Arabidopsis thaliana myosin binding protein MyoBs and application thereof

Abstract

The invention discloses arabidopsis thaliana myosin binding protein MyoBs and application thereof, and belongs to the technical field of biology. Mutant homozygous identification and screening are carried out on MyoB I (A) subfamily four members, pollen, pod length and seed phenotype of the homozygous inserted mutant are observed, it is found that flower morphology and pollen grain activity of a single mutant do not have abnormal phenotype, but the pod length of the single mutant is shorter than that of a wild type, and the single mutant has the advantages of being high in yield and high in yield. Therefore, the yield is also obviously lower than that of the wild type. According to the invention, phenotypes of short and small fruit pods and wizened seeds appear in a plant in an arabidopsis thaliana MyoBs protein single mutant, so that the importance of the MyoBs protein in a plant growth and development process is clarified, and a theoretical basis is provided for subsequent plant breeding.

Description

Technical Field

[0001] The present invention relates to the field of biotechnology, and in particular to an Arabidopsis myosin binding protein MyoBs and its application. Background Art

[0002] Arabidopsis thaliana has a small genome, a short life cycle, stable closed-flower self-pollination inheritance, and a very high mutation rate when treated with physical and chemical factors. It is a good material for genetic research and is usually used as a model plant. The cytoskeleton not only plays a supporting role in cells, but also serves as the movement track of kinases, myosins, and dyneins, and it plays a crucial role in the physiological activities of plants.

[0003] During vesicle transport, any blockage in the transport process will lead to protein accumulation, triggering a series of pathological reactions (apoptosis and phagocytosis), thus affecting the fertility and yield of plants. Currently, there is very little research on the adaptor proteins involved in the vesicle transport by the plant cytoskeleton. Therefore, the research on various adaptor proteins during vesicle transport and the clarification of the mechanism of vesicle transport are of great significance for subsequent research on animal or plant pathology.

[0004] The phylogenetic analysis results of the myosin motor domain show that there are 2,269 classes of myosins in 328 organisms. The conserved Myosin genes in mammals include 25-30 from subfamilies I to XV; however, there are 15 conserved myosin genes in plants, and only two families, Myosin-VIII and Myosin-XI, are included. The connection between myosin and organelles and other structures is not always direct contact, and in most cases, it depends on adaptor proteins. Currently, two potential myosin receptor families have been found in Arabidopsis: one is the MyoB (Myosin Binding) family consisting of 16 members; the other is the Mad family, which mainly consists of two subfamilies, Mad-A and Mad-B.

[0005] According to previous studies, Fl1 encodes a new maize protein body membrane protein with three predicted transmembrane domains and a C-terminal plant-specific domain (DUF593) of unknown function. There are obvious differences in the endosperm thickness between the fl1 mutant and the wild type. RISAP belongs to a putative myosin receptor family, contains a domain 593 of unknown function (DUF593), and binds to the tail domain of tobacco pollen tube Myosin-XI through its DUF593. High expression of RISAP blocks pollen tube growth and induces tip swelling. Current studies in Arabidopsis only propose a model of myosin receptor binding to myosin. How the myosin receptor specifically affects plant physiological activities and their growth and development is still unclear, and there is no report on the study of myosin regulating plant yield. Summary of the Invention

[0006] The object of the present invention is to provide an Arabidopsis myosin-binding protein MyoBs and its application to solve the problems existing in the above-mentioned prior art. In the single mutant of Arabidopsis MyoBs protein in the present invention, the phenotypes of short siliques and shriveled seeds appear in the plants, thus clarifying the importance of MyoBs protein in the process of plant growth and development and providing a theoretical basis for subsequent plant breeding.

