PvFBA1 protein, PvFBA1 gene, recombinant vector and their application in regulating plant cadmium tolerance

Abstract

The present invention relates to the field of genetic engineering technology, and in particular to PvFBA1 protein, PvFBA1 gene, recombinant vector and its application in regulating plant cadmium tolerance. Based on previous research, the present invention screened and obtained a yeast monoclone with cadmium tolerance function. Through sequencing and comparison with the sequence of the model plant Arabidopsis thaliana, it was found that the protein expressed by the gene is fructose-1,6-bisphosphate aldolase, named PvFBA1 protein. The full-length gene sequence was obtained by cloning, and on this basis, an overexpression vector was constructed and genetic transformation of Arabidopsis thaliana was carried out. The results showed that compared with wild-type plants, the root length and fresh weight of transgenic plants under cadmium stress were significantly higher than those of the wild-type, indicating that the PvFBA1 gene and the PvFBA1 protein expressed by it play an important regulatory role in cadmium stress, can improve the cadmium tolerance of plants, can be used to cultivate plants with strong cadmium tolerance for repairing cadmium pollution, and have practical application value.

Description

Technical Field

[0001] The present invention relates to the technical field of genetic engineering, in particular to a PvFBA1 protein, a PvFBA1 gene, a recombinant vector and applications thereof in regulating plant cadmium tolerance. Background Art

[0002] Cadmium, a carcinogenic heavy metal, has become a significant threat to agricultural product safety and human health. With my country's strengthened efforts to combat environmental pollution and prioritize the development of beautiful villages, the importance of the turfgrass industry, a key player in this area, has grown exponentially. Turfgrass, with its rich variety of species, not only offers aesthetic value for landscaping and recreational purposes, but also has ecological value in remediating cadmium-contaminated soils.

[0003] Seaside paspalum (Paspalum vaginatum cv. Sea Spray) is a perennial C4 herbaceous plant of the genus Paspalum in the Poaceae family. It primarily grows on beaches and sandy land in tropical and subtropical regions. Seaside paspalum is widely used for livestock feed, lawn establishment, landscaping, and soil improvement. Seaside paspalum is one of the most cadmium-tolerant warm-season turfgrasses, with a cadmium tolerance threshold significantly higher than that of Eremochloa ophiuroides, Zoysia japonica, and Cynodon dactylon × C. transvaalensis. To date, no research has been conducted on the molecular mechanisms regulating cadmium tolerance in seaside paspalum, making in-depth exploration of the molecular pathways underlying its cadmium tolerance highly valuable. Summary of the Invention

[0004] To address the above problems, the present invention provides a PvFBA1 protein, a PvFBA1 gene, a recombinant vector, and their use in regulating plant cadmium tolerance. The PvFBA1 protein provided by the present invention has the function of regulating plant cadmium tolerance and can be used to improve plant cadmium tolerance.

[0005] In order to achieve the above object, the present invention provides the following technical solutions:

[0006] The present invention provides a PvFBA1 protein for regulating plant cadmium tolerance. The amino acid sequence of the PvFBA1 protein is shown in SEQ ID NO.1.

[0007] The present invention also provides a PvFBA1 gene encoding the PvFBA1 protein described in the above technical solution, characterized in that the nucleotide sequence of the PvFBA1 gene is shown in SEQ ID NO.2.

[0008] The present invention also provides a recombinant vector for overexpressing the PvFBA1 gene, wherein the recombinant vector comprises the PvFBA1 gene and a basic vector described in the above technical solution.

[0009] Preferably, the basic vector comprises pEarleyGate103.

[0010] Preferably, the PvFBA1 gene is located between the EcoR I and EcoRV restriction sites of the basic vector.

[0011] The present invention also provides the use of the PvFBA1 protein described in the above technical solution, the PvFBA1 gene described in the above technical solution, or the recombinant vector described in the above technical solution in regulating plant cadmium tolerance.

[0012] Preferably, the regulation includes improving the cadmium tolerance of the plant by positively regulating the expression level of the PvFBA1 protein.

[0013] Preferably, the plant comprises seashore paspalum or Arabidopsis thaliana.

[0014] The present invention also provides the use of the PvFBA1 protein described in the above technical solution, the PvFBA1 gene described in the above technical solution, or the recombinant vector described in the above technical solution in cultivating cadmium-tolerant transgenic plants.

