782 results about "Metabolic disorder" patented technology

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention discloses an application of an HERP gene knockout mouse model in obesity and metabolic disorder diseases. The invention finds that compared with a wild type high-fat group, HERP gene knockout can cause phenotypes such as early obesity, more serious obesity degree, increase of fat weight ratio, aggravation of adipose tissue inflammation, dyslipidemia and glucose metabolism disorder of mice during high-fat feeding. And the HERP gene is knocked out, so that the adipocyte differentiation is increased. The HERP gene knockout mouse is more sensitive to nutrition, obesity can occur more quickly during high-fat feeding, symptoms such as fat amplification, fat inflammation and glucose and lipid metabolism disorder are more serious, and the HERP gene knockout mouse can be used for molecular mechanism research and drug screening of obesity, fat tissue and glucose and lipid metabolism disorder. It is further found that cilostazol can significantly relieve mouse obesity and lipid metabolism disorder caused by HERP gene defects, but has no obvious weight losing effect on normal genotype mice, and a new strategy is provided for precise treatment.

The invention discloses a feed functional compound for improving salt-alkali stress resistance of macrobrachium rosenbergii and application of the feed functional compound, and belongs to the technical field of aquaculture. The feed functional compound for improving saline-alkaline stress resistance of macrobrachium rosenbergii provided by the invention comprises vitamin D3, betaine and sodium oleate. According to the invention, the absorption promotion effect of vitamin D3 on calcium and phosphorus ions is utilized, so that the ion metabolism disorder of macrobrachium rosenbergii under saline-alkali stress is improved; by utilizing the osmotic pressure regulation capability of betaine, osmotic pressure unbalance under saline-alkali stress is improved, and the energy consumption of osmotic regulation is reduced; the sodium oleate is used for improving energy supply, the membrane structure is adjusted to improve osmotic pressure adjusting capacity, and the three components act together to achieve the purpose of improving salt-alkali stress tolerance of macrobrachium rosenbergii.

The invention relates to the technical field of microorganisms, in particular to a plant lactobacillus BD7807 and application thereof in treating lipid metabolism disorder, and particularly discloses a plant lactobacillus BD7807 with the preservation number of CGMCC (China General Microbiological Culture Collection Center) NO.33630. The invention further discloses a preparation method of the plant lactobacillus BD7807. The plant lactobacillus BD7807 has obvious lipid-lowering, anti-oxidation and adhesion capabilities, is bacteriostatic, has no multiple drug resistance, can play a role in lowering lipid without damaging other organs, and can be widely used for preventing and treating related symptoms caused by lipid metabolism disorder.

The invention discloses an edible and medicinal composition for dispelling effects of alcohol and protecting liver as well as a preparation method and application thereof, and belongs to the technical field of functional foods. The composition consists of the following raw materials in parts by weight: 1-8 parts of ampelopsis grossedentata extract freeze-dried powder, 1-8 parts of astragalus membranaceus extract freeze-dried powder, 1-5 parts of kudzu vine root extract freeze-dried powder, 1-8 parts of hawthorn extract freeze-dried powder and 1-5 parts of cassia seed extract freeze-dried powder. The composition is designed according to a multi-component synergistic interaction principle, and the functions of protecting the liver and dispelling the effects of alcohol are enhanced through targeted interaction of active ingredients such as ampelopsis grossedentata flavone, puerarin and astragaloside; the compound preparation has the compound effects of protecting the liver, dispelling the effects of alcohol, resolving dampness, resisting oxidative stress, regulating lipid metabolism and the like, can remarkably relieve the problems of acute and chronic liver injury and metabolic disorder caused by alcohol intake, and meets the food-grade safety standard and the medicinal activity requirement; the important application prospect is realized in the aspect of preparing a preparation for relieving alcoholic liver injury and improving the liver detoxification function.

