1002 results about "Metabolic disorder" patented technology

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

This disclosure features chemical entities (e.g., a compound or a pharmaceutically acceptable salt thereof) that degrade and / or otherwise modulate (e.g., inhibit) NIMA Related Kinase 7 (NEK7). Said chemical entities are useful, e.g., for treating a subject (e.g., a human subject) having one or more disorders or diseases associated with NLRP3 inflammasome activation. Said disorders or diseases include but are not limited to, autoinflammatory and autoimmune disorders (e.g., gout, inflammatory bowel disease, rheumatoid arthritis, multiple sclerosis), neurodegenerative diseases (e.g., Alzheimer's disease, Parkinson's disease), cardiovascular and metabolic disorders (eg. pericarditis, atherosclerosis, Type 2 diabetes, obesity, and metabolic syndrome), fibrotic disorders (e.g. interstitial lung disease, chronic kidney disease), hematology (eg. anemia of inflammation) and eye disorders (eg. macular degeneration). In embodiments, and while not wishing to be bound by theory, it is believed that the chemical entities described herein directly target (e.g., directly bind to) NEK7, thereby altering (e.g., attenuating) the inflammatory response modulated by the NLRP3 inflammasome. This disclosure also features compositions containing the same as well as methods of using and making the same.

The invention discloses an application of an HERP gene knockout mouse model in obesity and metabolic disorder diseases. The invention finds that compared with a wild type high-fat group, HERP gene knockout can cause phenotypes such as early obesity, more serious obesity degree, increase of fat weight ratio, aggravation of adipose tissue inflammation, dyslipidemia and glucose metabolism disorder of mice during high-fat feeding. And the HERP gene is knocked out, so that the adipocyte differentiation is increased. The HERP gene knockout mouse is more sensitive to nutrition, obesity can occur more quickly during high-fat feeding, symptoms such as fat amplification, fat inflammation and glucose and lipid metabolism disorder are more serious, and the HERP gene knockout mouse can be used for molecular mechanism research and drug screening of obesity, fat tissue and glucose and lipid metabolism disorder. It is further found that cilostazol can significantly relieve mouse obesity and lipid metabolism disorder caused by HERP gene defects, but has no obvious weight losing effect on normal genotype mice, and a new strategy is provided for precise treatment.

The invention discloses a feed functional compound for improving salt-alkali stress resistance of macrobrachium rosenbergii and application of the feed functional compound, and belongs to the technical field of aquaculture. The feed functional compound for improving saline-alkaline stress resistance of macrobrachium rosenbergii provided by the invention comprises vitamin D3, betaine and sodium oleate. According to the invention, the absorption promotion effect of vitamin D3 on calcium and phosphorus ions is utilized, so that the ion metabolism disorder of macrobrachium rosenbergii under saline-alkali stress is improved; by utilizing the osmotic pressure regulation capability of betaine, osmotic pressure unbalance under saline-alkali stress is improved, and the energy consumption of osmotic regulation is reduced; the sodium oleate is used for improving energy supply, the membrane structure is adjusted to improve osmotic pressure adjusting capacity, and the three components act together to achieve the purpose of improving salt-alkali stress tolerance of macrobrachium rosenbergii.

The present invention relates to immunoglobulins, such as immunoconjugates, comprising an ActRII receptor antibody and an agonistic GLP-1 molecule, such as agonistic GLP-1 peptide. Such constructs are useful in the treatment of numerous diseases and disorders, including metabolic disorders, such as obesity, diabetes and others.

The invention relates to pediococcus acidilactici XZ106, which is classified and named as pediococcus acidilactici, and is preserved in the China General Microbiological Culture Collection Center (CGMCC), the preservation number is CGMCC No.30094, the preservation date is March 22, 2024, and the preservation address is No.3, Yard 1, Beichen West Road, Chaoyang District, Beijing. The pediococcus acidilactici XZ106 can (1) relieve insulin resistance, regulate insulin and glucagon secretion and improve liver gluconeogenesis, so that diabetes hyperglycemia is improved; (2) weight gain, fat accumulation and liver lipid accumulation of obese mice are inhibited, glycolipid metabolism disorder of the mice is improved, and the composition has excellent effects of reducing fat and relieving obesity; (3) the level of IL-10 can be remarkably improved, and the anti-inflammatory ability of mice is improved; (4) vascular injury is reduced, so that diabetic complications and various cardiovascular diseases of atherosclerosis are prevented.

