239 results about "Hepatic Diseases" patented technology

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The present invention relates to pro-nano-emulsion compositions comprising at least one type of Omega 3 fatty acid capable of converting to nano-emulsion composition having average droplet size of below Ip, typically below 0.5p, and use thereof, particularly as dietary supplement, for preferential delivery of the Omega 3 fatty acid to heart and / or liver tissue of a subject consuming the composition, thereby maintaining normal cardiovascular / hepatic function and / or improving cardiovascular / hepatic disease or disorders.

The invention discloses a polypeptide or a pharmaceutically acceptable salt thereof. The polypeptide has an amino acid sequence as shown in SEQ ID NO: 1 or an amino acid sequence in a conservative modification form thereof. The polypeptide or the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP1R and is used for effectively activating the GLP1R. The GLP1R activating polypeptide is obtained through precise calculation and deep learning model optimization, has a short sequence, has unique amino acid arrangement compared with a traditional GLP-1 analogue, can effectively activate a GLP1R receptor, can also be used for treating or preventing metabolic disorder related diseases, and has a good application prospect. For example, obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes, non-alcoholic fatty liver diseases and the like.

An application method of a modified peptide derived from Urechis unicinctus is to prepare a drug for treating alcoholic liver disease. The modified peptide derived from Urechis unicinctus is one or more selected from F2-1: IHVKF (SEQ ID NO: 1), F2-2: VHFKI (SEQ ID NO: 2), F4-1: GAWKP (SEQ ID NO: 3), F4-2: AGWKP (SEQ ID NO: 4), F5-1: GTLKP (SEQ ID NO: 5), F5-2: GTPKL (SEQ ID NO: 6), F7-1: IIVRM (SEQ ID NO: 7), and F7-2: IRMVI (SEQ ID NO: 8). The modified peptide derived from Urechis unicinctus can enhance the degradation of alcohol and boost the survival rate of cells with alcoholic liver disease, and also alleviate lipid metabolism and inflammation in mice, protecting liver from alcoholic liver disease. When applied in drug development for treating alcoholic liver disease, the application method offers low-risk, low-cost, and is simple to operate therapeutic options.

Disclosed herein are compositions comprising siRNAs capable of downregulating SET and MYND (Myeloid-Nervy-DEAF1) domain-containing protein 2 (SMYD2) gene expression or a variant thereof. Also disclosed herein are methods of using SMYD2 inhibitors in the treatment of a liver disease or injury, such as fatty liver disease (FLD), non-alcoholic fatty liver disease (NAFLD) or non-alcoholic steatohepatitis (NASH).

The invention discloses a multi-classification auxiliary prediction method and system for metabolism-related fatty liver diseases, electronic equipment and a storage medium, belongs to the field of medical data processing, and is used for solving the problem that a traditional MAFLD binary prediction model cannot fully reflect continuous pedigree of disease severity. The method comprises the following steps: acquiring clinical data related to classification prediction of metabolism-related fatty liver diseases; performing label coding, missing value filling and feature screening on the clinical data; and inputting the screened features into a TabNet classification model optimized by a particle swarm algorithm, and outputting a risk classification result of the metabolism-related fatty liver disease. According to the method, the severity of the fatty liver can be more accurately evaluated, the liver health condition of a patient is comprehensively reflected, and more accurate treatment guidance is provided for clinical diagnosis.

The invention relates to the technical field of liver disease prediction, in particular to a metabolism-related fatty liver disease intelligent prediction method and system and a storage medium. The method comprises the following steps: collecting multi-source data, respectively obtaining basic demographic information, laboratory indexes and prediction indexes, and extracting quantitative and qualitative tongue picture parameters; performing variable screening on the tongue picture parameters and the clinical indexes, and determining key prediction variables; obtaining a key variable value according to the key prediction variable, obtaining a prediction result of the occurrence risk of the metabolism-related fatty liver disease, and outputting the prediction result; the system comprises a multi-source data acquisition module, a variable screening module and a prediction result acquisition module. By means of the mode, the intelligent tongue picture parameters and the clinical indexes are fused, and the effect of early prediction of the metabolism-related fatty liver diseases is achieved.