[0015] The present invention also provides a method for cultivating cadmium-tolerant transgenic plants, comprising the following steps:

[0016] The recombinant vector described in the above technical solution is introduced into the plant tissue or cell to be transformed to cultivate a cadmium-resistant transgenic plant.

[0017] Beneficial effects:

[0018] The present invention provides a PvFBA1 protein for regulating plant cadmium tolerance. The amino acid sequence of the PvFBA1 protein is shown in SEQ ID NO. 1. Based on previous research, the present invention screened a yeast monoclone (cadmium-tolerant gene) with cadmium tolerance. After sequencing and comparison with the sequence of the model plant Arabidopsis thaliana, it was found that the protein expressed by the gene is fructose-1,6-bisphosphate aldolase, named PvFBA1 protein. The full-length gene sequence was cloned, and an overexpression vector was constructed based on this sequence, and genetic transformation of Arabidopsis thaliana was performed. The results showed that compared with wild-type plants, the root length and fresh weight of transgenic plants under cadmium stress were significantly higher than those of wild-type plants, indicating that the PvFBA1 gene and the PvFBA1 protein it expresses play an important regulatory role in cadmium stress, can improve plant cadmium tolerance, and can be used to cultivate plants with strong cadmium tolerance for cadmium pollution remediation, thus having practical application value. BRIEF DESCRIPTION OF THE DRAWINGS

[0019] In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings required for use in the embodiments are briefly introduced below.

[0020] Figure 1 The results showed that overexpression of PvFBA1 enhanced the tolerance of yeast to cadmium stress;

[0021] Figure 2 Agarose electrophoresis diagram of target gene amplification products; M is DL2,000 DNA Marker, and lane 1 or 2 is the target gene amplification product;

[0022] Figure 3 This is the agarose electrophoresis diagram of the amplified product of the entry vector; the first lane on the left is the DL15,000 DNA Marker; the remaining lanes are the electrophoresis diagrams of the PCR of the entry vector bacterial solution;

[0023] Figure 4 PCR results of E. coli culture containing pEarleyGate103 vector; M: DL2,000 DNA Marker; Lanes 1-6: PCR results of E. coli culture containing pEarleyGate103-PvFBA1 vector;

[0024] Figure 5 PCR of Agrobacterium tumefaciens culture medium containing pEarleyGate103-GFP vector; M: DL2,000 DNA Marker; Lanes 1-6: PCR of Agrobacterium tumefaciens culture medium containing pEarleyGate103-PvFBA1 vector;

[0025] Figure 6 The results of positive seedling detection; M: DL2,000 DNA Marker; Lanes 1-11: PCR of pEarleyGate103-PvFBA1 transgenic plants;

[0026] Figure 7 and Figure 8 The phenotypic results of transgenic plants and wild-type plants after culturing in different culture media for 12 days;

[0027] Figure 9 The results are the root length of transgenic plants and wild-type plants after culturing in different culture media for 12 days;

[0028] Figure 10 The fresh weight results of transgenic plants and wild-type plants after being cultured in different culture media for 12 days. DETAILED DESCRIPTION

[0029] The present invention provides a PvFBA1 protein for regulating plant cadmium tolerance, wherein the amino acid sequence of the PvFBA1 protein is shown in SEQ ID NO.1, specifically: MSTYCGAYCGAYCGKYKDELIK NAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIELVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPE ILVDGPHDIERCAYVTEKVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSKKVTPEVIAEYTVRALQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLNTKKPWSLSFSFGRALQASTLKAWGGKVENVEKARAAFLTRCKANSEATLGTYKGDSSADTESLHVKDYKY.

[0030] The PvFBA1 protein described in the present invention is a fructose-1,6-bisphosphate aldolase secreted by seashore paspalum, has the function of regulating plant cadmium tolerance, and can be used to improve plant cadmium tolerance.

[0031]

[0032] The PvFBA1 gene described in the present invention is a gene for regulating the cadmium resistance of seashore paspalum. The cadmium resistance of plants can be improved by overexpressing the PvFBA1 gene, and the gene can be used to cultivate transgenic plants with higher cadmium resistance.

[0033] The present invention also provides a recombinant vector for overexpressing the PvFBA1 gene, wherein the recombinant vector comprises the PvFBA1 gene and a basic vector described in the above technical solution.

[0034] In the present invention, the basic vector preferably includes pEarleyGate103; the PvFBA1 gene is preferably located between the EcoR I and EcoR V restriction enzyme sites of the basic vector.