A dsRNA and double-stranded RNAi agent for inhibiting the expression of INHBE and a use thereof. The dsRNA and the double-stranded RNAi agent can be used for inhibiting the expression of INHBE to prevent and treat a metabolic disorder (such as a metabolic syndrome).

Provided herein are elastin-like polypeptides, endosomal escape peptides, and compounds comprising an elastin-like polypeptide chemically or recombinantly conjugated to one or more endosomal escape peptides. Also provided herein are compositions comprising a compound provided herein and an agent, methods of delivering an agent, and methods of treating or preventing a disease (e.g., a cardiovascular disease, a lung or respiratory disease, a musculoskeletal disease, a hematological disease, an immune disorder, an infectious disease, a genetic disease, cancer, a neurological disease, a psychiatric disorder, a metabolic disorder, or an inflammatory disease).

The invention relates to the technical field of microorganisms, in particular to a plant lactobacillus BD7807 and application thereof in treating lipid metabolism disorder, and particularly discloses a plant lactobacillus BD7807 with the preservation number of CGMCC (China General Microbiological Culture Collection Center) NO.33630. The invention further discloses a preparation method of the plant lactobacillus BD7807. The plant lactobacillus BD7807 has obvious lipid-lowering, anti-oxidation and adhesion capabilities, is bacteriostatic, has no multiple drug resistance, can play a role in lowering lipid without damaging other organs, and can be widely used for preventing and treating related symptoms caused by lipid metabolism disorder.

The invention discloses an edible and medicinal composition for dispelling effects of alcohol and protecting liver as well as a preparation method and application thereof, and belongs to the technical field of functional foods. The composition consists of the following raw materials in parts by weight: 1-8 parts of ampelopsis grossedentata extract freeze-dried powder, 1-8 parts of astragalus membranaceus extract freeze-dried powder, 1-5 parts of kudzu vine root extract freeze-dried powder, 1-8 parts of hawthorn extract freeze-dried powder and 1-5 parts of cassia seed extract freeze-dried powder. The composition is designed according to a multi-component synergistic interaction principle, and the functions of protecting the liver and dispelling the effects of alcohol are enhanced through targeted interaction of active ingredients such as ampelopsis grossedentata flavone, puerarin and astragaloside; the compound preparation has the compound effects of protecting the liver, dispelling the effects of alcohol, resolving dampness, resisting oxidative stress, regulating lipid metabolism and the like, can remarkably relieve the problems of acute and chronic liver injury and metabolic disorder caused by alcohol intake, and meets the food-grade safety standard and the medicinal activity requirement; the important application prospect is realized in the aspect of preparing a preparation for relieving alcoholic liver injury and improving the liver detoxification function.

The invention discloses a polypeptide or a pharmaceutically acceptable salt thereof. The polypeptide has an amino acid sequence as shown in SEQ ID NO: 1 or an amino acid sequence in a conservative modification form thereof. The polypeptide or the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP1R and is used for effectively activating the GLP1R. The GLP1R activating polypeptide is obtained through precise calculation and deep learning model optimization, has a short sequence, has unique amino acid arrangement compared with a traditional GLP-1 analogue, can effectively activate a GLP1R receptor, can also be used for treating or preventing metabolic disorder related diseases, and has a good application prospect. For example, obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes, non-alcoholic fatty liver diseases and the like.

Disclosed herein is a genetically engineered mesenchymal stem cells (MSC) comprising genetic alterations that increase gene expressions for adipogenic differentiation, mitochondrial biogenesis and a brown adipocyte marker. Also disclosed herein is a pharmaceutical composition and use of the pharmaceutical composition for preventing, ameliorating and / or treating a metabolic disorder.

