1403 results about "Blood lipids" patented technology

The invention relates to selenium-rich health-care rice dumplings. The selenium-rich health-care rice dumplings are prepared from the following raw materials of selenium-rich glutinous rice, rose petals, haw tree parasitism, plum tree parasitism, radix rehmanniae, dendrobium candidum, vegetable oil, pork, mung beans, ground cinnamon and table salt. The selenium-rich glutinous rice is used as a main raw material, so that selenium elements in human bodies are complemented, and collective antioxidation is strengthened; besides, the glutinous rice and the mung beans are soaked in a traditional Chinese medicine extracting solution, and medical components in traditional Chinese medicines are absorbed, so that the selenium-rich health-care rice dumplings have the efficacies of clearing heat, promoting salivation, relieving restlessness, resolving stagnation, reducing blood lipid, promoting digestion and enhancing the immunity of organisms.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention relates to application of fermentation lactobacillus mucus LFPerfectuus001 in preparation of a product for improving metabolic syndrome caused by high-fat and high-sugar diet, and belongs to the technical field of microorganisms. The invention provides application of fermented lactobacillus mucus LFPerfecus001 in preparation of a product for improving metabolic syndrome, the fermented lactobacillus mucus LFPerfecus001 is preserved in Guangdong Microbial Culture Collection Center on April 13, 2022, and the preservation number is GDMCC No: 62335. The invention further provides a preparation method of the fermented lactobacillus mucus LFPerfecus001. Animal experiments report that the fermented lactobacillus mucus LFPerfectus001 has the effects of reducing fat, increasing muscle, improving obesity, hyperglycemia, insulin resistance, dyslipidemia, hyperuricemia and fatty liver for the first time, and can well improve metabolic syndrome caused by high fat and high glucose.

The invention relates to pediococcus pentosaceus with a cholesterol lowering function and application thereof, and belongs to the technical field of microorganisms. The invention discloses pediococcus pentosaceus with a cholesterol lowering function and application of the pediococcus pentosaceus. The pediococcus pentosaceus R5 (GDMCC No.65659) is separated from special fermented food stinky acid in Guizhou. The in-vitro cholesterol removal rate of the pediococcus pentosaceus R5 can reach 59%, and the pediococcus pentosaceus R5 has the characteristics of acid / cholate resistance, no hemolysis and sensitivity to common antibiotics; an in-vivo lipid-lowering experiment is carried out on a hyperlipidemia model mouse, and the result shows that the strain R5 can remarkably improve the in-vivo dyslipidemia state of the mouse, reduce liver fat accumulation and protect the liver at the same time, and can be used for developing lipid-lowering related probiotic functional products. The strain R5 provided by the invention provides a natural and safe probiotic for preventing and / or treating hyperlipemia.

The invention relates to the field of microorganisms, and discloses a strain of lactobacillus acidophilus and application of the lactobacillus acidophilus in preparation of drugs for preventing and / or treating hyperlipidemia and hyperglycemia, the preservation number of the lactobacillus acidophilus is CGMCC No.33155, the strain can generate lactic acid, is resistant to acid and cholate, and has strong self-aggregation ability and hydrophobic ability. The strain provided by the invention can promote the decomposition of fat and sugar by degrading cholesterol and inhibiting the activity of alpha-glucosidase and alpha-amylase, can reduce the expression levels of blood sugar, blood fat and inflammatory factors of hyperlipidemia and hyperglycemia mice, and provides a new idea for preparing medicines for preventing and / or treating hyperglycemia and hyperlipidemia.