[0035] The recombinant vector provided by the present invention can overexpress the PvFBA1 gene. Compared with wild-type plants, the root length and fresh weight of transgenic plants transferred with the recombinant vector under cadmium stress are significantly higher than those of the wild type, indicating that the PvFBA1 gene and the PvFBA1 protein expressed by it play an important regulatory role in cadmium stress. The recombinant vector provided by the present invention can improve the cadmium tolerance of plants and can be used to cultivate plants with strong cadmium tolerance for repairing cadmium pollution. By improving the cadmium tolerance of cadmium-tolerant plants, the repair ability of cadmium-tolerant plants to cadmium pollution is improved, and the vector has practical application value.

[0036] The present invention also provides the use of the PvFBA1 protein described in the above technical solution, the PvFBA1 gene described in the above technical solution, or the recombinant vector described in the above technical solution in regulating plant cadmium tolerance.

[0037] In the present invention, the regulation preferably includes improving the cadmium tolerance of the plant by positively regulating the expression level of the PvFBA1 protein.

[0038] In the present invention, the plant preferably includes seashore paspalum or Arabidopsis thaliana.

[0039] The present invention also provides the use of the PvFBA1 protein described in the above technical solution, the PvFBA1 gene described in the above technical solution, or the recombinant vector described in the above technical solution in cultivating cadmium-tolerant transgenic plants.

[0040] The present invention also provides a method for cultivating cadmium-tolerant transgenic plants, comprising the following steps:

[0041] The recombinant vector described in the above technical solution is introduced into the plant tissue or cell to be transformed to cultivate a cadmium-resistant transgenic plant.

[0042] In the present invention, the substance preferably includes seashore paspalum or Arabidopsis thaliana.

[0043] To further illustrate the present invention, the PvFBA1 protein, PvFBA1 gene, recombinant vector and their application in regulating plant cadmium tolerance provided by the present invention are described in detail below with reference to the examples and drawings, but they should not be construed as limiting the scope of protection of the present invention.

[0044] Example 1

[0045] The materials used in the present invention are seashore paspalum 'Hailang', Saccharomyces cerevisiae strain Δycf1 (disclosed in [Shim, D., et al. (2009). "Orthologs of the class A4 heat shock transcription factor HsfA4aconfer cadmium tolerance in wheat and rice." The Plant Cell 21(12):4031-4043.]) and Arabidopsis thaliana Col-0, all from the Grass Physiology and Molecular Biology Research Team of Nanjing Agricultural University.

[0046] Construction of an overexpression vector for the PvFBA1 gene from seashore paspalum

[0047] (1) Obtaining the target gene

[0048] Based on the full-length expression library of Halophyte cDNA constructed by the applicant in the early stage (see the literature [Chen Y., et al. (2016). "Functional Identification and Characterization of Genes Cloned from Halophyte Seashore Paspalum Conferring Salinity and Cadmium Tolerance." Frontiers in Plant Science 7:102.]), screening for functional genes of Halophyte Seashore Paspalum cadmium tolerance was carried out in Saccharomyces cerevisiae.

[0049] The experimental groups were treated as follows: the polyethylene glycol (PEG) / lithium acetate method was used to efficiently prepare yeast Δycf1 competent cells and the full-length expression library plasmid of seashore paspalum cDNA was transformed into yeast competent cells. After the cells were grown in YPD Plus recovery medium, the cells were cultured at 10 1 , 10 2 , 10 3 and 10 4The bacterial suspension was diluted and plated on SD / URA solid medium containing 0, 50 μM, and 100 μM CdCl2 at four concentrations. A control group, designated Δycf1+EV, was set up. The only difference between the control group and the experimental group was that the plasmid of the full-length expression library of Paspalum cDNA in the experimental group was replaced with the empty vector pYES2-DEST52. Finally, a yeast monoclone with cadmium resistance was successfully screened and obtained. The results are shown in the figure. Figure 1 After sequencing and comparing it with the model plant Arabidopsis thaliana sequence, it was found that the gene was fructose-1,6-bisphosphate aldolase and was named PvFBA1.

