301 results about "Hepatic Diseases" patented technology

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

The invention provides a method for drug screening and disease model construction of liver organoid, relates to the technical field of medical research, and adopts multi-modal data acquisition, fusion and intelligent analysis and quantum computing processing to optimize comprehensive application of data, so that the richness, accuracy and analysis efficiency of the data are remarkably improved, and the risk of drug screening and disease model construction of liver organoid is reduced. Multi-source data of genomics, transcriptomics and the like are collected comprehensively, an accurate research system of immune-hepatic disease interaction based on organoid is constructed, an in-vivo complex immune-hepatic disease microenvironment can be highly simulated, the proportion and activation state of immune cells are accurately regulated and controlled in an in-vitro model, functional and phenotypic changes of the immune cells are monitored in real time, and the immune-hepatic disease interaction accuracy is improved. According to the present invention, the interaction mechanism between the immune cells and the liver organ cells is deeply revealed, such that the accurate information basis is provided for the accurate determination of the drug action target, the development of the innovative drug for the immune check point or tumor microenvironment regulation is easily achieved, and the pertinence and the success rate of the drug research and development are substantially improved.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The present disclosure provides a class of compounds represented by formula (I '), or tautomers, stereoisomers or pharmaceutically acceptable salts thereof. The compound disclosed by the invention has a relatively strong agonistic effect on GLP-1R, can be used for treating diseases such as diabetes mellitus, metabolism-related fatty liver diseases, Alzheimer's disease and the like or has an effect of reducing weight. # imgabs0 #

Provided are a compound represented by formula (I'), or a tautomer, stereoisomer or pharmaceutically acceptable salt thereof. The compound represented by formula (I') has a strong agonistic effect on GLP-1R, and can treat diseases such as diabetes, metabolic-associated fatty liver diseases, and Alzheimer's disease, or has a weight loss effect.

The invention relates to the technical field of microorganisms, in particular to application of pediococcus acidilactici ZJUIDS13 in improvement of liver diseases, including improvement of alcoholic liver diseases and improvement of fatty liver diseases related to metabolic dysfunction. The pediococcus acidilactici ZJUIDS13 has relatively strong capability of protecting liver injury induced by alcohol, and can improve the states of liver injury and lipid metabolism disorder caused by high fat diet.

The present invention relates to pro-nano-emulsion compositions comprising at least one type of Omega 3 fatty acid capable of converting to nano-emulsion composition having average droplet size of below Ip, typically below 0.5p, and use thereof, particularly as dietary supplement, for preferential delivery of the Omega 3 fatty acid to heart and / or liver tissue of a subject consuming the composition, thereby maintaining normal cardiovascular / hepatic function and / or improving cardiovascular / hepatic disease or disorders.

The invention belongs to the technical field of biological medicine, and particularly relates to a chondroitin sulfate oligosaccharide derivative and a preparation method and application thereof.The structure of the chondroitin sulfate oligosaccharide derivative is shown in the formula I # imgabs0 #, in the formula I, R1 is SO3H and R2 is H or R1 is H and R2 is SO3H, and the polymerization degree of the chondroitin sulfate oligosaccharide derivative is equal to 8; the chondroitin sulfate oligosaccharide derivative has good chronic hepatitis repair promotion and anti-inflammatory activity, is clear in structure, and can be orally taken to treat the non-alcoholic fatty liver disease.

The invention provides application of combined cholic acid TrpCA and producing bacteria thereof in treating and preventing metabolic diseases. The present invention relates to the use of tryptophan-binding cholic acid or a producing bacterium thereof in the preparation of a composition for preventing and / or treating a metabolic disease or for promoting the production of GLP-1 and / or insulin. The inventor finds for the first time that tryptophan-bound cholic acid can remarkably promote secretion of GLP-1 on an in-vivo animal model and an in-vitro cell model, the effects of reducing weight, reducing blood sugar and relieving the symptoms of the non-alcoholic fatty liver disease are achieved, and the same metabolism improvement effect can also be achieved through planting of probiotics capable of generating cholic acid TrpCA.