The invention discloses a polypeptide or a pharmaceutically acceptable salt thereof. The polypeptide has an amino acid sequence as shown in SEQ ID NO: 1 or an amino acid sequence in a conservative modification form thereof. The polypeptide or the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP1R and is used for effectively activating the GLP1R. The GLP1R activating polypeptide is obtained through precise calculation and deep learning model optimization, has a short sequence, has unique amino acid arrangement compared with a traditional GLP-1 analogue, can effectively activate a GLP1R receptor, can also be used for treating or preventing metabolic disorder related diseases, and has a good application prospect. For example, obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes, non-alcoholic fatty liver diseases and the like.

Disclosed herein is a genetically engineered mesenchymal stem cells (MSC) comprising genetic alterations that increase gene expressions for adipogenic differentiation, mitochondrial biogenesis and a brown adipocyte marker. Also disclosed herein is a pharmaceutical composition and use of the pharmaceutical composition for preventing, ameliorating and / or treating a metabolic disorder.

The invention discloses a method for establishing an animal model for age-related retinopathy caused by lipid metabolism disorder, and the animal model is obtained by specifically knocking out Lss genes from mouse retinal pigment epithelium (RPE) cells by means of a CRISPR / Cas9 gene editing technology. The age-related retinopathy model mouse constructed by the invention shows a retinopathy phenotype with retinal lipid deposition and reduced visual function at the age of 5 months, and the retinopathy is further aggravated along with the increase of the age of the mouse and is similar to the phenotype of age-related retinopathy related to lipid metabolism disorder clinically; and an ideal and effective animal model is provided for researching age-related retinopathy.

The present invention relates to modulators that can regulate, for example, inhibit the expression and / or activity of an inhibin subunit βE (INHBE), such as double-stranded RNA (dsRNA) active agents or antisense polynucleotide formulations. The present invention also relates to a method for inhibiting the expression and / or activity of INHBE by using such modulators, and a method for preventing and treating INHBE-related diseases in subjects (such as metabolic disorders or obesity or cardiovascular diseases, such as metabolic syndrome).

Provided are TYK2 inhibitors of Formula I, processes for their production, their use as pharmaceuticals and pharmaceutical compositions comprising them. These compounds are useful, for example, in treating TYK2-mediated disorders, such as, autoimmune and inflammatory disorders, metabolic disorders, proliferative disorders, endocrine disorders, neurological disorders, allergic disorders, and disorders associated with transplantation.

A double-stranded siRNA and a use thereof. Specifically disclosed are uses of a double-stranded siRNA containing non-natural nucleotides and a conjugate of the double-stranded siRNA, targeting an inhibin βE gene, and being capable of being applied to treatment of metabolic disorder-related diseases.

The disclosure provides methods for preparation of carbohydrate replacement therapies (CRT) that include nanocarriers of carbohydrates and glycolipids for pharmaceutical delivery to cell interior, endoplasmic reticulum, and Golgi for treating CDG type I and CDG type II diseases as well as other metabolic disorders.

The invention discloses application of beta-alanine in preparation of a medicine for preventing and / or treating uric acid metabolic disorder related diseases. The invention provides a theoretical source of beta-alanine for reducing the uric acid level. In the earlier stage, the applicant of the invention adopts non-target metabolome and targeted metabolome data to construct a hyperuricemia prediction model, and Rmcorr correlation analysis shows that high beta-alanine level and low uric acid level have strong correlation. On the other hand, beta-alanine acid is adopted to intervene in a hyperuricemia mouse, it is proved that beta-alanine can reduce the blood uric acid level of the hyperuricemia mouse and promote urine uric acid excretion, and beta-alanine can be used for preventing and / or treating uric acid metabolic disorder related diseases.