[0050] (2) Primer design

[0051] The full-length nucleotide sequence of the PvFBA1 gene was analyzed for restriction sites using BioXM 2.7 software, and EcoRI and EcoRV were selected as the two restriction endonucleases. Primers were designed using PremierPrimer 5.0 software. The designed sequences were synthesized by Qingke Biotechnology Co., Ltd. and are as follows:

[0052] Primer-F: 5′-gaattcgcATGTCGACATACTGCGGAGCCTACTG-3′, SEQ IDNO.3;

[0053] Primer-R: 5′-gatatcTCAGTACTTGTAGTCCTTGACGTGGAG-3′, SEQ IDNO.4;

[0054] The lowercase sequence of the upstream primer F is the EcoR I restriction enzyme cutting sequence; the lowercase sequence of the downstream primer R is the EcoR V restriction enzyme cutting sequence.

[0055] (3) Gene cloning

[0056] Using the cDNA of seashore paspalum as a template, the primers designed in step (2) were used to perform PCR amplification of the full-length sequence of the cloned gene using NEB's Q5 high-fidelity enzyme system to obtain a PCR reaction product; the PCR reaction solution system was: 5×Q5 Reaction Buffer 10μL, 5×Q5 High GC Enhancer 10μL, 2.5mM dNTPs 4μL, 10μM Primer-F 2.5μL, 10μM Primer-R 2.5μL, cDNA 0.5μL, Q5 High-Fidelity DNA Polymerase 0.5μL and ddH2O to 50μL; the PCR reaction conditions were: pre-denaturation at 98℃ for 30s; denaturation at 98℃ for 10s, annealing at 64℃ for 30s, extension at 72℃ for 45s, 30 cycles; total extension at 72℃ for 5min; and storage at 10℃.

[0057] The above PCR reaction product was added with 5 μL of 10× Loading Buffer, spotted into a lane of 1% agarose gel, and run agarose gel electrophoresis for 20 min at 120V and 200mA. Observe, capture images, and cut the target band in a gel imager. The results are shown in Figure 2 .

[0058] Depend on Figure 2 From the sequencing results of the target band, it can be seen that the PCR reaction product obtained in the present invention is the band of the target gene PvFBA1, which can be used for subsequent experiments.

[0059] (4) Entry vector bacterial solution PCR

[0060] The PCR product and vector pENTR1A were purified by double digestion with restriction endonucleases BamH I and Not I in step (3). The two double digestion fragments of PvFBA1 and pENTR1A were ligated together using the T4 DNA ligase reaction system. The reaction product was transformed into competent E. coli TOP10 to obtain the entry vector pENTR1A-PvFBA1. The primers designed in step (2) were used for PCR amplification to verify the correctness of the entry vector pENTR1A-PvFBA1. The PCR amplification reaction system was: Primer-F 0.5μL, Primer-R 0.5μL, 2×PCR Mix 5μL, bacterial solution 1μL and ddH2O 3μL. The PCR amplification reaction conditions were: 94℃ pre-denaturation for 10min; 94℃ denaturation for 30s; 58℃ annealing for 30s; 72℃ extension for 1.5min, 32 cycles; 72℃ total extension for 10min; 4℃ termination reaction. The obtained amplified products were subjected to agarose electrophoresis. Figure 3The first lane on the left is DL15,000 DNA Marker; the remaining lanes are PCR electrophoresis images of entry vector bacterial solution.

[0061] Depend on Figure 3 It can be seen that the entry vector contains the target gene PvFBA1 and can be used for subsequent experiments.

[0062] (5) pEarleyGate103 vector Escherichia coli PCR

[0063] The plasmid pENTR1A-PvFBA1 was linearized using the restriction endonuclease Pvu I, and the target gene PvFBA1 was cloned into the pEarleyGate103 vector using the LR recombinase system of the Gateway technology to construct the plant overexpression vector pEarleyGate103-PvFBA1. The correctness of the constructed pEarleyGate103-PvFBA1 vector was verified by PCR amplification using the primers designed in step (2). The PCR amplification reaction system was: Primer-F 0.5μL, Primer-R 0.5μL, 2×PCRMix 5μL, Escherichia coli liquid 1μL and ddH2O 3μL. The reaction conditions were: pre-denaturation at 94℃ for 10min; denaturation at 94℃ for 30s; annealing at 58℃ for 30s; extension at 72℃ for 1.5min, 32 cycles; total extension at 72℃ for 10min; termination at 4℃. The obtained amplified products were subjected to agarose electrophoresis. Figure 4 .

[0064] Depend on Figure 4 It can be seen that the overexpression vector pEarleyGate103-PvFBA1 contains the target gene PvFBA1 and can be used for subsequent experiments.