The invention discloses pediococcus acidilactici and application thereof, and relates to the technical field of microorganisms. The pediococcus acidilactici is pediococcus acidilactici Mei.1103.1, the preservation unit is China General Microbiological Culture Collection Center, the preservation number is CGMCC NO.32564, the preservation date is November 11, 2024, the preservation address is Institute of Microbiology, Chinese Academy of Sciences, No. 3, No.1 Yard, Beichen West Road, Chaoyang District, Beijing, and the preservation number is CGMCC NO.32564. The pediococcus acidilactici Mei.1103.1 is CGMCC NO.32564. The pediococcus acidilactici Mei.1103.1. The invention also provides application of the fermented dry rice flour in preparation of products for reducing uric acid, preventing / treating hyperuricemia, regulating immunity, preventing / treating kidney injury and preventing / treating fatty liver and fermented dry rice flour. The bacterium can reduce uric acid and relieve hyperuricemia; regulating blood fat; kidney and liver injuries caused by hyperuricemia are repaired; the content of volatile flavor compounds in the fermented dry rice flour is increased.

The invention discloses a blood fat test card based on a photochemical principle, and belongs to the technical field of in-vitro detection. The blood fat detection card comprises a card body, the card body is provided with a sample adding port, a correction area and at least one test area, the sample adding port is respectively communicated with the correction area and the test area, and the correction area and the test area are respectively provided with an air hole communicated with the outside; the correction area is provided with a reaction film and a hemolytic agent; and the test area is provided with an enzyme layer and an interference removing film corresponding to a to-be-detected item. The photochemical principle is adopted, the reflected light values of the test area and the correction area before and after the reaction are obtained, the luminosity value difference related to the initial concentration and hematocrit of the item to be detected is obtained, the concentration value of the item to be detected is corrected through the luminosity value difference related to the hematocrit, and therefore the corrected concentration value of the item to be detected is calculated. The detection result is more accurate and reliable, and the operation is simple.

The present invention provides a method for increasing glycemic control in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. The present invention provides a method for improving weight management in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. Further providing a method for treating a condition selected from atherosclerosis, chronic kidney disease, NAFLD, and NASH. Further provided is a method to prevent or induce remission of diabetes comprising administration of tirzepatide, or a pharmaceutically acceptable salt thereof. Further provided is a dosing regimen for increasing glycemic control, improving weight management, and / or treating dyslipidemia.

The present disclosure relates to RNAi agents, e.g., double stranded RNAi agents such as siRNAs, able to Inhibin Subunit Beta E (INHBE) gene expression. Also disclosed are pharmaceutical compositions that include INHBE RNAi agents and methods of use thereof. The INHBE RNAi agents disclosed herein may be conjugated to targeting ligands to facilitate the delivery to cells, including to hepatocytes. Delivery of the INHBE RNAi agents in vivo provides for inhibition of INHBE gene expression. The RNAi agents can be used in methods of treatment of diseases, disorders, or symptoms mediated in part by INHBE gene expression, such as obesity, diabetes, liver inflammation, dyslipidemia, or metabolic disease.

The invention relates to the field of biological medicine, in particular to application of hispidulin in preparation of a lipid de novo synthesis inhibitor or a metabolism-related fatty liver disease treatment or prevention product. The hispidulin disclosed by the invention has a chemical structure as shown in a formula (I). The hispidulin in the invention reverses liver cell lipid droplet excessive infiltration induced by high-dose fructose in a dose-dependent manner; furthermore, the hispidulin dose-dependent ameliorating obesity signs in HFD-induced MAFLD model mice, including liver weight, body weight, blood lipid level, liver fat content, and insulin resistance, without significantly reducing food intake.

There is provided the use of Lactobacillus paracasei or a afterbiogen in the preparation of a pharmaceutical composition or a food composition for the production of tryptophan-binding cholic acid. The Lactobacillus paracasei or the afterbiogen thereof can be used to prevent and / or treat metabolic diseases or to promote the production of GLP-1 and / or insulin, or to maintain blood glucose healthy levels, to maintain blood lipid health and / or to control fat in the body.