The invention belongs to the technical field of traditional Chinese medicines, and relates to a traditional Chinese medicine composition for improving obesity and metabolic syndrome and a preparation method thereof. The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 15 to 28 parts of radix astragali seu hedysari, 8 to 20 parts of radix codonopsis, 20 to 35 parts of rhizoma dioscoreae, 8 to 24 parts of semen lablab album, 6 to 20 parts of rhizoma atractylodis macrocephalae stir-fried with bran, 20 to 35 parts of raw semen coicis, 3 to 10 parts of rhizoma pinelliae preparata, 6 to 15 parts of pericarpium citri reticulatae, 10 to 20 parts of poria cocos, 6 to 15 parts of rhizoma alismatis, 6 to 15 parts of raw liquorice root, 10 to 20 parts of semen hoveniae, 10 to 20 parts of lotus leaf and 8 to 15 parts of raw fructus crataegi. The composition has the effects of invigorating spleen, replenishing qi, resolving dampness and removing turbidity, can effectively control the weight gain of obese patients and improve the metabolic disorder condition of metabolic syndrome, is safe, effective and stable, has small side effects, and has very good research and development values.

The invention belongs to the technical field of traditional Chinese medicines, and particularly relates to a traditional Chinese medicine composition for improving cognition, emotion, memory and depression states and a preparation method and application thereof. The traditional Chinese medicine composition is prepared from the following components in parts by mass: radix scutellariae, rhizoma coptidis, radix puerariae, rhizoma anemarrhenae, bitter gourd, rhizoma zingiberis, stiff silkworm, American ginseng and radix notoginseng. Wherein the radix scutellariae and the rhizoma coptidis are monarch drugs and mainly attack the core pathogenesis; the radix puerariae, the rhizoma anemarrhenae and the pseudo-ginseng serve as ministerial drugs, assist monarch drugs and treat secondary pathogenesis; bitter gourd, rhizoma zingiberis, stiff silkworm and American ginseng are used as adjuvant drugs to regulate drug properties and treat and treat both symptoms and root causes; and radix puerariae and pseudo-ginseng are used as conductant drugs for guiding channels or harmonizing the drugs. The traditional Chinese medicine composition disclosed by the invention can be used for preventing and treating cognitive disorder, mood disorder and depressive state caused by metabolic disorder. The traditional Chinese medicine composition is small in side effect, high in individuation and suitable for being taken for a long time, and has an obvious treatment effect.

The present invention provides an isolated Akkermansia muciniphila strain, composition comprising the same, and use thereof, which can be used for treating, preventing, or alleviating obesity, metabolic disorders induced by obesity, diabetes, inflammation, liver and kidney diseases, liver diseases, cardiovascular and cerebrovascular diseases, brain aging, tumors, etc. Additionally, it can be used for preventing and treating metabolic disorders after discontinuation of GLP-1 receptor agonist drugs, preventing weight rebound and blood glucose rebound, and maintaining glucose homeostasis.

The invention discloses an endogenous small molecule metabolite for treating obesity and related metabolic diseases thereof, and belongs to the field of biological medicine. Specifically, the invention relates to application of hippuric acid in preparation of anti-obesity drugs. The invention discloses a technical scheme for treating obesity and related metabolic disorders by hippuric acid, and overcomes the defects of single curative effect, larger side effect or unclear action mechanism and the like in the prior art through the advantages of targeted improvement of liver fatty degeneration, improvement of insulin sensitivity, higher potential safety, provision of a new treatment strategy and the like. The method has remarkable technical progress and clinical application value.

The invention belongs to the field of biotechnology and nutritional medicine, relates to a maternal obesity intervention preparation, and particularly relates to a preparation method of a plant embryo fermentation product and application of the plant embryo fermentation product in blocking of trans-generation delivery metabolic diseases. FWG is prepared through a probiotic fermentation technology, obesity, glucose and lipid metabolism disorder and oxidative stress induced by high-fat diet of a parent body can be remarkably improved, and cross-generation transmission of metabolic diseases is blocked by adjusting composition of intestinal flora of the parent body and offspring and a hypothalamic PI3K-Akt signal channel. The invention reveals that maternal FWG intervention passes through a mechanism that a PI3K-Akt pathway is dominated and multiple pathways are coordinated on the transcriptome level for the first time, the HFD-induced offspring hypothalamus metabolism programming abnormality is reversed, and a new central regulation target is provided for cross-generation metabolic disease prevention. The FWG is a wheat processing byproduct, is free of chemical additives, is suitable for long-term dietary supplement, is a natural and safe nutrition intervention scheme, and is suitable for the field of maternal and infant health.

