Application of the HbHRG1 gene in regulating plant height in Brazilian rubber trees

Abstract

The invention discloses an application of a Hevea brasiliensis HbHRG1 gene in regulating plant height, and relates to the technical fields of genetic engineering and plant breeding. The invention provides a plant height regulating gene HbHRG1, and its nucleotide sequence is shown in SEQ ID NO.1. The invention screens out a gene HbHRG1 that may regulate plant height from a Hevea brasiliensis transcriptome, and transgenic experiments prove that overexpression of HbHRG1 in Populus tomentosa can increase plant height, and the gene can be applied to the directional genetic improvement of Hevea brasiliensis and the cultivation of new high-quality germplasm, broadening the scope of utilization of Hevea brasiliensis genetic resources, providing candidate genes for the cultivation of superior varieties of Hevea brasiliensis, and laying a foundation for in-depth research on the relevant mechanism of HbHRG1 regulating plant height.

Description

Technical Field

[0001] The invention relates to the technical field of genetic engineering and plant breeding, and in particular to the application of a Hevea brasiliensis HbHRG1 gene in regulating plant strain height. Background Art

[0002] Hevea brasiliensis. (Willd.ex A.Juss.) Müll.Arg. is a large tree of the Euphorbiaceae family, with a mature tree height of up to 30 meters. The rubber tree is native to Brazil and is now distributed in more than 40 countries and regions in Asia, Africa, Oceania, and Latin America. The natural rubber it produces is an important industrial raw material.

[0003] Plant height is an important agronomic trait of the Brazilian rubber tree, which not only affects the wood production of the Brazilian rubber tree, but also plays an important role in the latex production. Identifying plant height regulatory genes, clarifying the molecular mechanism of plant height regulation, and applying it to the improvement of new varieties is an effective way to create new plant types and increase wood and latex production. By exploring and identifying genes related to plant type traits, new germplasm and genetic resources are provided for the construction of the ideal plant type of Brazilian rubber tree. Summary of the invention

[0004] The purpose of the present invention is to provide an application of the Hevea brasiliensis HbHRG1 gene in regulating plant height to solve the problems existing in the above-mentioned prior art. Overexpression of the Hevea brasiliensis HbHRG1 gene in plants can increase plant height.

[0005] To achieve the above object, the present invention provides the following solutions:

[0006] The present invention provides an application of the Hevea brasiliensis HbHRG1 gene in any of the following:

[0007] (1) Application in regulating plant strains;

[0008] (2) Application in the cultivation of transgenic plants with increased plant height;

[0009] The nucleotide sequence of the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.1.

[0010] The present invention also provides the use of the protein encoded by the Hevea brasiliensis HbHRG1 gene in any of the following:

[0011] (1) Application in regulating plant strains;

[0012] (2) Application in the cultivation of transgenic plants with increased plant height;

[0013] The amino acid sequence of the protein encoded by the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.2.

[0014] The present invention provides the use of a recombinant vector comprising the Hevea brasiliensis HbHRG1 gene in any of the following:

[0015] (1) Application in regulating plant strains;

[0016] (2) Application in the cultivation of transgenic plants with increased plant height.

[0017] Preferably, the nucleotide sequence of the recombinant vector is as shown in SEQ ID NO.3.

[0018] Use of the engineered bacteria comprising the recombinant vector in any of the following:

[0019] (1) Application in regulating plant strains;

[0020] (2) Application in the cultivation of transgenic plants with increased plant height.

[0021] Preferably, the expression level of the Hevea brasiliensis HbHRG1 gene is upregulated to increase the plant height; the nucleotide sequence of the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.1;

[0022] More preferably, the plants include Hevea brasiliensis and Populus tomentosa.

[0023] The present invention also provides a method for increasing the height of a plant, comprising the step of overexpressing a Hevea brasiliensis HbHRG1 gene in a plant to increase the height of the plant; the nucleotide sequence of the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.1;

[0024] Preferably, the plants include Hevea brasiliensis and Populus tomentosa.

[0025] The present invention also provides a method for cultivating a transgenic plant with increased plant height, comprising the following steps:

[0026] Overexpressing the HbHRG1 gene in plant cells, then cultivating the plant cells, and using the plant cells to regenerate plants, thereby obtaining the transgenic plant with increased plant height; the nucleotide sequence of the HbHRG1 gene of the rubber tree of Brazilian rubber tree is shown in SEQ ID NO.1;

[0027] Preferably, the plants include Hevea brasiliensis and Populus tomentosa.

