacturonic acid, glucuronic acid, mannose, xylose, arabinose, glucose, galactose, fucose and rhamnose. The weight-average molecular weight of the big fruit hawthorn heteropolysaccharide is 81.6 kDa to 157.3 kDa. The product has unique structures of complex monosaccharide composition, low molecular weight, appropriate uronic acid content, low esterification degree and the like; compared with CP which is single in structure and high in esterification, the CP is better in oxidation resistance and bile acid binding capacity; compared with hawthorn polysaccharide with low uronic acid content and high molecular weight, the hawthorn polysaccharide has the advantages that the enzyme inhibition activity is obviously enhanced, and the hawthorn polysaccharide has a wide prospect in development of functional food, health care products or medicines for regulating blood sugar / blood fat, resisting oxidation and preventing metabolic syndromes.

The invention relates to the field of medicine synthesis, and discloses a GLP-1 / GIP / GCG tri-agonist compound. The GLP-1 / GIP / GCG three-agonist compound is used for preparing a medicine composition for treating diseases, and the application of the medicine composition in preparing a medicine for treating at least one of the following diseases, namely, the GLP-1 / GIP / GCG three-agonist compound, and the GLP-1 / GIP / GCG three-agonist compound. The diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The invention provides application of a monascus composition in preparation of a medicine for preventing and / or treating coronary microcirculation disturbance. The monascus composition comprises one or more of cortex mori, ramulus mori and folium mori, monascus and radix puerariae. When the composition containing the red yeast rice is applied to preparation of the medicine for preventing and / or controlling coronary microcirculation disturbance, the abnormal microvascular structure can be improved (myocardial microvascular density MVD is increased, edema around microvessels is relieved, the lumen stenosis phenomenon is improved, and the endothelial cell condition is good); 2) microvascular occlusion is improved (pathologic results show that microvascular contents are reduced); (3) the abnormal vasodilatation and contraction function of the microvessels is improved (NO is increased); 4) improving blood lipid metabolism disorder; and (5) the heart function is improved (the left ventricular ejection fraction LVEF and the left ventricular short axis shortening rate LVFS are improved, and the left ventricular pressure maximum rising rate LV + dp / dtmax and the left ventricular pressure maximum falling rate LV-dp / dtmax are increased).

The invention discloses animal bifidobacterium subsp. Lactis BA-C9 capable of improving diabetes and application of the animal bifidobacterium subsp. Lactis BA-C9, the animal bifidobacterium subsp. Lactis BA-C9 is preserved in China Center for Type Culture Collection on March 11, 2024, and the preservation number is CCTCC NO: M2024457. The product prepared from the animal bifidobacterium subsp. Lactis BA-C9 has the beneficial effect of improving diabetes mellitus, can reduce fasting blood-glucose and liver injury, and has the capabilities of improving insulin resistance, glucose tolerance and dyslipidemia.

The invention belongs to the technical field of biological medicines, and particularly discloses a composition with functions of reducing blood sugar and blood fat as well as a preparation method and application of the composition. Chinese herbal compound medicinal materials are subjected to water extraction and high-temperature and high-pressure sterilization, and lactobacillus rhamnosus SHA113 bacterial sludge is resuspended in a water extract to obtain the composition of lactobacillus rhamnosus SHA113 and the Chinese herbal compound; the traditional Chinese medicine compound composition comprises astragalus membranaceus, raw Chinese yam, hawthorn, gynostemma pentaphylla, liquorice and jujube; the preservation number of the lactobacillus rhamnosus SHA113 is CCTCC (China Center For Type Culture Collection) NO: M 2017838; the lactobacillus rhamnosus SHA113 and traditional Chinese medicine compound composition can remarkably reduce the content of triglyceride and cholesterol in serum, control the fasting blood-glucose level, relieve accumulation of triglyceride and cholesterol in the liver and improve the oxidation resistance of the liver, has wide market potential and application prospects, and has wide application prospects. The compound can be applied to preparation of drugs for reducing blood sugar and blood fat.