The present application belongs to the field of biomedicine technology, and specifically relates to a chondroitin sulfate oligosaccharide derivative and a preparation method and application thereof. The structure of the chondroitin sulfate oligosaccharide derivative is shown in Formula I, #imgabs0#Formula I, where R1 is SO3H, R2 is H or R1 is H, R2 is SO3H, and the polymerization degree of the chondroitin sulfate oligosaccharide derivative is equal to 8; the chondroitin sulfate oligosaccharide derivative has good promotion of chronic hepatitis repair and anti-inflammatory activity, and has a clear structure, and can be used for oral treatment of non-alcoholic fatty liver disease.

The invention discloses a polypeptide or a pharmaceutically acceptable salt thereof. The polypeptide has an amino acid sequence as shown in SEQ ID NO: 1 or an amino acid sequence in a conservative modification form thereof. The polypeptide or the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP1R and is used for effectively activating the GLP1R. The GLP1R activating polypeptide is obtained through precise calculation and deep learning model optimization, has a short sequence, has unique amino acid arrangement compared with a traditional GLP-1 analogue, can effectively activate a GLP1R receptor, can also be used for treating or preventing metabolic disorder related diseases, and has a good application prospect. For example, obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes, non-alcoholic fatty liver diseases and the like.

The invention provides application of a lactobacillus mucus fermentation strain A21196 in preparation of a product for promoting ethanol metabolism, and belongs to the technical field of microbial preparations. The lactobacillus mucus fermentation strain A21196 has the high-yield ethanol dehydrogenase and acetaldehyde dehydrogenase, and has the effects of reducing the content of ethanol and acetaldehyde in the blood of mice suffering from acute alcoholism and shortening the central nervous inhibition time in vivo. Therefore, the invention provides the application of the fermented lactobacillus mucus strain A21196 in preparation of a product for preventing and / or treating the alcoholic liver injury or the alcoholic liver disease.

An application method of a modified peptide derived from Urechis unicinctus is to prepare a drug for treating alcoholic liver disease. The modified peptide derived from Urechis unicinctus is one or more selected from F2-1: IHVKF (SEQ ID NO: 1), F2-2: VHFKI (SEQ ID NO: 2), F4-1: GAWKP (SEQ ID NO: 3), F4-2: AGWKP (SEQ ID NO: 4), F5-1: GTLKP (SEQ ID NO: 5), F5-2: GTPKL (SEQ ID NO: 6), F7-1: IIVRM (SEQ ID NO: 7), and F7-2: IRMVI (SEQ ID NO: 8). The modified peptide derived from Urechis unicinctus can enhance the degradation of alcohol and boost the survival rate of cells with alcoholic liver disease, and also alleviate lipid metabolism and inflammation in mice, protecting liver from alcoholic liver disease. When applied in drug development for treating alcoholic liver disease, the application method offers low-risk, low-cost, and is simple to operate therapeutic options.

The disclosure provides methods and compositions for treating pancreatic and hepatic disease such as, pancreatic steatosis, pancreatic cancer, non-alcoholic fatty liver disease, non-alcoholic steatohepatitis, and hepatic cancer. The provided methods include administering an effective amount of a HIF1-α Pathway Inhibitor or a HIF1-α Inhibitor and an PFKFB3 inhibitor to the subject having or at risk of having pancreatic and / or hepatic disease. The provided methods include administering an effective amount of a HIF1-α Pathway Inhibitor or a HIF1-α Inhibitor and an PFKFB3 inhibitor to the subject having or at risk of having pancreatic and / or hepatic disease.

Disclosed herein are compositions comprising siRNAs capable of downregulating SET and MYND (Myeloid-Nervy-DEAF1) domain-containing protein 2 (SMYD2) gene expression or a variant thereof. Also disclosed herein are methods of using SMYD2 inhibitors in the treatment of a liver disease or injury, such as fatty liver disease (FLD), non-alcoholic fatty liver disease (NAFLD) or non-alcoholic steatohepatitis (NASH).