[0065] Example 2: Transformation of Agrobacterium EHA105

[0066] (1) Take out the competent Agrobacterium EHA105 stored in a -80°C ultra-low temperature freezer and thaw on ice. Add 1 μL of the pEarleyGate103-PvFBA1 overexpression vector constructed in step (5) of Example 1, mix, transfer to a pre-cooled 1 mm electroporation cuvette, then ice-bathe for 5 minutes and electroporate once.

[0067] (2) Add 1000 μL of sterile LB liquid medium without resistance and culture on a shaker at 28°C and 200 rppm for 1 h;

[0068] (3) After the culture is completed, the bacterial solution is centrifuged at 6000 rpm for 1 min, part of the supernatant is discarded, and 100 μL is evenly spread on LB solid medium; the LB solid medium contains 50 mg / L Kan and 50 mg / L Rif, sealed with a parafilm, and inverted in a 28°C incubator for 3 days;

[0069] (4) Bacteria inspection and backup: PCR amplification is performed using the primers designed in step (2) to verify whether Agrobacterium has been successfully transformed. The PCR amplification method is the same as step (5) in Example 1. The target band is correct and has the same brightness ( Figure 5 ) for successfully transformed Agrobacterium, and the corresponding colonies from the backup plate were picked into LB liquid medium containing 50 mg / L Kan and 50 mg / L Rif, and shaken; the bacterial liquid and 50% glycerol were then maintained at a volume ratio of 3:7, quickly frozen in liquid nitrogen, and stored in a -80°C ultra-low temperature freezer.

[0070] Example 3: Infecting Arabidopsis inflorescences and screening for resistant plants

[0071] (1) Shaking the bacteria: Take out the bacterial solution successfully transformed in Example 2 and place it on ice to melt. Use a pipette to add the bacterial solution to 20 mL of LB liquid medium containing 50 mg / L Kan and 50 mg / L Rif. Place the culture on a shaker at 28°C and 200 rpm until the bacterial solution OD reaches 0. 600 =1.6, sterilization conditions 5000rpm, 8min;

[0072] (2) Transformation: Prepare 500 mL of a 5 wt.% sucrose solution, suspend the bacteria with a small amount of sucrose solution, and add 0.02% Silwet L-77 before transformation. Soak the inflorescence of Arabidopsis thaliana in the bacterial solution for 50 seconds, remove it and shake it briefly, then place it in an empty paper box and culture it in the dark for 24 hours. After one day, place the plant upright and water it once every three days to ensure that the plant is well hydrated.

[0073] (3) Screening: Harvested transgenic seeds were disinfected with Triton X-100 and sodium hypochlorite solution, and the seeds were spread on 1 / 2 MS medium containing 20 mg / L Basta (Product No.: 45520; Brand: Sigma-Aldrich) with water. The seeds were cultured in the dark at 4°C for 2 days, and then transferred to 22°C with 16 h of light culture. If the seeds still grew well after Basta screening, they could be preliminarily determined to be positive seedlings.

[0074] (4) Harvesting T1 transgenic plants: When the positive seedlings have 2 leaves, transfer them to a sterilized substrate, place them in a growth room, cover them with a transparent plastic cover to keep them moist for 7 days, and then maintain them normally.

[0075] Example 4: Identification of cadmium-tolerant phenotypes of transgenic plants

[0076] (1) Positive seedling detection: The total RNA of the plant in step (4) of Example 3 was extracted using the TIANGEN plant total RNA extraction kit (DP432); the total RNA of the plant in step (4) of Example 3 was extracted using the TaKaRa PrimeScript TM The extracted RNA was reverse transcribed into cDNA using the RTMasterMix (Perfect Real Time) reverse transcription kit. The resulting cDNA was diluted 10-fold with water and stored at -20°C. PCR amplification of the full-length sequence of the cloned gene was performed using NEB's Q5 high-fidelity enzyme system to obtain PCR products. The PCR reaction mixture consisted of 5 μL of 2× PCR Mix, 10.5 μL of F, 10.5 μL of R, 1 μL of bacterial culture, and 3 μL of ddH2O.