The invention provides an intelligent intervention method for dyslipidemia based on multi-omics analysis, and aims to provide scientific and personalized treatment and lifestyle guidance for dyslipidemia patients. And the predictive ability of the deep learning model is combined with the interpretability and security verification mechanism of the knowledge graph and the rule engine, so that the scientificity, interpretability and security of each intervention scheme are ensured. An intervention scheme is generated through a deep learning model, and meanwhile, a knowledge graph and a rule engine are introduced, so that the interpretability, the safety and the dynamic adaptability of the scheme are ensured. By dynamically analyzing individualized genes, proteins and clinical characteristics, individualized treatment and lifestyle intervention suggestions are provided for patients. The model not only can significantly improve the curative effect and reduce the risk of adverse reactions, but also can realize continuous improvement of an individualized intervention scheme through real-time feedback and dynamic optimization, and provides an efficient blood fat management tool for doctors and patients.

The invention belongs to the technical field of microorganisms, and particularly relates to lactobacillus mucus BU360 with the function of improving uric acid, blood fat and blood glucose metabolism and application of the lactobacillus mucus BU360. The preservation number of the lactobacillus fermentum BU360 provided by the invention is CGMCC (China General Microbiological Culture Collection Center) No.33032. The lactobacillus fermentum BU360 provided by the invention has the advantages that the preservation number is CGMCC No.33032; the lactobacillus mucus BU360 can efficiently degrade guanosine and inosine which are precursor substances for synthesizing uric acid and directly degrade the uric acid, thalli, cell contents and metabolites of the lactobacillus mucus BU360 can inhibit the activity of xanthine oxidase and relieve HUA, and the lactobacillus mucus BU360 can directly degrade cholesterol and inhibit the activity of alpha-glucosidase and alpha-amylase, so that the lactobacillus mucus BU360 can be used for preparing the uric acid. The polypeptide has potential capability of improving blood fat and blood glucose metabolism abnormality, and assists in treatment of HUA; besides, the strain has relatively strong acid-resistant and cholate-resistant characteristics, can smoothly reach the intestinal tract of a human body, has relatively good safety on sensitivity of various antibiotics, and lays a foundation for development of related probiotic products. The lactobacillus mucus BU360 has a wide application prospect in the aspect of preparing products for relieving HUA, improving blood fat and blood glucose metabolism and the like.

The invention discloses a cape jasmine and fennel compound extract and a preparation method and application thereof, and belongs to the technical field of plant extracts.The preparation method of the cape jasmine and fennel compound extract comprises the steps that S1, a cape jasmine extract is prepared; s2, preparing a fennel extract; s3, the fennel extract and the fructus gardeniae extract are mixed according to a certain proportion to obtain the fructus gardeniae and fennel compound extract, the fennel extract prepared through the preparation method comprises an oil component and a water-soluble component, the compound extract achieves the effect of 1 + 1 > 2, has the remarkable effect of reducing blood fat and blood sugar, does not have side effects, and is suitable for large-scale popularization and application. The traditional Chinese medicine composition has an obvious regulating effect on blood pressure and blood fat of patients, has the efficacy of improving blood pressure, blood fat and blood sugar of patients, and is nontoxic and harmless to human bodies and free of side effects.

The invention belongs to the field of microorganisms, and provides lactobacillus paracasei Jlus660321 with a function of assisting in reducing blood fat and cholesterol and application of the lactobacillus paracasei Jlus660321, and the preservation number of the lactobacillus paracasei Jlus660321 is CGMCC No. 33962. The lactobacillus paracasei Jlus 660321 has the functions of assisting in lowering blood fat and lowering cholesterol, shows excellent cholesterol lowering performance in a cholesterol degradation experiment, and can degrade 61.60% of cholesterol in the experiment. A hemolysis experiment result is gamma-hemolysis, namely, hemolysis is avoided, and toxic and side effects are small. Rat in-vivo experiments show that the lactobacillus paracasei Jlus 660321 can effectively slow down the increase of body weight, liver weight, liver index, low-density lipoprotein content and triglyceride content caused by high-fat diet, and further show that the lactobacillus paracasei Jlus 660321 has the function of assisting in reducing blood fat and cholesterol; the compound can be used for preparing medicines, nourishment or health care products for assisting in reducing blood fat and / or reducing cholesterol.