[0007] To achieve the above object, the present invention provides the following solutions:

[0008] The present invention provides an application of an Arabidopsis myosin-binding protein MyoBs in regulating the yield of Arabidopsis. By reducing the expression of the Arabidopsis myosin-binding protein MyoBs, the yield of Arabidopsis is reduced;

[0009] The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

[0010] The present invention also provides a method for regulating the yield of Arabidopsis. By reducing the expression of the Arabidopsis myosin-binding protein MyoBs, the yield of Arabidopsis is reduced;

[0011] The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

[0012] The present invention also provides an application of an Arabidopsis myosin-binding protein MyoBs in shortening the silique length of Arabidopsis. The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

[0013] The present invention also provides a method for shortening the length of Arabidopsis thaliana pods, wherein the length of Arabidopsis thaliana pods is shortened by reducing the expression of Arabidopsis myosin binding protein MyoBs;

[0014] The amino acid sequence of the Arabidopsis myosin binding protein MyoBs includes one or more of the sequences shown in SEQ ID NOs. 10 to 13.

[0015] The present invention also provides an application of an Arabidopsis myosin binding protein MyoBs in reducing the number of Arabidopsis seeds. The amino acid sequence of the Arabidopsis myosin binding protein MyoBs includes one or more of the sequences shown in SEQ ID NOs. 10 to 13.

[0016] The present invention also provides a method for reducing the number of Arabidopsis seeds, which reduces the number of Arabidopsis seeds by reducing the expression of Arabidopsis myosin binding protein MyoBs;

[0017] The amino acid sequence of the Arabidopsis myosin binding protein MyoBs includes one or more of the sequences shown in SEQ ID NOs. 10 to 13.

[0018] The present invention also provides an application of an Arabidopsis myosin binding protein MyoBs in reducing the fertility of Arabidopsis seeds. The amino acid sequence of the Arabidopsis myosin binding protein MyoBs includes one or more of the sequences shown in SEQ ID NOs. 10 to 13.

[0019] The present invention also provides a method for reducing the fertility of Arabidopsis seeds, which reduces the fertility of Arabidopsis seeds by reducing the expression of Arabidopsis myosin binding protein MyoBs, thereby increasing the number of shriveled seeds in Arabidopsis seeds;

[0020] The amino acid sequence of the Arabidopsis myosin binding protein MyoBs includes one or more of the sequences shown in SEQ ID NOs. 10 to 13.

[0021] The present invention discloses the following technical effects:

[0022] The present invention identified and screened homozygous mutants of four members of the MyoB I(A) subfamily. The pollen, pod length, and seed phenotypes of the homozygous insertional mutants were observed. The findings revealed that the single mutants exhibited no abnormalities in flower morphology or pollen grain viability. However, the pods of the single mutants were shorter than those of the wild type, and the number of seeds was also less, resulting in significantly lower yields than the wild type. By demonstrating that single mutants of the Arabidopsis MyoBs protein exhibited short pods and shrunken seeds, the present invention illustrates the importance of the MyoBs protein in plant growth and development, providing a theoretical basis for subsequent plant breeding. Brief Description of the Drawings

[0023] In order to more clearly illustrate the technical solutions in the embodiments of the present invention or the prior art, the following will briefly introduce the drawings required for use in the embodiments. Obviously, the drawings in the following description are only some embodiments of the present invention. For those of ordinary skill in the art, without creative efforts, other drawings can be obtained based on these drawings.

[0024] Figure 1 Identification diagram of the DNA level of homozygous single mutants; among them, A is the pattern diagram of the mutant sites of homozygous single mutants, and B is the gel electrophoresis diagram of the amplification products for identifying homozygous mutants by the three-primer method;

[0025] Figure 2 The number of mutant bases and their sites obtained by next-generation sequencing; among them, A is the sequencing result of mutant myob1, B is the sequencing result of mutant myob4, C is the sequencing result of mutant myob5, and D is the sequencing result of mutant myob6;

[0026] Figure 3 Identification diagram of the RNA level of homozygous single mutants; among them, A is the diagram showing the positions of primers used to identify the expression levels of MyoB4 and MyoB5 mutants at the RNA level, and B is the gel electrophoresis diagram of the amplification products;

[0027] Figure 4 Relative expression levels of myob1 (A) and myob6 (B) proteins;

[0028] Figure 5 Diagrams of the flower morphology (A) and pollen viability (B) of homozygous single mutants;