[0028] The present invention discloses the following technical effects:

[0029] The present invention discovered the HbHRG1 gene in the Brazilian rubber tree, synthesized the gene, and overexpressed the HbHRG1 gene in Populus tomentosa for the first time, confirming that the Brazilian rubber tree HbHRG1 gene has the function of increasing plant height, providing a new idea for directional trait genetic improvement and cultivating transgenic plants related to plant height traits. It has important guiding significance for directional breeding of crop plant height traits, cultivating new excellent germplasm and production application, and has broad application prospects. BRIEF DESCRIPTION OF THE DRAWINGS

[0030] In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings required for use in the embodiments will be briefly introduced below. Obviously, the drawings described below are only some embodiments of the present invention. For ordinary technicians in this field, other drawings can be obtained based on these drawings without paying creative work.

[0031] Figure 1 The expression level of HbHRG1 gene in different tissues of Hevea brasiliensis is statistically analyzed; Pistil: pistil; Stamen: stamen; Seed coat: seed coat; Latex: rubber; Peel: fruit skin; Root: root; Petiole: petiole; Immaturebark: immature bark; Immature xylem: immature xylem; Mature bark: mature bark; Maturexylem: mature xylem; Leaf: leaf; Seedkernel: seed kernel;

[0032] Figure 2 This is the subcellular localization map of HbHRG1 protein in Nicotiana benthamiana leaf cells; Bright: bright field; DAPI: 4',6-diamidino-2-phenylindole; FM4-64: styrylpyridine dye; GFP: green fluorescent protein; Merged: merged field;

[0033] Figure 3 Statistical diagram of the expression level of HbHRG1 gene in transgenic white poplar; *P<0.05, **P<0.01, ***P<0.001; the internal reference gene is the white poplar Actin gene; WT: wild-type white poplar; OE25, OE26, OE28: transgenic white poplar

[0034] Figure 4 This is the detection diagram of HbHRG1 protein expression in transgenic Populus tomentosa; M: Marker, standard molecular weight protein premix; WT: wild-type Populus tomentosa; OE25, OE26, OE28: transgenic Populus tomentosa;

[0035] Figure 5This is a plant height analysis diagram of HbHRG1 transgenic Populus tomentosa and wild-type Populus tomentosa; WT: wild-type Populus tomentosa; OE25, OE26, OE28: transgenic Populus tomentosa. DETAILED DESCRIPTION

[0036] Various exemplary embodiments of the present invention will now be described in detail. This detailed description should not be considered as limiting the present invention, but should be understood as a more detailed description of certain aspects, features, and embodiments of the present invention.

[0037] It should be understood that the terms described in the present invention are only for describing a particular embodiment and are not intended to limit the present invention. In addition, for the numerical range in the present invention, it should be understood that each intermediate value between the upper and lower limits of the scope is also specifically disclosed. The intermediate value in any stated value or stated range, and each smaller range between any other stated value or intermediate value in the described range is also included in the present invention. The upper and lower limits of these smaller ranges can be independently included or excluded in the scope.

[0038] Unless otherwise indicated, all technical and scientific terms used herein have the same meanings as those generally understood by those skilled in the art. Although the present invention describes only preferred methods and materials, any methods and materials similar or equivalent to those described herein may also be used in the implementation or testing of the present invention. All documents mentioned in this specification are incorporated by reference to disclose and describe the methods and / or materials associated with the documents. In the event of a conflict with any incorporated document, the content of this specification shall prevail.

[0039] It will be apparent to those skilled in the art that various modifications and variations may be made to the specific embodiments of the present invention description without departing from the scope or spirit of the present invention. Other embodiments derived from the present invention description will be apparent to those skilled in the art. The present invention description and examples are exemplary only.

[0040] The words “include,” “including,” “have,” “contain,” etc. used in this document are open-ended terms, meaning including but not limited to.

[0041] The present invention screens out a gene HbHRG1 that may regulate plant height from the transcriptome of Hevea brasiliensis, and the nucleotide sequence of the gene is shown in SEQ ID NO.1.