The present disclosure provides a strain of the family Lactobacillaceae and its products, compositions and applications. In a first aspect of the present disclosure, a strain of the family Lactobacillaceae ( Lactobacillaceae ) strain, the Lactobacillaceae strain may include strain MNH08891 with a deposit number of GDMCC No. 65551, or strain MNH22076 with a deposit number of GDMCC No. 65554, or a strain having at least 98.65% identity to the 16S rRNA sequence of strain MNH08891 or strain MNH22076, or a strain having at least 98.65% identity to the 16S rRNA sequence set forth in SEQ ID NO: 1. The strains disclosed in the embodiments of the present disclosure or products based on the strains have excellent effects in treating, preventing, or alleviating metabolic diseases, as well as treating, preventing, or ameliorating metabolic disorders after discontinuation of drugs used to treat metabolic diseases.

The present invention relates to a D-galactopyranose compound of formula (1)whereinthe pyranose ring is α-D-galactopyranose, and these compounds are high affinity galectin-1 and / or galectin 3 inhibitors for use in treatment of inflammation; fibrosis; scarring; keloid formation; aberrant scar formation; surgical adhesions; septic shock; cancer; metastasising cancers; autoimmune diseases, metabolic disorders; heart disease; heart failure; pathological angiogenesis; eye diseases; atherosclerosis; metabolic diseases; diabetes type I; diabetes type II; insulin resistance; Diastolic heart failure; asthma; liver disorders.

The invention provides a liver-protecting probiotic composition and application thereof in prevention or treatment of acute liver injury, and belongs to the technical field of microorganisms and medicines. The invention provides lactobacillus crispatus LJ003, and the preservation number of the lactobacillus crispatus LJ003 is CGMCC (China General Microbiological Culture Collection Center) No.30723. The invention further provides a method for preparing fermented globe artichoke leaf powder, polyphenol and chlorogenic acid by using the lactobacillus crispatus LJ003, and the fermented globe artichoke leaf powder prepared by using the lactobacillus crispatus LJ003. The prepared fermented globe artichoke leaf powder can be used for preparing the liver protection probiotic composition, and the obtained liver protection probiotic composition has a good protection effect on liver cells, can effectively improve liver cell lipid metabolism disorder caused by excessive ethanol intake, and has a remarkable effect on preventing or treating acute liver injury.

The present invention relates to the use of selective aquaporin inhibitors, e.g., of aquaporin-4 or aquaporin-2, e.g., certain phenylbenzamide compounds, for the prophylaxis, treatment and control of aquaporin-mediated conditions, e.g., diseases of water imbalance, for example edema (particularly edema of the brain and spinal cord, e.g., following trauma or ischemic stroke, as well as the edema associated with glioma, meningitis, acute mountain sickness, epileptic seizures, infections, metabolic disorders, hypoxia, water intoxication, hepatic failure, hepatic encephalopathy, diabetic ketoacidosis, abscess, eclampsia, Creutzfeldt-Jakob disease, and lupus cerebritis, as well as edema consequent to microgravity and / or radiation exposure, as well as edema consequent to invasive central nervous system procedures, e.g., neurosurgery, endovascular clot removal, spinal tap, aneurysm repair, or deep brain stimulation, as well as retinal edema), as well as hyponatremia and excess fluid retention, and diseases such as epilepsy, retinal ischemia and other diseases of the eye associated with abnormalities in intraocular pressure and / or tissue hydration, myocardial ischemia, myocardial ischemia / reperfusion injury, myocardial infarction, myocardial hypoxia, congestive heart failure, sepsis, and neuromyelitis optica, as well as migraines, as well as to novel assays for identifying aquaporin inhibitors.