There are provided polypeptides that include an Activin receptor type IIB (ActRIIB) ectodomain (ECD) variant. In some embodiments, a polypeptide of the disclosure includes an ActRIIB-ECD variant fused to an Fc domain moiety. The disclosure also provides pharmaceutical compositions and methods of using the polypeptides to treat diseases and conditions associated with TGFβ superfamily ligand signaling, such as metabolic disorders, diabetes, obesity, cardiometabolic disease, pulmonary hypertension, fibrosis, muscle weakness and atrophy, bone damage, and / or low red blood cell levels (such as anemia).

There are provided polypeptides that include an Activin receptor type IIB (ActRIIB) ectodomain (ECD) variant. In some embodiments, a polypeptide of the disclosure includes an ActRIIB-ECD variant fused to an Fc domain moiety. The disclosure also provides pharmaceutical compositions and methods of using the polypeptides to treat diseases and conditions associated with TGFβ superfamily ligand signaling, such as pulmonary hypertension, fibrosis, muscle weakness and atrophy, metabolic disorders and / or cardiometabolic disease, bone damage, and / or low red blood cell levels (such as anemia).

The invention provides a polyphenolic composition and method for its use and manufacture in the treatment of metabolic disorders. The active agents of the composition can include flavonoids and anthocyanins. The active agents can be obtained from rose petal extract, including Rosa multiflora rose petal extract. The composition finds use in the treatment of obesity and complications associated with obesity.

The present invention discloses compounds, compositions, methods for modulating central nervous system activity, methods for treating inflammatory or metabolic disorders, and methods for treating central nervous system disorders, such as depression, anxiety, and trauma- and stressor-related disorders, comprising the indolizines having the structures disclosed herein.

The invention discloses a method for establishing an animal model for age-related retinopathy caused by lipid metabolism disorder, and the animal model is obtained by specifically knocking out Lss genes from mouse retinal pigment epithelium (RPE) cells by means of a CRISPR / Cas9 gene editing technology. The age-related retinopathy model mouse constructed by the invention shows a retinopathy phenotype with retinal lipid deposition and reduced visual function at the age of 5 months, and the retinopathy is further aggravated along with the increase of the age of the mouse and is similar to the phenotype of age-related retinopathy related to lipid metabolism disorder clinically; and an ideal and effective animal model is provided for researching age-related retinopathy.

The present invention relates to modulators that can regulate, for example, inhibit the expression and / or activity of an inhibin subunit βE (INHBE), such as double-stranded RNA (dsRNA) active agents or antisense polynucleotide formulations. The present invention also relates to a method for inhibiting the expression and / or activity of INHBE by using such modulators, and a method for preventing and treating INHBE-related diseases in subjects (such as metabolic disorders or obesity or cardiovascular diseases, such as metabolic syndrome).

A GLP-1, GIP and GCG receptor triagonist and a use thereof. The corresponding compound has an agonist effect on a human glucagon-like peptide-1 (GLP-1) receptor, a human glucose-dependent insulinotropic polypeptide (GIP) receptor and a human glucagon (GCG) receptor, and can be used for preventing and / or treating diseases or conditions related to metabolic disorders.

Provided are TYK2 inhibitors of Formula I, processes for their production, their use as pharmaceuticals and pharmaceutical compositions comprising them. These compounds are useful, for example, in treating TYK2-mediated disorders, such as, autoimmune and inflammatory disorders, metabolic disorders, proliferative disorders, endocrine disorders, neurological disorders, allergic disorders, and disorders associated with transplantation.

A double-stranded siRNA and a use thereof. Specifically disclosed are uses of a double-stranded siRNA containing non-natural nucleotides and a conjugate of the double-stranded siRNA, targeting an inhibin βE gene, and being capable of being applied to treatment of metabolic disorder-related diseases.

The present invention relates to modulators, e.g., double stranded RNA (dsRNA) agents, antisense polynucleotide agents, antibodies, guideRNAs that effect ADAR editing, or guideRNAs that effect CRISPR editing, that modulate, e.g., inhibit, the expression and / or activity of inhibin subunit beta E (INHBE). The invention also relates to methods of using such modulators to inhibit expression and / or activity of INHBE and to methods of preventing and treating an INHBE-associated disorder, e.g., metabolic disorder, e.g., metabolic syndrome, in a subject.