The invention discloses application of a lucid ganoderma extract combined with clostridium butyricum in preparation of fat-reducing food or medicine. The invention finds that the ganoderma lucidum extract is combined with clostridium butyricum for use, so that the weight gain of a mouse induced by high-fat diet can be obviously slowed down, the epididymal fat weight of the high-fat mouse is reduced, and the lipid accumulation in the liver and serum of the mouse is reduced; according to the present invention, with the application of the polypeptide, the fat cell size is reduced, the expression of the key gene mRNA related to lipid metabolism and synthesis in the mouse liver is reduced, the intestinal flora of the mouse is regulated, the obesity can be well improved, and the important application prospect in the preparation of the drugs or food for treating diabetes, reducing blood fat, obesity and non-alcoholic fatty liver disease is provided.

The invention belongs to the technical field of biological medicines, and particularly relates to a traditional Chinese medicine composition for treating metabolism-related fatty liver diseases and a preparation method thereof. The technical problem to be solved by the invention is to provide a new choice for treating metabolism-related fatty liver diseases. According to the technical scheme, the traditional Chinese medicine composition for treating the metabolism-related fatty liver disease is prepared from the following components: radix paeoniae rubra, cyrtomium fortunei, curcuma zedoary, sculellaria barbata, herba epimedii, fingered citron, semen cassiae and herba artemisiae scopariae. The invention is mainly used for providing a new choice for treating the metabolism-related fatty liver disease, and has a wide application prospect.

The invention provides a new target for treating metabolism-related fatty liver diseases, a regulation molecule and application thereof. The invention discloses a novel target gene closely related to relieving or treating the metabolism-related fatty liver disease and a signal channel related to upstream and downstream regulation and control of the target gene for the first time. The invention discloses a new mechanism participated by the signal channel and used for regulating and controlling the metabolism-related fatty liver disease. Preferred remission / therapeutic agents are also disclosed.

The invention belongs to the technical field of traditional Chinese medicine research, and particularly relates to ganoderma lucidum polysaccharide and an extraction method and application thereof. The structural formula of the ganoderan is shown as a formula I in the specification. The ganoderan extracted by the invention can repair intestinal barriers by promoting the growth of beneficial intestinal bacteria, alleviate liver inflammation by targeting LPS / TLR4 / NF-kappa B / MAPK signal pathways, and reduce fat accumulation, thereby effectively alleviating the non-alcoholic fatty liver disease; and # imgabs0 #.

The invention belongs to the technical field of animal model construction, and particularly relates to a non-alcoholic fatty liver disease mouse model based on humanized PNPLA3 I148M transgene as well as a construction method and application thereof, the construction method comprises the following steps: step i: designing CDS of a human gene and a key 3 'UTR element for patent medicine of a small nucleic acid drug in gene plasmid DNA of the constructed model; step ii, using Luc2 or iRFP to report gene expression in the gene plasmid DNA for constructing the model; and (iii) a disease model of the fatty liver disease induced by combining plasmid DNA transient transfer with high-fat diet. The mouse model constructed by the invention has the advantages that a specific exogenous gene expression signal of the liver is detected in real time through small animal living imaging, a human PNPLA3 protein is detected and overexpressed through serum ELISA, PNPLA3 I148M mRNA is detected and overexpressed through liver RT-qPCR, the phenotype of the non-alcoholic fatty liver disease of the liver is determined through 15-week-old pathology, and the whole process of modeling for 8 weeks does not need to be operated in a biosafety secondary laboratory.

The invention provides a metabolism-related fatty liver disease prediction method based on a self-attention mechanism, and the method comprises the steps: obtaining blood test and four diagnosis instrument data of a patient, and constructing a fatty liver disease data set; according to the same index data of the same patient in different periods, adding time sequence information codes to form an optimized fatty liver disease data set with sequence features; constructing and training a fatty liver detection model, wherein the fatty liver detection model comprises a convolutional neural network, a layered attention module and a feedforward neural network layer; and inputting patient data into the trained fatty liver detection model to obtain the metabolism-related fatty liver disease prediction grade of the patient. According to the invention, the method achieves the refined reasoning of the time sequence indexes of the patient through multi-scale convolution and hierarchical attention, and improves the prediction precision of the model.

The present invention relates to inhibitors, and compositions containing inhibitors, and uses of the same in the treatment or prevention of a metabolic disease or disorder, such as a metabolic disease or disorder associated with non-alcoholic fatty liver disease (NAFLD), and / or obesity and / or a disease or disorder associated with adipogenesis.