[0042] SEQ ID NO.1:

[0043] ATGGCAATCACAAGACTTTTACGTTCTTTTAGGCCTCTGCGTCATGTTCCTCCTCCTGGTTCAACTTCATCATCTGTTACGACGGTGAAATTCATTGGCAAGAATACTGCAGGGTTGGGTGGAGAGAAGATGGTTTCAGGGGACGGTGACAAAAGGAAATCAACGGCGGCTGCTATGAAACCATCCGTGTCTACTAATGAGAGCTTGATCACTGCAGAATCACGGGTTGATGAGGGATTGGATTTGTCTTCTTTGCTTGCAACTGTTTGCAATGCTTTGTTTAAGGTGTTG AAGCCTGCTGTTAAACGAAAGCCCTGGAATTTACAGGTCCAGATGCTCATTGAAAAGGCAATAATTGATTGTCGGTTCTTCACATTATTTGCCATTGCGGGATCCTTGCTAGGTTCAGTATTGTGTTTTCTGGAGGGTTGCTTTCTCATTCTAAAGTCATACTTTCACTATTTTAATACGTTATCTCATAGTTTTGATCAAGGACATTTGGTGCAGCTACTTATAGAAGCCATTGACATGTTCTTGGTACGGACAGCCATGCTTATGTTTGGGGTTGGGTTGTATGTCATCTTTGTGGGACCAAAGAATTCAAAAGACGAAAGGCCATGGCTGCCAGGATCAAACTTTTTTGGGCTATTCTATTTGAAGTCTCTTCCAACATGGATGCAGATGGAGTCAGTTACACAAGCCAAGTCTAGAATTGGGCATGCTGCAATGATGATACTGCAAGTGGGATTCTTGGAGAAATTCAAGAACATACCTCTAGTTACGAGTTTGGATCTTGCCTGTTTTGCAGGATCTGTACTGGTTTCCTCAGCTTGTATATTCATTCTTTCAAAACTCTCAGTTGGTGGTATTTCGGGAAAAGGCAGGTAA。

[0044] The amino acid sequence of the protein encoded by the HbHRG1 gene is shown in SEQ ID NO.2.

[0045] SEQ ID NO.2:

[0046] MAITRLLRRSFRPLRHVPPPGSTSSSVTTVKFIGKNTAGLGGEKMVSGDGDKRKSTAAAMKPSVSTNESLITAESRVDEGLDLSSLLATVCNALFKVLKPAVKRKPWNLQVQMLIEKAIIDCRFFTLFAIAGSLLGSVLCFLEGCFLIL KSYFHYFNTLSHSFDQGHLVQLLIEAIDMFLVRTAMLMFGVGLYVIFVGPKNSKDERPWLPGSNFFGLFYLKSLPTWMQMESVTQAKSRIGHAAMMILQVGFLEKFKNIPLVTSLDLACFAGSVLVSSACIFILSKLSVGGISGKGR.

[0047] Example 1 Analysis of tissue expression of HbHRG1 gene

[0048] 1. Total RNA Extraction and Reverse Transcription

[0049] (1) Leaves, stem xylem, bark, female flowers, male flowers, pericarp, and seed tissues of one-year-old Hevea brasiliensis RY73397 were collected.

[0050] (2) Place the plant tissue in a mortar pre-cooled with liquid nitrogen, add liquid nitrogen and immediately grind it into powder.

[0051] (3) Total RNA was extracted using the OminiPlant RNA Kit (Chemical Industry News, catalog number: CW2598).

[0052] (4) Take the dissolved RNA sample, measure the concentration of total RNA with a nucleic acid protein analyzer, detect its purity, and perform electrophoresis with 1% agarose gel to quickly detect its quality.

[0053] (5) Using the EasyScript One-Step gDNA Removal and cDNA Synthesis Kit (Beijing Quanshijin Biotechnology Co., Ltd., Catalog No.: AE311-02), total RNA was used as a template for cDNA synthesis. The reaction system is shown in Table 1, with a total volume of 20 μL. The reaction conditions were 42°C for 15 min, 85°C for 5 s, and stored at 4°C.