The disclosure provides methods for preparation of carbohydrate replacement therapies (CRT) that include nanocarriers of carbohydrates and glycolipids for pharmaceutical delivery to cell interior, endoplasmic reticulum, and Golgi for treating CDG type I and CDG type II diseases as well as other metabolic disorders.

The invention discloses application of beta-alanine in preparation of a medicine for preventing and / or treating uric acid metabolic disorder related diseases. The invention provides a theoretical source of beta-alanine for reducing the uric acid level. In the earlier stage, the applicant of the invention adopts non-target metabolome and targeted metabolome data to construct a hyperuricemia prediction model, and Rmcorr correlation analysis shows that high beta-alanine level and low uric acid level have strong correlation. On the other hand, beta-alanine acid is adopted to intervene in a hyperuricemia mouse, it is proved that beta-alanine can reduce the blood uric acid level of the hyperuricemia mouse and promote urine uric acid excretion, and beta-alanine can be used for preventing and / or treating uric acid metabolic disorder related diseases.

The invention belongs to the technical field of traditional Chinese medicines, and relates to a traditional Chinese medicine composition for improving obesity and metabolic syndrome and a preparation method thereof. The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 15 to 28 parts of radix astragali seu hedysari, 8 to 20 parts of radix codonopsis, 20 to 35 parts of rhizoma dioscoreae, 8 to 24 parts of semen lablab album, 6 to 20 parts of rhizoma atractylodis macrocephalae stir-fried with bran, 20 to 35 parts of raw semen coicis, 3 to 10 parts of rhizoma pinelliae preparata, 6 to 15 parts of pericarpium citri reticulatae, 10 to 20 parts of poria cocos, 6 to 15 parts of rhizoma alismatis, 6 to 15 parts of raw liquorice root, 10 to 20 parts of semen hoveniae, 10 to 20 parts of lotus leaf and 8 to 15 parts of raw fructus crataegi. The composition has the effects of invigorating spleen, replenishing qi, resolving dampness and removing turbidity, can effectively control the weight gain of obese patients and improve the metabolic disorder condition of metabolic syndrome, is safe, effective and stable, has small side effects, and has very good research and development values.

The invention belongs to the technical field of traditional Chinese medicines, and particularly relates to a traditional Chinese medicine composition for improving cognition, emotion, memory and depression states and a preparation method and application thereof. The traditional Chinese medicine composition is prepared from the following components in parts by mass: radix scutellariae, rhizoma coptidis, radix puerariae, rhizoma anemarrhenae, bitter gourd, rhizoma zingiberis, stiff silkworm, American ginseng and radix notoginseng. Wherein the radix scutellariae and the rhizoma coptidis are monarch drugs and mainly attack the core pathogenesis; the radix puerariae, the rhizoma anemarrhenae and the pseudo-ginseng serve as ministerial drugs, assist monarch drugs and treat secondary pathogenesis; bitter gourd, rhizoma zingiberis, stiff silkworm and American ginseng are used as adjuvant drugs to regulate drug properties and treat and treat both symptoms and root causes; and radix puerariae and pseudo-ginseng are used as conductant drugs for guiding channels or harmonizing the drugs. The traditional Chinese medicine composition disclosed by the invention can be used for preventing and treating cognitive disorder, mood disorder and depressive state caused by metabolic disorder. The traditional Chinese medicine composition is small in side effect, high in individuation and suitable for being taken for a long time, and has an obvious treatment effect.

The present invention provides an isolated Akkermansia muciniphila strain, composition comprising the same, and use thereof, which can be used for treating, preventing, or alleviating obesity, metabolic disorders induced by obesity, diabetes, inflammation, liver and kidney diseases, liver diseases, cardiovascular and cerebrovascular diseases, brain aging, tumors, etc. Additionally, it can be used for preventing and treating metabolic disorders after discontinuation of GLP-1 receptor agonist drugs, preventing weight rebound and blood glucose rebound, and maintaining glucose homeostasis.