The invention discloses a cadinane type sesquiterpene as well as a preparation method and application thereof. The cadinane type sesquiterpene is separated from cinnamon bark, and has at least one of structural formulas shown as a formula (I), a formula (II), a formula (III) and a formula (IV). Liver protection activity evaluation is carried out by applying an alcohol-induced hepatocyte injury model, and it is found that the cadinane type sesquiterpene can effectively relieve alcohol-induced AML-12 hepatocyte injury; the dumarane sesquiterpenes can inhibit the alcoholic liver disease and relieve fat accumulation, so that the dumarane sesquiterpenes have the anti-alcoholic liver disease activity, can be applied to preparation of the anti-alcoholic liver disease drugs, and have good research and development prospects; belongs to the field of natural medicinal chemistry.

The invention provides a traditional Chinese medicine compound for preventing and treating metabolism-related fatty liver diseases, a capsule and application, and relates to the field of medicines. The traditional Chinese medicine compound is prepared from the following raw materials in parts by weight: 1-5 parts of a turmeric extract, 10-20 parts of a radix puerariae extract, 15-30 parts of a salvia miltiorrhiza extract, 1-10 parts of a schisandra chinensis extract and 2-15 parts of a lucid ganoderma extract. The preparation method of the capsule comprises the following steps: uniformly mixing the turmeric extract, the kudzuvine root extract, the salvia miltiorrhiza extract, the schisandra chinensis extract, the lucid ganoderma extract and the maltodextrin, and filling the mixture into a hydroxypropyl methylcellulose hollow capsule to obtain the capsule. Salvia miltiorrhiza is used as a monarch drug, turmeric and radix puerariae are used as ministerial drugs, and schisandra chinensis and lucid ganoderma are used as adjuvant drugs, so that the traditional Chinese medicine composition has the functions of protecting liver, promoting blood circulation and qi circulation, helping produce saliva and slake thirst, tonifying qi and soothing nerves and the like, can effectively prevent and treat metabolism-related fatty liver diseases, and can treat non-alcoholic fatty liver diseases; particularly, the traditional Chinese medicine composition has an obvious treatment effect on non-alcoholic simple fatty liver and non-alcoholic fatty liver hepatitis.

The invention discloses a pharmaceutical application of a 3-phenylglutaric acid derivative and a pharmaceutical composition. The 3-phenylglutaric acid derivative can be used for preparing an FASN inhibition drug. The 3-phenylglutaric acid derivative micromolecule 84-B10 can inhibit FASN in a targeted manner, is used for inhibiting the activity of the FASN, promoting the degradation of the FASN and relieving weight gain, liver fat accumulation, insulin sensitivity decline and glucose tolerance impairment caused by high calorie intake, and can be used for preparing medicines for preventing and treating metabolism-related fatty liver diseases.

The invention provides a mulberry phellinus linteus strain SH08, mulberry phellinus linteus polysaccharide as well as a preparation method and application of the mulberry phellinus linteus polysaccharide, and belongs to the technical field of biological medicines and functional foods. The mulberry phellinus igniarius strain SH08 provided by the invention is preserved in the China Center for Type Culture Collection on October 11, 2025, the preservation address is No. 299, eight road, Wuchang District, Wuhan City, Hubei Province, the strain preservation number is CCTCC NO: M20252203, and the mulberry phellinus igniarius strain SH08 is named as SanghuangAKSQSH01. The invention also provides a method for preparing high-purity mulberry phellinus linteus polysaccharide (SHP-PS) from sporocarp of the strain, and structural characterization of the polysaccharide. Experiments prove that the SHP-PS can effectively improve non-alcoholic fatty liver disease (NAFLD) induced by high fat diet, and the mechanism of the SHP-PS is closely related to blood fat regulation, liver injury and inflammation reduction, intestinal barrier repair, intestinal flora structure regulation and short-chain fatty acid generation promotion. The invention provides high-quality raw materials and a clear technical scheme for developing novel medicines or functional foods for preventing and treating NAFLD, and has important application value.