[0054] Table 1 Reverse transcription reaction system

[0055]

[0056] 2. qRT-PCR detection of HbHRG1 gene expression levels in different tissues of Hevea brasiliensis

[0057] (1) Design qRT-PCR primers as shown in Table 2, use cDNA as template, add samples according to the reaction system shown in Table 3, and perform qRT-PCR reaction. The PCR program is: 94°C for 30 s; 94°C for 5 s, 60°C for 30 s, 72°C for 20 s, 30 cycles.

[0058] (2) Use 2 -ΔΔCT Methods The relative expression of HbHRG1 gene in different tissues of Hevea brasiliensis was calculated and analyzed. The data were visualized using Excel software. SPSS26 software was used for significance analysis of the data.

[0059] Table 2 qRT-PCR primer design

[0060]

[0061] Table 3 Fluorescence quantitative PCR reaction system

[0062]

[0063] The qRT-PCR test results are as follows Figure 1 As shown, the HbHRG1 gene is highly expressed in the immature xylem and mature xylem of the stem of the Brazilian rubber tree. The stem is the main part of the plant height growth and has an important influence on the growth and development of the plant. This shows that the HbHRG1 gene plays an important role in the plant height growth process of the Brazilian rubber tree.

[0064] Example 2 Subcellular localization of HbHRG1 protein

[0065] Through bioinformatics analysis and prediction, HbHRG1 protein may be localized in the plasma membrane. Next, we constructed recombinant bacteria, injected them into plant leaves, and further verified them by subcellular localization.

[0066] 1. Construction of recombinant bacteria

[0067] The full length of the HbHRG1 gene without a stop codon was synthesized, connected to the N-terminus of the green fluorescent protein gene GFP, and the expression was initiated by the strong promoter 35S to construct a 35S::HbHRG1:GFP expression vector. At the same time, the 35S::GFP empty vector was used as a control. The nucleotide sequence of the 35S::HbHRG1:GFP expression vector is shown in SEQ ID NO.3.

[0068] The two vectors 35S::GFP and 35S::HbHRG1:GFP were transformed into Agrobacterium, and the positive bacterial liquid was preserved after sequencing and identification.

[0069] 2. Subcellular localization

[0070] 2.1 Preparation of osmotic resuspension:

[0071] 2.033 g MgCl2·6H2O and 1.952 g 2-(N-morphophenanthroline)ethanesulfonic acid were dissolved in 100 mL ddH2O to prepare a 10-fold concentration mother solution, sterilized at 121°C for 15 min, and stored in a refrigerator at 4°C for later use; 19.62 mg acetosyringone was dissolved in 1 mL dimethyl sulfoxide to prepare a 5-fold mother solution, which was stored at -20°C for later use.

[0072] 2.2 Subcellular localization method:

[0073] First, the 35S::GFP and 35S::HbHRG1:GFP Agrobacterium strains stored at -20°C were streaked on solid LB plates containing kanamycin and rifampicin to revive, and then single clones were placed in 10 mL LB liquid medium containing kanamycin and rifampicin antibiotics and cultured overnight at 200 rpm and 28°C. The bacterial solution was centrifuged at 4000 rpm for 10 min, the LB medium was discarded, and the Agrobacterium cells were resuspended with infiltration resuspension solution to adjust the OD 600 The concentration of 35S::GFP and 35S::HbHRG1:GFP was 0.6-0.8, and the suspension was allowed to stand at room temperature for 2 hours. The resuspended solutions containing 35S::GFP and 35S::HbHRG1:GFP were injected into the dorsal tissue of tobacco leaves using a disposable syringe. The injected tobacco was cultured in the dark at 25°C for 24 hours, and finally cultured normally for 48 hours, and then the tobacco leaves were observed under a confocal microscope.

[0074] The results are as follows Figure 2 As shown, the fluorescent dye DAPI locates the cell nucleus, the fluorescent dye FM4-64 locates the plasma membrane, and GFP locates the target protein. It can be seen that the fluorescent signal of 35S::GFP appears in the cell nucleus, cell membrane and cytoplasm, while the fluorescent signal of 35S::HbHRG1:GFP appears in the plasma membrane.