The invention relates to the field of medicine synthesis, and discloses a GLP-1 / GCG dual-agonist compound. The GLP-1 / GCG dual-agonist compound provided by the invention is used for preparing a pharmaceutical composition for treating diseases, and application of the pharmaceutical composition in preparation of a medicine for treating at least one of the following diseases, the diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The invention provides a theaflavin composition for treating hypertension as well as a preparation method and application thereof, and relates to the technical field of medicines. The theaflavin composition comprises theaflavin, a celery seed extract, a gastrodia elata extract, a parasitic loranthus extract, a centella asiatica extract, a lotus leaf extract and a licorice extract. Wherein the theaflavin can regulate blood fat, inhibit atherosclerosis and improve the vascular endothelial function; the celery seed extract inhibits the activity of angiotensin converting enzyme, and cooperates with theaflavin to regulate blood pressure; the gastrodia elata extract can calm liver wind and improve cerebral circulation; the loranthus parasiticus extract has the effects of tonifying liver and kidney and regulating water sodium metabolism; the centella asiatica extract can resist inflammation and repair vascular endothelium; the lotus leaf extract can clear heat, promote diuresis, calm the liver and suppress yang; and the licorice extract harmonizes the medicines and resists oxidation. According to the invention, theaflavin is taken as a core, multi-dimensional effects of reducing blood pressure, protecting blood vessels and resisting inflammation and oxidation are realized, and a natural and comprehensive health management scheme is provided for hypertensive patients.

The invention discloses a composition for assisting in reducing blood sugar and blood fat as well as a preparation method and application thereof, and relates to the technical field of functional compositions. The composition comprises highland barley powder and modified inulin, the preparation method of the highland barley powder comprises the following steps: soaking highland barley grains in a weakly alkaline aqueous solution, and sequentially carrying out first pulse microwave treatment, enzyme deactivation treatment and segmented baking treatment; the segmented baking treatment comprises first-stage baking treatment and second-stage intermittent infrared irradiation treatment; the temperature of the first-stage baking treatment is 40-60 DEG C; the temperature of the second-stage intermittent infrared irradiation treatment is 60-80 DEG C, and the emission wavelength is 2.5-4 microns; the preparation method of the modified inulin comprises the following steps: performing acidolysis treatment on inulin in a weakly acidic aqueous solution, and then drying. The highland barley powder and the modified inulin in the embodiment can synergistically improve glycometabolism and lipid metabolism, effectively reduce the body weight, blood sugar, blood fat and the like under high-glucose and / or high-fat diet, and protect and repair the pancreas islet function.

The present disclosure relates to a stable pharmaceutical composition comprising a fixed dose combination of olbistetrapib and ezetimibe or a salt, solvate, or derivative of olbistetrapib and ezetimibe. The disclosure further describes the use of ezetimibe and Eubiquitrapib, for example in such fixed dose combinations, for the preparation of an agent for the treatment of a subject in need of lowering LDL-cholesterol or a subject suffering from hyperlipidemia or mixed dyslipidemia, and methods of treatment for the subject.

The invention belongs to the technical field of microorganisms, and particularly relates to lactobacillus plantarum GL-2 and application thereof. The invention provides a strain of lactobacillus plantarum which is preserved in the 8th road of Wuchang District in Wuhan City, Hubei Province on March 15, 2023, and the preservation number is CCTCC M 2023328. The results of the embodiment show that the lactobacillus plantarum GL-2 provided by the invention has the effects of reducing blood sugar and blood fat, and the lactobacillus plantarum GL-2 provided by the invention also has the effects of repairing inflammation damaged organs and regulating intestinal microorganisms.

The invention discloses a compound bacterial agent for reducing blood sugar and blood fat, application of the compound bacterial agent and a method for preparing a fermented coconut milk beverage from the compound bacterial agent, belongs to the technical field of microorganisms, and particularly relates to the compound bacterial agent for reducing blood sugar and blood fat, the compound bacterial agent comprises fermented lactobacillus mucus AL-8 and lactobacillus paracasei DX-5, and the compound bacterial agent is prepared from the fermented lactobacillus mucus AL-8, the lactobacillus paracasei DX-5, the lactobacillus paracasei DX-5, the lactobacillus paracasei DX-5 and the lactobacillus paracasei DX-5 and the lactobacillus paracasei DX-5 and the lactobacillus paracasei DX-5 and the lactobacillus paracasei DX-5 and the lactobacillus paracasei DX-5. The preservation number of the lactobacillus mucus AL-8 is CCTCC (China Center For Type Culture Collection) NO: M20252735; the preservation number of the lactobacillus paracasei DX-5 is CCTCC (China Center For Type Culture Collection) NO: M20252736. According to the invention, the fermented coconut milk beverage is prepared by utilizing the inhibition effect of a blood sugar and blood fat reducing compound bacterial agent consisting of fermented lactobacillus mucus AL-8 and casei paracasei DX-5 on alpha-amylase and pancreatic lipase.