The application discloses a high-activity UGT1A1 enzyme based on tree shrew and a feed composition for enhancing alcohol metabolism. The catalytic efficiency of the recombinant tree shrew UGT1A1 enzyme on ethanol is significantly higher than that of human isozyme. The core of the application is to provide a complex feed system containing the enzyme, which solves the key bottleneck of poor stability and low delivery efficiency of exogenous enzymes in application through the synergistic effect of enzyme stabilizers, cell penetration enhancers, enteric coatings and coenzyme supply agents. Animal experiments show that the composition can safely and effectively accelerate in vivo alcohol elimination and reduce blood ethanol concentration, and can be used for developing alcoholism products, acute alcoholism treatment drugs and alcoholic liver disease prevention preparations.

The invention discloses a composition for preventing and / or treating alcoholic liver diseases, a product and application thereof. The present invention relates to a composition comprising: breast milk oligosaccharides and vitamins; the breast milk oligosaccharide comprises fucosyllactose and sialic acid lactose; the composition can provide nutritional support for patients with alcoholic liver diseases, repair intestinal mucosal barrier, reduce endotoxin entering blood, improve abundance of beneficial bacteria in intestinal tracts and reduce inflammatory response, so as to achieve the purpose of preventing and / or treating alcoholic liver diseases induced by alcohol.

Administration of pentadecanoylcarnitine or pentadecanoic acid is provided for prevention, management or treatment of aggression, allergies, allergic rhinitis, Alzheimer's disease, anxiety and anxiety disorders, amyotrophic lateral sclerosis, arthritis, asthma, atherosclerosis, attention-deficit hyperactivity disorder, bipoloar disorder, brain damage, cancer, cardiovascular disease, cholestatic pruritis, depression, chronic obstructive pulmonary disease (COPD), cocaine abuse, cough, dermatitis, depression, drug-seeking behavior, gastrointestinal disorders, facial erythema associated with rosacea, glaucoma, hepatic diseases, hyperactive bladder, hypersensitivity disorders, hypertension, impulsivity, inflammation, mental disorders and conditions, metabolic disorders, migraines, nasal and sinus congestion, nausea, neuropathic pain with and symptoms of multiple sclerosis, neurological and neuropsychiatric disorders, obesity, obsessive-compulsive disorders, opioid-induced respiratory depression, osteoarthritis, pain, Parkinson disease, pathological gambling, peptic ulcers, schizophrenia, sleep disorders, spinal cord injury, tardive dyskinesia, tics and behavioral problems with Tourette's syndrome; as well as for supporting appetite, cardiovascular health, hematologic health, memory, metabolic health, mood, prolonged REM sleep, renal health, sexuality, sociability and metabolic, hematological, renal, and weight loss.

The invention relates to the technical field of biological medicines, and discloses application of INHBC as a target spot in prevention and / or treatment of metabolic diseases. Specifically, the invention relates to application of substances for promoting INHBC gene expression or improving protein activity in preparation of products for preventing and / or treating metabolic diseases, and the metabolic diseases comprise diseases caused by energy metabolism disorder, such as obesity, diabetes, fatty liver disease, hyperlipidemia and the like. According to the application disclosed by the invention, liver specific overexpression or INHBC knock-in can improve mouse liver fatty degeneration and abnormal glucose metabolism induced by high fat diet, and in addition, the heat production activity of mouse adipose tissues can be enhanced, so that obesity induced by high fat diet is inhibited; the compound has an important application value in preventing and / or treating metabolic diseases such as obesity, type 2 diabetes and fatty liver diseases.

To provide a diagnosis marker for a non-alcoholic fat liver disease.SOLUTION: The present invention relates to a composition and a kit for accurately diagnosing hepatitis (Non-alcoholic steatohepatitis;NASH) by including a formulation for measuring the level of ApoA-1 (Exosomal ApoA-1) protein derived from exosome, and relates to a composition and a kit for accurately predicting the prognosis after a medicine for treating non-alcoholic fat hepatitis is provided.SELECTED DRAWING: Figure 10

The present invention relates to the medical use of specific long-acting glycemic analogs having dual GLP-1 / glycemic receptor agonist activity for the prevention and / or treatment of metabolic liver diseases, in particular non-alcoholic fatty liver disease (NAFLD), non-alcoholic fatty liver (NAFL), non-alcoholic steatohepatitis (NASH), NAFLD-related hepatic fibrosis and / or cirrhosis.