[0077] The nucleotide sequence of F1 is: 5′-TATCCTTCGCAAGACCCTTCCTCTA-3′, SEQ ID NO. 5;

[0078] The nucleotide sequence of R1 is: R: 5′-TCAGTACTTGTAGTCCTTGACGTGGAG-3′, SEQ ID NO.6;

[0079] The PCR reaction conditions were as follows: pre-denaturation at 94°C for 10 min; 32 cycles of denaturation at 94°C for 30 s, annealing at 58°C for 30 s, and extension at 72°C for 90 s; total extension at 72°C for 1 min; and termination of the reaction at 25°C.

[0080] The above PCR reaction products were added with 5 μL of 10× Loading Buffer and detected by agarose gel electrophoresis. The plants with the same target band were considered positive plants ( Figure 6 ), 11 transgenic lines were obtained after testing, and 4 lines were randomly selected to perform the phenotypic experiment in step (2).

[0081] (2) Identification of cadmium-tolerant phenotype: The four transgenic lines selected in step (1) (denoted as OE1, OE2, OE3, and OE4) and wild-type (Col-0) Arabidopsis seeds were grown on 1 / 2 MS medium containing different concentrations of cadmium chloride, wherein the concentrations of the different cadmium chlorides were 0 μM, 50 μM, 100 μM, and 150 μM. The root length and fresh weight of the lines were measured after 12 days of culture. The results are shown in Tables 1 and Figures 7-10 .

[0082] Table 1 Root length and fresh weight of different strains under different cadmium concentrations

[0083]

[0084] From Table 1 and Figures 7-10 It can be seen that under the condition of 150 μM cadmium concentration, the root length and fresh weight of the transgenic lines (OE1, OE2, OE3 and OE4) were significantly higher than those of the wild type, indicating that the PvFBA1 gene and the PvFBA1 protein it expresses play an important regulatory role in cadmium stress and can improve the cadmium tolerance of plants.

[0085] In summary, the PvFBA1 protein provided by the present invention has the function of regulating plant cadmium tolerance and can be used to improve plant cadmium tolerance.

[0086] Although the above embodiment provides a detailed description of the present invention, it is only a part of the embodiments of the present invention, not all of the embodiments. People can also obtain other embodiments based on this embodiment without creativity, and these embodiments all fall within the scope of protection of the present invention.

Claims

1. PvFBA1 protein or PvFBA1 Application of genes or recombinant vectors in improving plant cadmium tolerance; the amino acid sequence of the PvFBA1 protein is shown in SEQ ID NO.1; PvFBA1 The nucleotide sequence of the gene is shown in SEQ ID NO.2; the recombinant vector includes the PvFBA1 Gene and basic vector; the application is to express the PvFBA1 protein in plants or to transfer the PvFBA1 The gene is transferred into the recombinant vector; the plant is seashore paspalum or Arabidopsis thaliana.

2. The use according to claim 1, characterized in that The basic vector is pEarleyGate103.

3. The use according to claim 2, characterized in that described PvFBA1 The gene is located in the pEarleyGate103 vector EcoR I and EcoR V between the restriction sites.

4. PvFBA1 protein or PvFBA1 Application of genes or recombinant vectors in cultivating cadmium-tolerant transgenic plants; the amino acid sequence of the PvFBA1 protein is shown in SEQ ID NO.1; PvFBA1 The nucleotide sequence of the gene is shown in SEQ ID NO.2; the recombinant vector includes the PvFBA1 Gene and basic vector; the cadmium-resistant transgenic plant is to express the PvFBA1 protein or to transfer the PvFBA1 The invention relates to a transgenic plant having the gene or the recombinant vector transferred therein; the plant is seashore paspalum or Arabidopsis thaliana.

5. The use according to claim 4, characterized in that The basic vector is pEarleyGate103.

6. The use according to claim 5, characterized in that described PvFBA1 The gene is located in the pEarleyGate103 vector EcoR I and EcoR V between the restriction sites.

7. A method for cultivating cadmium-tolerant transgenic plants, characterized in that: The following steps are involved: The recombinant vector is introduced into the plant tissue or cell to be transformed to cultivate a cadmium-resistant transgenic plant; the recombinant vector includes PvFBA1 Gene and base vector; PvFBA1 The nucleotide sequence of the gene is shown in SEQ ID NO. 2; the plant is seashore paspalum or Arabidopsis thaliana.

8. The method according to claim 7, characterized in that The basic vector is pEarleyGate103.

9. The method according to claim 8, characterized in that described PvFBA1 The gene is located in the pEarleyGate103 vector EcoR I and EcoR V between the restriction sites.

Images