The invention discloses a traditional Chinese medicine compound oral preparation for treating male oligoasthenospermia, and belongs to the technical field of traditional Chinese medicine preparations. The rhizoma polygonati processed with wine, the prepared rehmannia root and the like are used for nourishing the liver and kidney to consolidate congenital, the codonopsis pilosula, the astragalus membranaceus and the like are used for invigorating spleen and replenishing qi to complement postnatal, the fried cowherb seed is used for activating blood circulation, and the salted semen plantaginis is used for promoting diuresis, so that the problems of insufficient spermatogenesis and low vitality caused by deficiency of the spleen and the kidney are fundamentally solved. Experiments and clinical researches show that the preparation can significantly improve the sperm quantity, activity and activity rate of oligoasthenospermia model mice and patients, the clinical total effective rate reaches 90%, the pregnancy rate reaches 53.3%, and the curative effect is superior to that of Wuzi Yanzong pills in a control group. The action mechanism covers regulation of blood lipid metabolism, improvement of hypothalamus-pituitary-gonad axis functions, repair of testicular seminiferous tubule structural damage and reduction of lipid deposition, and meanwhile, oxidative stress and inflammatory injury are relieved and spermatogenic cell functions are protected by regulating and controlling a PPAR signal channel and inhibiting molecular pathways such as Cga / Sting mediated cell apoptosis.

Incretin analogs are provided that have activity at each of the glucose-dependent insulinotropic polypeptide (GIP), glucagon-like peptide-1 (GLP-1) and glucagon (GCG) receptors. The incretin analogs have structural features resulting in balanced activity and extended duration of action at each of these receptors. Methods also are provided for treating diseases such as type 2 diabetes mellitus, dyslipidemia, metabolic syndrome, non-alcoholic fatty liver disease, non-alcoholic steatohepatitis and obesity.

The invention relates to a lactobacillus rhamnosus YYSJ019 strain for relieving obesity and application of the lactobacillus rhamnosus YYSJ019 strain. The lactobacillus rhamnosus YYSJ019 strain is classified and named as lactobacillus rhamnosus, and the preservation number of the lactobacillus rhamnosus YYSJ019 strain is CGMCC (China General Microbiological Culture Collection Center) No.33472. The strain has good tolerance and high surface hydrophobicity in gastric juice, and has the potential of smoothly entering the gastrointestinal tract of a human body; the bacterial strain has excellent intestinal adhesion capability, and provides a basis for continuously playing a probiotic effect; the strain can slow down weight gain of obese mice and improve fat accumulation, liver injury and inflammation in bodies of the obese mice; the blood sugar metabolism capability and the blood fat metabolism capability can also be improved, and the potential of preventing and treating hyperglycemia or hyperlipidemia is achieved; in addition, a mouse small intestine endocrine cell line (STC-1 cell line) can be stimulated to generate the glucagon-like peptide-1, and the glucagon-like peptide-1 has the potential of improving diseases caused by insufficient secretion of the glucagon-like peptide-1; the effects of reducing uric acid in vitro and reducing uric acid in vivo are achieved, and the potential of preventing and treating hyperuricemia is achieved.

The invention relates to the technical field of biological medicine, and discloses an intestinal insulinotropic analogue with multiple biological activities, a synthesis method, a pharmaceutical composition and application, the synthesized intestinal insulinotropic analogue has triple agonist activity of a GLP-1 receptor, a glucagon receptor and a CCK-1 receptor, not only has the treatment effect of GLP-1 on diabetes, but also has the treatment effect of GLP-1 on CCK-1, and also has the effect of GLP-1 on CCK-1 on CCK-1. The traditional Chinese medicine composition also has the regulating effect of glucagon on lipolysis and energy metabolism and the beneficial effect of CCK on appetite inhibition, so that a synergistic effect is generated on sugar, fat and energy metabolism; the application has great potential in preparation of drugs for treating metabolic syndromes, such as diabetes, obesity, non-alcoholic fatty liver diseases, dyslipidemia and other diseases.