The invention discloses an extraction process method of a functional gastrodia elata wine partner and application of the functional gastrodia elata wine partner in alcoholic liver injury, and belongs to the technical field of biology. In order to improve the diversity of edible gastrodia elata products and solve the problems of long consumed time, low solubility, low leaching rate of active substances and the like of traditional gastrodia elata wine, the invention provides a new concept of gastrodia elata wine partners. Artificial intelligence and a response surface are combined, and optimal extraction process parameters are optimized and obtained as follows: the volume fraction of ethanol is 50%, the material-liquid ratio is 1: 20 g / mL, the ultrasonic time is 1.55 h, the ultrasonic temperature is 58 DEG C, and the ultrasonic power is 490 W; network pharmacology and molecular docking reveal that the gastrodia elata wine partner has a potential protection effect on alcoholic liver diseases; cell tests show that the gastrodia elata wine partner has a remarkable protection effect on HegG2 cells, and animal experiments further reveal that the gastrodia elata wine partner can effectively reduce the ethanol content of rat eye socket blood and has potential advantages in the aspects of reducing free radical damage and improving the oxidative stress state. The convenient edible product and the matching mode are expected to become beneficial supplement of the modern drinking culture, and the liver health is protected while people enjoy delicious wine.

The research finds that the SUMOylation level of the liver in a clinical specimen and an animal model of the metabolic dysfunction fatty liver disease is obviously reduced. UBC9 is used as the only key E2 ligase for SUMOylation to regulate and control the SUMOylation level. The invention discloses application of a UBC9 gene overexpression preparation in drugs for treating or preventing metabolic dysfunction fatty liver diseases. Through overexpression of liver specificity UBC9 mediated by an AAV adeno-associated virus vector or overexpression of UBC9 in HepG2 cells by a lentiviral vector, lipid deposition of a C57 mouse liver induced by high fat diet and a cell model treated by palmitate can be remarkably improved, and reduction of the SUMOylation level of the mouse liver and the human HepG2 cells under the high fat background can be reversed. Therefore, the UBC9 gene overexpression preparation can be used for developing drugs for treating metabolic dysfunction fatty liver diseases.

The present invention discloses the application of Zanthoxylum bungeanum exosomes in the preparation of a drug for preventing and / or treating hepatic diseases, and specifically relates to the field of biomedical technologies. The application of Zanthoxylum bungeanum exosomes in the preparation of a drug for preventing and / or treating hepatic diseases is based on the principle of inhibiting the proliferation, migration and fibrosis indicators of hepatic stellate cells. For the alcohol-induced chemical injury liver fibrosis model in mice, intervention with Zanthoxylum bungeanum exosomes can significantly improve the pathological changes of liver tissue, inhibit collagen deposition, reduce the number of lipid droplets in liver tissue, and decrease the activities of serum AST and ALT, with significantly better effects than the non-drug-administered model group. The present invention provides a drug containing Zanthoxylum bungeanum exosomes or related biological materials. Compared with traditional therapeutic drugs, this drug has the advantages of being easy to separate, easy to detect, rich in sources, high in safety, good in stability, and can also be used as a drug delivery system to load targeted drugs, etc., thereby improving the treatment efficiency of liver fibrosis diseases.

This invention relates to a composition for improving alcoholic liver damage, belonging to the field of health product technology. This application provides the use of rhodioloside and lactose-N-trisaccharide in the prevention and / or inhibition of alcoholic liver disease. This application also provides a composition of human lactose oligosaccharides and rhodioloside. The compositions described in this application can prevent the occurrence of alcoholic liver disease or inhibit its further deterioration. This application provides a green, safe, and healthy composition, offering an ideal composition for protecting human health.

The embodiment of the invention provides an oxadiazole-steroid compound, a pharmaceutical composition and application. The oxadiazole-steroid compound is a compound with a structure as shown in a formula I or pharmaceutically acceptable salt of the compound or a mixture of the compound and the pharmaceutically acceptable salt. The oxadiazole-steroid compound provided by the embodiment of the invention can effectively activate a metabolic regulation target FXR, and has excellent potential for preventing or treating MAFLD and related complications thereof. Meanwhile, the compound has no excitation effect on an MRGPRX4 receptor possibly causing pruritus while maintaining the FXR excitation activity, and a safer choice is provided for treatment of related diseases. Therefore, the oxadiazole-steroid compound has a more remarkable application prospect in preparation of the medicine for treating the metabolism-related fatty liver disease.