The invention provides a hypoglycemic peptide which is prepared by taking bovine whey protein as a raw material and is stable in gastrointestinal digestion and absorption. In an in-vitro cell experiment, the peptide fragment can improve the uptake of insulin-resistant HepG2 hepatocytes and synthesize glycogen by using glucose, can promote intestinal endocrine cells NCI-H716 to secrete GLP-1, has a certain synergistic effect, and can further play the effects of promoting GLP-1 secretion and activating a GLP-1 receptor through combined use. An insulin resistance mouse model is constructed by utilizing high-fat diet, and the peptide fragment is adopted for intervention, so that the hypoglycemic peptide is further proved to have obvious effects on losing weight, reducing lipid accumulation and assisting in reducing blood fat, and meanwhile, the hypoglycemic peptide can be used for improving insulin resistance related symptoms. The milk peptide provided by the invention has gastrointestinal digestion stability and hypoglycemic activity, can be used as a functional milk base material for developing food, medicines or health care products with the effect of regulating blood sugar, and is wide in application prospect.

The invention discloses a polypeptide or a pharmaceutically acceptable salt thereof. The polypeptide has an amino acid sequence as shown in SEQ ID NO: 1 or an amino acid sequence in a conservative modification form thereof. The polypeptide or the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP1R and is used for effectively activating the GLP1R. The GLP1R activating polypeptide is obtained through precise calculation and deep learning model optimization, has a short sequence, has unique amino acid arrangement compared with a traditional GLP-1 analogue, can effectively activate a GLP1R receptor, can also be used for treating or preventing metabolic disorder related diseases, and has a good application prospect. For example, obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes, non-alcoholic fatty liver diseases and the like.

The invention relates to the field of medicine synthesis, and discloses a GCG-GLP-1 dual agonist compound. The GCG-GLP-1 dual-agonist compound provided by the invention is used for preparing a pharmaceutical composition for treating diseases, and the application of the pharmaceutical composition in preparing a medicine for treating at least one of the following diseases, the diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The invention discloses a long-acting polypeptide analogue and application thereof, the polypeptide analogue can act on a GLP-1 receptor, a GIP receptor and a Y2 receptor at the same time, and can play the biological activities of GLP-1, GIP and PYY3-36 at the same time; the PYY3-36 GLP-1 has the treatment effect of GLP-1 on diabetes mellitus, also has the beneficial effect of GIP on glucose and lipid metabolism and appetite inhibition, and also has the beneficial effect of PYY3-36 on appetite inhibition, so that the PYY3-36 GLP-1 has a synergistic effect on glucose, lipid and energy metabolism; the application of the compound in preparation of drugs for treating metabolic syndromes, such as diabetes, obesity and dyslipidemia, has greater potential in preparation of drugs for treating diseases such as diabetes, obesity and dyslipidemia.

The invention provides a blood fat reducing polypeptide as well as a screening method and application thereof, and belongs to the field of polypeptides. The blood fat reducing polypeptide provided by the invention comprises at least one of 116 polypeptides with amino acid sequences of FFPFF, VFFFPF, PFFFF, AFFFPFF, LFFFPFY and the like. The blood fat reducing polypeptide provided by the invention can effectively reduce blood fat, has no obvious toxic or side effect, shows good inhibitory activity on steroid esterase and lipase in an in-vitro enzyme activity test, and also can effectively reduce blood fat in an animal in-vivo experiment; and no obvious toxic or side effect is shown in toxicity prediction and animal in-vivo models.