Provided herein are methods of treating metabolic disorders, including cardiometabolic disorders such as heart failure with preserved ejection fraction (HFpEF), by co-administering therapeutically effective amounts of: an isolated nucleic acid comprising a nucleotide sequence of CGUCCGAUGGUAGUGGGUUAUCAG (SEQ ID NO:12) or a sequence at least 95% identical thereto, wherein the nucleic acid is RNA, and wherein the nucleic acid is at most 30 nt long; and a second therapeutic that is an incretin or functional analogue thereof, and / or is an activator of glucagon-like peptide 1 (GLP-1) receptor signaling.

The invention discloses a lactobacillus rhamnosus HX-4F3 strain and application thereof, and belongs to the technical field of biology. The lactobacillus rhamnosus HX-4F3 disclosed by the invention is preserved in the China Center for Type Culture Collection, and the preservation number of the lactobacillus rhamnosus HX-4F3 is CCTCC (China Center for Type Culture Collection) NO: M 20251454. The invention discloses an application of a strain HX-4F3 in preparation of drugs or food for lowering lipid or / and blood sugar. The invention also discloses application of the compound in preparation of functional food or / and medicines for preventing or / and treating metabolic diseases. The invention also discloses a composition for lowering lipid or / and blood sugar, which comprises a live bacterium of the strain HX-4F3 or freeze-dried powder, a spore preparation, a metabolic supernatant or an inactivated bacterium of the strain HX-4F3, and a pharmaceutically or food acceptable carrier. According to the lactobacillus rhamnosus HX-4F3 provided by the invention, the glucose and lipid metabolism disorder can be remarkably improved through a multiple synergistic mechanism, and the glucose and lipid metabolism disorder can be remarkably improved through the lactobacillus rhamnosus HX-4F3.

The present invention relates to Akkermansia muciniphila Akk11 having the functions of regulating blood glucose and blood fat and the use thereof. Said Akkermansia muciniphila Akk11 is classified and named as Akkermansia muciniphila Akk11 with the accession number of CCTCC NO: M2024119. The strain uses mucin as the unique source of carbon element and nitrogen element, so as to control the basic regulatory systems of glucose and energy metabolism, protect the integrity of intestinal epithelial cells and mucus layers to exert a protective effect on metabolism, regulate the levels of blood glucose and blood fat, and remarkably relieve symptoms of metabolic disorders, and thus providing strategies and reference basis for the prevention and treatment of obesity.

The present disclosure relates to methods of treating, preventing or managing cardiovascular and / or metabolic disorders selected from the group consisting of hypercholesteremia, dyslipidemia, hypertriglyceridemia, non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), type 2 diabetes and obesity in a human subject in need thereof by administering a human FGF21 protein variant.

The invention discloses a compound for preventing and treating related diseases caused by aldehyde metabolism disorder and application of the compound. The compound is a compound as shown in a formula (I) or a stereoisomer, a tautomer, a solvate and pharmaceutically acceptable salt of the compound as shown in the formula (I). The compound can be combined with active aldehyde to reduce the generation of an active aldehyde-biomacromolecule adduct and play a role in removing aldehyde, and can be used for treating various system diseases caused by aldehyde metabolism disorder. # imgabs0 #

The invention relates to the field of metabolite detection, in particular to an endogenous metabolite detection device and method for metabolic disorder patients. The method comprises the following steps: segmenting a Raman spectrum curve of an endogenous metabolite of a patient to obtain a plurality of fluctuation segments and a reference baseline value of each fluctuation segment, screening out a normal fluctuation segment, and combining the reference baseline value of the normal fluctuation segment to obtain a normal baseline value of the Raman spectrum curve; adjusting each fluctuation section of the Raman spectrum curve according to the difference between the reference baseline value and the normal baseline value of each fluctuation section to obtain an adjusted spectrum curve, denoising the adjusted spectrum curve to obtain a final spectrum curve, and detecting the endogenous metabolites of the patient. According to the invention, the baseline drift phenomenon of the Raman spectrum curve of the endogenous metabolite of the patient can be eliminated, and the Raman spectrum data quality and the detection accuracy of the endogenous metabolite are improved.