[0075] Example 3 Poplar genetic transformation

[0076] The overexpression vector containing the HbHRG1 gene in Example 2 was delivered to Wuhan Boyuan Biotechnology Co., Ltd. to transform Populus tomentosa. The transgenic Populus tomentosa seedlings were planted in Building 3, Phase III, Gaonong Bio-Park Headquarters, No. 888, Gaoxin Avenue, East Lake High-tech Zone, Wuhan City, Hubei Province, to obtain transgenic Populus tomentosa plants.

[0077] Example 4 Target gene expression detection

[0078] 1. Total RNA Extraction and Reverse Transcription

[0079] The transgenic Populus tomentosa plants obtained in Example 3 were used to extract total RNA and perform reverse transcription:

[0080] (1) Take the leaves of Populus tomentosa, cut them into small pieces quickly, put them into a mortar pre-cooled with liquid nitrogen, add liquid nitrogen and grind them quickly twice immediately.

[0081] (2) Total RNA was extracted using the OminiPlant RNA Kit (Chemical Industry News, catalog number: CW2598).

[0082] (3) Take the dissolved RNA sample, measure the total RNA concentration with a nucleic acid protein analyzer, detect its purity, and quickly detect its quality with 1% agarose gel.

[0083] (4) Using the EasyScript One-Step gDNA Removal and cDNA Synthesis Kit (Beijing Quanshijin Biotechnology Co., Ltd., Catalog No.: AE311-02), total RNA was used as a template for cDNA synthesis. The 20 μL reaction system is shown in Table 4. The reaction conditions were 42°C for 15 min, 85°C for 5 s, and stored at 4°C.

[0084] Table 4 Reverse transcription reaction system

[0085]

[0086] 2. qRT-PCR detection of HbHRG1 gene expression in transgenic Populus tomentosa

[0087] (1) Design qRT-PCR primers as shown in Table 2 of Example 1, use cDNA as template, add sample according to the reaction system shown in Table 5, and perform qRT-PCR reaction. The PCR program is: 94°C for 30 s; 94°C for 5 s, 60°C for 30 s, 72°C for 20 s, and 30 cycles.

[0088] Table 5 Fluorescence quantitative PCR reaction system

[0089]

[0090] (2) Use 2 -ΔΔCT Methods The relative expression level of HbHRG1 in transgenic Populus tomentosa was calculated and analyzed. Figure 3 ). Excel was used to visualize the data. SPSS26 was used to perform significance analysis on the data.

[0091] After qRT-PCR detection, the results were as follows Figure 3 As shown, the target gene was highly expressed in transgenic Populus tomentosa (OE25, OE26 and OE28).

[0092] Example 5 Target protein expression detection

[0093] The transgenic Populus tomentosa leaves expressing the HbHRG1 gene detected in Example 4 were cut and total protein was extracted and detected by Western blot:

[0094] (1) Plant total protein was extracted according to the method of the Plant Total Protein Extraction Kit (Beijing Coolbo Technology Co., Ltd., catalog number: PTE001).

[0095] (2) Add an appropriate amount of protein extract to the extracted protein, mix well, and boil for 10 minutes to obtain a sample to be tested.

[0096] (3) Take 5 μL of the sample to be tested and load it in sequence. The marker used is Uelandy color pre-stained protein marker (10-180 kDa, three colors). After loading, perform SDS-PAGE electrophoresis, first at 100 V for 30 min; after the sample has entered the separation gel, perform electrophoresis at 120 V until the end.

[0097] (4) Soak the polyvinylidene fluoride membrane (PVDF membrane) in 100% methanol for 30 seconds; place it in the transfer tank in the order of "sponge-gel-PVDF-sponge" from the negative electrode to the positive electrode, and pour in the transfer buffer; transfer the membrane at a voltage of 200V for 2 hours and a constant current of 150mA.

[0098] After the end, the PVDF membrane was placed in 1× TBST buffer and washed three times, each time for 5 min.

[0099] (5) Place the PVDF membrane in a blocking solution containing 5% skim milk powder and block it at room temperature for 1 hour. Remove the PVDF membrane from the blocking solution and wash it in 1×TBST buffer for 3 times, 5 minutes each time; dilute the primary antibody (mouse anti-GFP, 1:2000) with the blocking solution, place the PVDF membrane in the primary antibody dilution solution, place it on a shaker, and incubate it at 4°C for 2 hours.