The invention relates to the field of medicine synthesis, and discloses a GLP-1 / GIP / GCG tri-agonist compound. The GLP-1 / GIP / GCG three-agonist compound is used for preparing a medicine composition for treating diseases, and the application of the medicine composition in preparing a medicine for treating at least one of the following diseases, namely, the GLP-1 / GIP / GCG three-agonist compound, and the GLP-1 / GIP / GCG three-agonist compound. The diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The invention relates to an application of an Sdccag3 gene in preparation of a weight-reducing medicine for regulating glucose and lipid metabolism. The Sdccag3 gene is used as an action target to be applied to preparation or screening of the weight-reducing medicine for regulating glucose and lipid metabolism, and the nucleotide sequence of the Sdccag3 gene is as shown in SEQ ID No. 1. According to the application disclosed by the invention, the specific overexpressed Sdccag3 in adipose tissues in a mouse body can obviously inhibit the increase of the blood fat level, and the overexpressed Sdccag3 can also obviously improve the poor glucose tolerance, improve the insulin sensitivity, reduce the levels of serum triglyceride, cholesterol and low-density lipoprotein cholesterol of an obese mouse, improve the poor glucose tolerance and improve the insulin sensitivity. The insulin sensitivity is improved, obesity-related glycolipid metabolism is effectively regulated and controlled, the effect of reducing blood lipid and blood sugar is achieved, and the compound can be used for preparing weight-losing drugs for reducing blood lipid and blood sugar.

The invention belongs to the technical field of plant extracts, and particularly relates to application of a carob bean extract in a medicine for improving glycometabolism / female polycystic ovarian syndrome. The invention discloses a pharmaceutical composition for improving glycometabolism female polycystic ovarian syndrome. The pharmaceutical composition is prepared from a carob bean extract, baicalein, cedrol, bioactive peptide, biological polysaccharide and auxiliary materials. The composition disclosed by the invention has the effects of reducing blood sugar, reducing blood fat and improving an insulin function, and also has the effects of resisting oxidation, enhancing immunity and the like, and the substances are combined for use, so that a synergistic interaction effect is achieved, and the effect of improving / treating the abnormal glucose metabolism related female polycystic ovarian syndrome is further improved.

The invention relates to the field of medicines, foods or health-care products, in particular to big-fruit hawthorn heteropolysaccharide as well as a preparation method and application thereof. The large-fruit hawthorn heteropolysaccharide is prepared from galacturonic acid, glucuronic acid, mannose, xylose, arabinose, glucose, galactose, fucose and rhamnose. The weight-average molecular weight of the big fruit hawthorn heteropolysaccharide is 81.6 kDa to 157.3 kDa. The product has unique structures of complex monosaccharide composition, low molecular weight, appropriate uronic acid content, low esterification degree and the like; compared with CP which is single in structure and high in esterification, the CP is better in oxidation resistance and bile acid binding capacity; compared with hawthorn polysaccharide with low uronic acid content and high molecular weight, the hawthorn polysaccharide has the advantages that the enzyme inhibition activity is obviously enhanced, and the hawthorn polysaccharide has a wide prospect in development of functional food, health care products or medicines for regulating blood sugar / blood fat, resisting oxidation and preventing metabolic syndromes.

The invention provides a pharmaceutical composition containing lactoferrin and application of the pharmaceutical composition in blood fat reduction. Specifically, the KGT-C polypeptide provided by the invention has a very strong effect of reducing the synthesis amount of cholesterol in cells, and after the KGT-C polypeptide is combined with lactoferrin, the generation of cholesterol and LDL can be remarkably reduced, so that the KGT-C polypeptide has a relatively good effect of treating hyperlipidemia.

The invention relates to the field of medicine synthesis, and discloses a GLP-1 / GIP / GCG tri-agonist compound. The GLP-1 / GIP / GCG three-agonist compound is used for preparing a medicine composition for treating diseases, and the application of the medicine composition in preparing a medicine for treating at least one of the following diseases, namely, the GLP-1 / GIP / GCG three-agonist compound, and the GLP-1 / GIP / GCG three-agonist compound. The diseases include type II diabetes mellitus, impaired glucose tolerance, type I diabetes mellitus, obesity, hypertension, metabolic syndrome, dyslipidemia, cognitive impairment, atherosclerosis, myocardial infarction, coronary heart disease, cardiovascular disease, stroke, inflammatory bowel syndrome and / or dyspepsia or gastric ulcer, hepatic fibrosis disease and pulmonary fibrosis disease.