The invention discloses a multi-classification auxiliary prediction method and system for metabolism-related fatty liver diseases, electronic equipment and a storage medium, belongs to the field of medical data processing, and is used for solving the problem that a traditional MAFLD binary prediction model cannot fully reflect continuous pedigree of disease severity. The method comprises the following steps: acquiring clinical data related to classification prediction of metabolism-related fatty liver diseases; performing label coding, missing value filling and feature screening on the clinical data; and inputting the screened features into a TabNet classification model optimized by a particle swarm algorithm, and outputting a risk classification result of the metabolism-related fatty liver disease. According to the method, the severity of the fatty liver can be more accurately evaluated, the liver health condition of a patient is comprehensively reflected, and more accurate treatment guidance is provided for clinical diagnosis.

The invention relates to the technical field of liver disease prediction, in particular to a metabolism-related fatty liver disease intelligent prediction method and system and a storage medium. The method comprises the following steps: collecting multi-source data, respectively obtaining basic demographic information, laboratory indexes and prediction indexes, and extracting quantitative and qualitative tongue picture parameters; performing variable screening on the tongue picture parameters and the clinical indexes, and determining key prediction variables; obtaining a key variable value according to the key prediction variable, obtaining a prediction result of the occurrence risk of the metabolism-related fatty liver disease, and outputting the prediction result; the system comprises a multi-source data acquisition module, a variable screening module and a prediction result acquisition module. By means of the mode, the intelligent tongue picture parameters and the clinical indexes are fused, and the effect of early prediction of the metabolism-related fatty liver diseases is achieved.

The invention discloses application of a lucid ganoderma extract combined with clostridium butyricum in preparation of fat-reducing food or medicine. The invention finds that the ganoderma lucidum extract is combined with clostridium butyricum for use, so that the weight gain of a mouse induced by high-fat diet can be obviously slowed down, the epididymal fat weight of the high-fat mouse is reduced, and the lipid accumulation in the liver and serum of the mouse is reduced; according to the present invention, with the application of the polypeptide, the fat cell size is reduced, the expression of the key gene mRNA related to lipid metabolism and synthesis in the mouse liver is reduced, the intestinal flora of the mouse is regulated, the obesity can be well improved, and the important application prospect in the preparation of the drugs or food for treating diabetes, reducing blood fat, obesity and non-alcoholic fatty liver disease is provided.

The invention belongs to the technical field of biological medicines, and particularly relates to a traditional Chinese medicine composition for treating metabolism-related fatty liver diseases and a preparation method thereof. The technical problem to be solved by the invention is to provide a new choice for treating metabolism-related fatty liver diseases. According to the technical scheme, the traditional Chinese medicine composition for treating the metabolism-related fatty liver disease is prepared from the following components: radix paeoniae rubra, cyrtomium fortunei, curcuma zedoary, sculellaria barbata, herba epimedii, fingered citron, semen cassiae and herba artemisiae scopariae. The invention is mainly used for providing a new choice for treating the metabolism-related fatty liver disease, and has a wide application prospect.

The invention provides a new target for treating metabolism-related fatty liver diseases, a regulation molecule and application thereof. The invention discloses a novel target gene closely related to relieving or treating the metabolism-related fatty liver disease and a signal channel related to upstream and downstream regulation and control of the target gene for the first time. The invention discloses a new mechanism participated by the signal channel and used for regulating and controlling the metabolism-related fatty liver disease. Preferred remission / therapeutic agents are also disclosed.

The invention discloses a construction method and application of a metabolic disorder related fatty liver disease damp-heat syndrome mouse model, and relates to the technical field of biological model construction.The construction method is technically characterized in that the damp-heat environment is simulated through a simple and convenient method of combining a silica gel heating plate with wet padding, and high-fat and high-sugar feed feeding is combined, so that the metabolic disorder related fatty liver disease damp-heat syndrome mouse model is obtained. The MASLD damp-heat syndrome mouse model is stably induced, and the equipment acquisition difficulty and the modeling cost in the research process are reduced; the mouse model is used for research on construction of MASLD of various symptom types mainly including damp-heat.