[0100] (6) Remove the PVDF membrane from the primary antibody and wash it three times in 1×TBST buffer, 5 min each time; dilute the secondary antibody (goat anti-mouse, 1:1000) with a blocking solution containing 5% skim milk powder; place the PVDF membrane in the secondary antibody dilution solution, place it on a shaker, and incubate it at room temperature for 1 h. Remove the PVDF membrane and wash it three times in 1×TBST buffer, 5 min each time.

[0101] (7) Mix liquid A and liquid B of the ECL developer in a ratio of 1:1, cover the PVDF membrane, make the PVDF membrane fully contact with the developer, and observe the PVDF membrane by imaging.

[0102] The results are as follows Figure 4 As shown, Western blot analysis showed that the HbHRG1-GFP fusion protein was expressed in transgenic P. tomentosa (OE25, OE26, and OE28) but not in wild-type P. tomentosa.

[0103] Example 6 Plant height measurement

[0104] The height of the aboveground part of the transgenic and wild-type Populus tomentosa was measured with a ruler, and three biological replicates were measured. The data were visualized using Excel software. SPSS26 software was used to perform a significance analysis of the data.

[0105] The results are as follows Figure 5 As shown, the plant height of transgenic white poplar (OE25, OE26 and OE28) overexpressing the HbHRG1 gene was significantly higher than that of wild-type white poplar (WT), indicating that overexpression of the HbHRG1 gene significantly increased the plant height of white poplar and accelerated its growth.

[0106] It can be seen from the above embodiments that the present invention provides a plant height trait-related gene HbHRG1 and its recombinant vector and application. The HbHRG1 gene can increase the plant height and accelerate the growth of plants, providing a research basis and new ideas for cultivating transgenic plants related to plant height traits.

[0107] The embodiments described above are only descriptions of the preferred modes of the present invention, and are not intended to limit the scope of the present invention. Without departing from the design spirit of the present invention, various modifications and improvements made to the technical solutions of the present invention by ordinary technicians in this field should all fall within the protection scope determined by the claims of the present invention.

Claims

1. Application of overexpression of the Hevea brasiliensis HbHRG1 gene in improving the growth rate of Populus tomentosa, characterized in that: The nucleotide sequence of the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.

1.

2. Application of overexpressing the HbHRG1 gene of Hevea brasiliensis in cultivating transgenic Populus tomentosa with increased plant height, characterized in that: The nucleotide sequence of the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.

1.

3. Application of overexpressing the protein encoded by the Hevea brasiliensis HbHRG1 gene as claimed in claim 1 in improving the growth rate of Populus tomentosa, characterized in that: The amino acid sequence of the protein encoded by the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.

2.

4. Use of overexpressing the protein encoded by the HbHRG1 gene of the Hevea brasiliensis as claimed in claim 1 in cultivating transgenic Populus tomentosa with increased plant height, characterized in that: The amino acid sequence of the protein encoded by the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.

2.

5. Use of a recombinant vector comprising the Hevea brasiliensis HbHRG1 gene of claim 1 in improving the growth rate of Populus tomentosa, characterized in that: The recombinant vector is an overexpression vector.

6. Use of a recombinant vector comprising the Hevea brasiliensis HbHRG1 gene of claim 1 in cultivating transgenic Populus tomentosa with increased plant height, characterized in that: The recombinant vector is an overexpression vector.

7. Use of an engineered bacterium comprising the recombinant vector described in claim 5 or 6 in improving the growth rate of Populus tomentosa strains.

8. Use of an engineered bacterium comprising the recombinant vector according to claim 5 or 6 in cultivating transgenic Populus tomentosa with increased plant height.

9. A method for increasing the plant height of Populus tomentosa, characterized in that: The method comprises the steps of overexpressing the Hevea brasiliensis HbHRG1 gene in Populus tomentosa to increase the plant height of the Populus tomentosa; The nucleotide sequence of the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.

1.

10. A method for cultivating transgenic Populus tomentosa with increased plant height, characterized in that: The following steps are involved: Overexpressing the HbHRG1 gene in Populus tomentosa cells, then cultivating the Populus tomentosa cells, and using the Populus tomentosa cells to regenerate Populus tomentosa, thereby obtaining the transgenic Populus tomentosa with increased plant height; The nucleotide sequence of the Hevea brasiliensis HbHRG1 gene is shown in SEQ ID NO.1.

Images