The present invention belongs to the field of biomedicine technology, and specifically relates to a fermented white lentil polysaccharide, an extraction method and application thereof. The present invention firstly utilizes Bacillus natto to ferment white lentils, and then respectively extracts polysaccharides from the white lentils fermented by Bacillus natto by traditional hot water leaching and ultrasound-assisted enzymolysis, and obtains products of polysaccharide structure, and all have water solubility, water holding capacity, antioxidant capacity, blood sugar lowering capacity and blood lipid lowering capacity. A new type of polysaccharide is obtained by the extraction method of the present invention, which has a low price, wide application, and development and commercial value.

The invention provides application of a monascus composition in preparation of a medicine for preventing and / or treating coronary microcirculation disturbance. The monascus composition comprises one or more of cortex mori, ramulus mori and folium mori, monascus and radix puerariae. When the composition containing the red yeast rice is applied to preparation of the medicine for preventing and / or controlling coronary microcirculation disturbance, the abnormal microvascular structure can be improved (myocardial microvascular density MVD is increased, edema around microvessels is relieved, the lumen stenosis phenomenon is improved, and the endothelial cell condition is good); 2) microvascular occlusion is improved (pathologic results show that microvascular contents are reduced); (3) the abnormal vasodilatation and contraction function of the microvessels is improved (NO is increased); 4) improving blood lipid metabolism disorder; and (5) the heart function is improved (the left ventricular ejection fraction LVEF and the left ventricular short axis shortening rate LVFS are improved, and the left ventricular pressure maximum rising rate LV + dp / dtmax and the left ventricular pressure maximum falling rate LV-dp / dtmax are increased).

The invention discloses animal bifidobacterium subsp. Lactis BA-C9 capable of improving diabetes and application of the animal bifidobacterium subsp. Lactis BA-C9, the animal bifidobacterium subsp. Lactis BA-C9 is preserved in China Center for Type Culture Collection on March 11, 2024, and the preservation number is CCTCC NO: M2024457. The product prepared from the animal bifidobacterium subsp. Lactis BA-C9 has the beneficial effect of improving diabetes mellitus, can reduce fasting blood-glucose and liver injury, and has the capabilities of improving insulin resistance, glucose tolerance and dyslipidemia.

The invention relates to the technical field of microorganisms, in particular to animal combined lactobacillus LA-1, a microbial preparation and application of the animal combined lactobacillus LA-1 and the microbial preparation. Animal combined lactobacillus has been preserved in the China General Microbiological Culture Collection Center (CGMCC) on September 27, 2024, the preservation address is No.3, Yard 1, Beichen West Road, Chaoyang District, Beijing, and the preservation number is CGMCC No.32098. The animal combined lactobacillus has the advantages that the animal combined lactobacillus LA-1 is preserved in the China General Microbiological Culture Collection Center (CGMCC), the preservation number is CGMCC No.32098, and the preservation number is CGMCC No.32098; animal combined lactobacillus LA-1 has the efficacy of remarkably reducing cholesterol content and bile salt hydrolase activity, can inhibit alpha-glucosidase activity, is high in fatty acid absorption rate, has safety, is sensitive to common antibiotics, can relieve obesity, reduce blood fat and liver lipid accumulation, relieve liver lipid degeneration and fat hypertrophy, and has the efficacy of reducing cholesterol content and bile salt hydrolase activity. The liver protection and liver function enhancement effects are achieved, and the good application prospect is achieved in the aspect of functional product preparation.

The invention belongs to the technical field of biological medicines, and particularly discloses a composition with functions of reducing blood sugar and blood fat as well as a preparation method and application of the composition. Chinese herbal compound medicinal materials are subjected to water extraction and high-temperature and high-pressure sterilization, and lactobacillus rhamnosus SHA113 bacterial sludge is resuspended in a water extract to obtain the composition of lactobacillus rhamnosus SHA113 and the Chinese herbal compound; the traditional Chinese medicine compound composition comprises astragalus membranaceus, raw Chinese yam, hawthorn, gynostemma pentaphylla, liquorice and jujube; the preservation number of the lactobacillus rhamnosus SHA113 is CCTCC (China Center For Type Culture Collection) NO: M 2017838; the lactobacillus rhamnosus SHA113 and traditional Chinese medicine compound composition can remarkably reduce the content of triglyceride and cholesterol in serum, control the fasting blood-glucose level, relieve accumulation of triglyceride and cholesterol in the liver and improve the oxidation resistance of the liver, has wide market potential and application prospects, and has wide application prospects. The compound can be applied to preparation of drugs for reducing blood sugar and blood fat.