The invention belongs to the technical field of traditional Chinese medicine research, and particularly relates to ganoderma lucidum polysaccharide and an extraction method and application thereof. The structural formula of the ganoderan is shown as a formula I in the specification. The ganoderan extracted by the invention can repair intestinal barriers by promoting the growth of beneficial intestinal bacteria, alleviate liver inflammation by targeting LPS / TLR4 / NF-kappa B / MAPK signal pathways, and reduce fat accumulation, thereby effectively alleviating the non-alcoholic fatty liver disease; and # imgabs0 #.

The present invention relates to the application of a silymarin pharmaceutical composition in the preparation of a drug for treating fatty liver disease, and belongs to the field of medical technology. The present invention provides the application of a pharmaceutical composition in the preparation of a drug for preventing and / or treating fatty liver disease, wherein the active ingredient of the pharmaceutical composition comprises a 7-KDCA regulator; the 7-KDCA regulator comprises silymarin, or the 7-KDCA regulator comprises silybin, silybin, silybinin and / or isosilybin; the silybin comprises silybin A and / or silybin B; the isosilybin comprises isosilybin A and / or isosilybin B. Studies have shown that the pharmaceutical composition can effectively and safely treat fatty liver disease at a low dose, has anti-inflammatory activity, and has a mimetic nerve growth factor activity, and has great application prospects in the preparation of drugs for preventing and / or treating fatty liver disease, anti-inflammatory, and preventing and / or treating Alzheimer's disease.

The invention belongs to the technical field of animal model construction, and particularly relates to a non-alcoholic fatty liver disease mouse model based on humanized PNPLA3 I148M transgene as well as a construction method and application thereof, the construction method comprises the following steps: step i: designing CDS of a human gene and a key 3 'UTR element for patent medicine of a small nucleic acid drug in gene plasmid DNA of the constructed model; step ii, using Luc2 or iRFP to report gene expression in the gene plasmid DNA for constructing the model; and (iii) a disease model of the fatty liver disease induced by combining plasmid DNA transient transfer with high-fat diet. The mouse model constructed by the invention has the advantages that a specific exogenous gene expression signal of the liver is detected in real time through small animal living imaging, a human PNPLA3 protein is detected and overexpressed through serum ELISA, PNPLA3 I148M mRNA is detected and overexpressed through liver RT-qPCR, the phenotype of the non-alcoholic fatty liver disease of the liver is determined through 15-week-old pathology, and the whole process of modeling for 8 weeks does not need to be operated in a biosafety secondary laboratory.

The invention provides a metabolism-related fatty liver disease prediction method based on a self-attention mechanism, and the method comprises the steps: obtaining blood test and four diagnosis instrument data of a patient, and constructing a fatty liver disease data set; according to the same index data of the same patient in different periods, adding time sequence information codes to form an optimized fatty liver disease data set with sequence features; constructing and training a fatty liver detection model, wherein the fatty liver detection model comprises a convolutional neural network, a layered attention module and a feedforward neural network layer; and inputting patient data into the trained fatty liver detection model to obtain the metabolism-related fatty liver disease prediction grade of the patient. According to the invention, the method achieves the refined reasoning of the time sequence indexes of the patient through multi-scale convolution and hierarchical attention, and improves the prediction precision of the model.