The invention discloses a preparation method and processing equipment of herbal composite granules, and relates to the technical field of composite granules. Comprising the following components in parts by weight: 15-20 parts of soybean phospholipid, 10-15 parts of glutamine, 10-15 parts of L-arginine, 5-10 parts of a ginseng extract, 5-10 parts of phytosterol, 5-10 parts of xylooligosaccharide, 5-10 parts of inositol, 5-10 parts of a hawthorn extract, 5-10 parts of a blueberry extract, 5-10 parts of an acerola cherry extract, 0-5 parts of yeast beta glucan, 0-5 parts of a sea-buckthorn extract, 0-5 parts of a tartary buckwheat extract, 0-5 parts of haematococcus pluvialis and the like. The composition is innovative and breakthrough in successful application in the aspects of heart and cerebral vessels and anti-aging, and can regulate intestines, protect liver, reduce blood pressure and regulate blood fat; thrombus is melted, the vascular endothelial function is improved, and arteriosclerosis is prevented; meanwhile, the effects of resisting oxidation, resisting inflammation, resisting aging and enhancing immunity can also be achieved.

The invention provides an intelligent intervention method for dyslipidemia based on multi-omics analysis, and aims to provide scientific and personalized treatment and lifestyle guidance for dyslipidemia patients. And the predictive ability of the deep learning model is combined with the interpretability and security verification mechanism of the knowledge graph and the rule engine, so that the scientificity, interpretability and security of each intervention scheme are ensured. An intervention scheme is generated through a deep learning model, and meanwhile, a knowledge graph and a rule engine are introduced, so that the interpretability, the safety and the dynamic adaptability of the scheme are ensured. By dynamically analyzing individualized genes, proteins and clinical characteristics, individualized treatment and lifestyle intervention suggestions are provided for patients. The model not only can significantly improve the curative effect and reduce the risk of adverse reactions, but also can realize continuous improvement of an individualized intervention scheme through real-time feedback and dynamic optimization, and provides an efficient blood fat management tool for doctors and patients.

The invention belongs to the technical field of microorganisms, and particularly relates to lactobacillus mucus BU360 with the function of improving uric acid, blood fat and blood glucose metabolism and application of the lactobacillus mucus BU360. The preservation number of the lactobacillus fermentum BU360 provided by the invention is CGMCC (China General Microbiological Culture Collection Center) No.33032. The lactobacillus fermentum BU360 provided by the invention has the advantages that the preservation number is CGMCC No.33032; the lactobacillus mucus BU360 can efficiently degrade guanosine and inosine which are precursor substances for synthesizing uric acid and directly degrade the uric acid, thalli, cell contents and metabolites of the lactobacillus mucus BU360 can inhibit the activity of xanthine oxidase and relieve HUA, and the lactobacillus mucus BU360 can directly degrade cholesterol and inhibit the activity of alpha-glucosidase and alpha-amylase, so that the lactobacillus mucus BU360 can be used for preparing the uric acid. The polypeptide has potential capability of improving blood fat and blood glucose metabolism abnormality, and assists in treatment of HUA; besides, the strain has relatively strong acid-resistant and cholate-resistant characteristics, can smoothly reach the intestinal tract of a human body, has relatively good safety on sensitivity of various antibiotics, and lays a foundation for development of related probiotic products. The lactobacillus mucus BU360 has a wide application prospect in the aspect of preparing products for relieving HUA, improving blood fat and blood glucose metabolism and the like.