The invention relates to a novel spirobenzylisoquinoline alkaloid hypecoum erectum ketone base C extracted from hypecoum erectum as well as a preparation method and application of the novel spirobenzylisoquinoline alkaloid hypecoum erectum ketone base C, which can be used for effectively extracting and preparing the novel spirobenzylisoquinoline alkaloid hypecoum erectum ketone base C from the hypecoum erectum and realizing the application in preparing a medicine for preventing and treating a non-alcoholic fatty liver disease. Carrying out heating reflux extraction on the dried hypecoum erectum by using ethanol, carrying out acid extraction and alkali precipitation, and sequentially extracting by using chloroform and n-butyl alcohol to obtain an extract of a corresponding part; and mixing the target extract with silica gel, eluting, concentrating under reduced pressure, detecting, combining the same fractions, eluting on a column, mixing the silica gel with the sample, eluting, collecting the fractions with retention time, concentrating and drying to obtain the anise keto alkali C. The invention also discloses a preparation method of the anise keto alkali C. The invention also discloses a preparation method of the anise keto alkali C. The compound can significantly improve free fatty acid-induced HepG2 cell lipid metabolism disorder and lipid accumulation, meanwhile alleviate FFA-induced HepG2 cell damage, can be prepared into various drug dosage forms, is convenient and effective in clinical use, has wide development and application prospects, and has significant economic and social benefits.

The present invention relates to inhibitors, and compositions containing inhibitors, and uses of the same in the treatment or prevention of a metabolic disease or disorder, such as a metabolic disease or disorder associated with non-alcoholic fatty liver disease (NAFLD), and / or obesity and / or a disease or disorder associated with adipogenesis.

The invention relates to the technical field of microorganisms, in particular to application of lactobacillus paracasei ZJUIDS05 (CGMCC (China General Microbiological Culture Collection Center) NO.20515) in preparation of a medicine for improving alcohol metabolism and alcoholic liver diseases. When the ZJUIDS05 is used for improving alcohol metabolism, the ZJUIDS05 can be used for reducing the ethanol content, ALT and AST in plasma; the metabolic capability and the oxidation resistance of the ethanol are enhanced; when the ZJUIDS05 intervention is used for improving alcoholic liver diseases, liver injury (ALT and AST levels are remarkably reduced) caused by alcohol can be remarkably improved, the content of ethanol in plasma is reduced, and the metabolic capacity and the antioxidant capacity of ethanol are enhanced.

The invention discloses a cadinane type sesquiterpene as well as a preparation method and application thereof. The cadinane type sesquiterpene is separated from cinnamon bark, and has at least one of structural formulas shown as a formula (I), a formula (II), a formula (III) and a formula (IV). Liver protection activity evaluation is carried out by applying an alcohol-induced hepatocyte injury model, and it is found that the cadinane type sesquiterpene can effectively relieve alcohol-induced AML-12 hepatocyte injury; the dumarane sesquiterpenes can inhibit the alcoholic liver disease and relieve fat accumulation, so that the dumarane sesquiterpenes have the anti-alcoholic liver disease activity, can be applied to preparation of the anti-alcoholic liver disease drugs, and have good research and development prospects; belongs to the field of natural medicinal chemistry.

The invention provides a traditional Chinese medicine compound for preventing and treating metabolism-related fatty liver diseases, a capsule and application, and relates to the field of medicines. The traditional Chinese medicine compound is prepared from the following raw materials in parts by weight: 1-5 parts of a turmeric extract, 10-20 parts of a radix puerariae extract, 15-30 parts of a salvia miltiorrhiza extract, 1-10 parts of a schisandra chinensis extract and 2-15 parts of a lucid ganoderma extract. The preparation method of the capsule comprises the following steps: uniformly mixing the turmeric extract, the kudzuvine root extract, the salvia miltiorrhiza extract, the schisandra chinensis extract, the lucid ganoderma extract and the maltodextrin, and filling the mixture into a hydroxypropyl methylcellulose hollow capsule to obtain the capsule. Salvia miltiorrhiza is used as a monarch drug, turmeric and radix puerariae are used as ministerial drugs, and schisandra chinensis and lucid ganoderma are used as adjuvant drugs, so that the traditional Chinese medicine composition has the functions of protecting liver, promoting blood circulation and qi circulation, helping produce saliva and slake thirst, tonifying qi and soothing nerves and the like, can effectively prevent and treat metabolism-related fatty liver diseases, and can treat non-alcoholic fatty liver diseases; particularly, the traditional Chinese medicine composition has an obvious treatment effect on non-alcoholic simple fatty liver and non-alcoholic fatty liver hepatitis.