[0029] Figure 6 Comparison diagram of the pod length, the number of seeds per pod, and the fertility of homozygous single mutants; among them, A is the comparison of the pod phenotypes between the wild type and the mutants, B is the statistical result of the number of seeds in the pods of the wild type and the mutants; C is the statistical result of the pod lengths of the wild type and the mutants; D is the comparison of the seed fertility between the wild type and the mutants;

[0030] Figure 7 Phenotype diagram of shriveled seeds in the pods of homozygous single mutants. Detailed Embodiments

[0031] Now, various exemplary embodiments of the present invention will be described in detail. This detailed description should not be considered as a limitation of the present invention, but rather as a more detailed description of certain aspects, characteristics, and implementation schemes of the present invention.

[0032] It should be understood that the terms described in this invention are only for describing specific embodiments and are not intended to limit the invention. Additionally, for the numerical ranges in this invention, it should be understood that each intermediate value between the upper and lower limits of the range is also specifically disclosed. Any intermediate value within any stated value or stated range, as well as each smaller range between any other stated value or intermediate value within the stated range, is also included in this invention. The upper and lower limits of these smaller ranges may be independently included or excluded from the range.

[0033] Unless otherwise specified, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which this invention pertains. Although this invention only describes preferred methods and materials, any methods and materials similar or equivalent to those described herein may also be used in the implementation or testing of this invention. All documents mentioned in this specification are incorporated by reference to disclose and describe the methods and / or materials related to the documents. In case of conflict with any incorporated document, the content of this specification shall prevail.

[0034] Without departing from the scope or spirit of this invention, various improvements and changes can be made to the specific embodiments of the specification of this invention, which are obvious to those skilled in the art. Other embodiments obtained from the specification of this invention are obvious to those skilled in the art. The specification and examples of this invention are merely exemplary.

[0035] Regarding the use of "comprising", "including", "having", "containing", etc. herein, they are all open-ended terms, meaning including but not limited to.

[0036] Example 1 Preliminary identification of T-DNA homozygous mutants at the DNA level

[0037] Since the seeds purchased from the Arashare website lost their resistance, the mutants can only be identified by the Genotying method. The specific sites and the number of inserted bases of the purchased T-DNA insertion mutants were counted according to the SALK serial numbers through the website http: / / signal.salk.edu / . The statistical results are shown in Table 1.

[0038] Table 1 Specific sites of mutants and the number of inserted bases

[0039]

[0040] After transferring the T-DNA insertion mutant plants that had grown on MS medium for 7 days to soil culture for 15 days, the DNA of four types of single mutants, namely myob1, myob4, myob5, and myob6, was extracted by the SDS method. First, the samples were amplified with two primers, RP + BP (the specific primer sequences are shown in Table 2). The amplification system was 10 μL. Meanwhile, the wild-type Col-0 was used as a negative control. The DNA samples with positive bands were selected, and the initially positive DNA samples were further identified for homozygous and heterozygous mutants by amplifying with two primers, LP and RP. Meanwhile, the wild-type Col-0 was used as a positive control. During this process, those with the same target band as the wild-type were heterozygous mutants, while those without the same band as Col-0 were homozygous mutants.

[0041] Table 2 Primers used for identifying T-DNA insertion mutants

[0042]

[0043]

[0044] The above is the identification of mutants at the DNA level. The PCR program was as follows: pre-denaturation at 95 °C for 3 min, denaturation at 95 °C for 15 s, annealing (set the annealing temperature according to the Tm temperature of the forward and reverse primers) for 15 s, extension at 72 °C for 2 min, for 32 cycles. The PCR products were electrophoresed using 1.5% agarose gel (150 V for 15 min), and the results were as Figure 1 . Through the method of identifying mutants with three primers, the homozygous insertion mutants in the four types of single mutants, myob1, myob4, myob5, and myob6, were identified. The specific number and sites of mutated bases were obtained by next-generation sequencing ( Figure 2 ).

[0045] The amino acid sequences of myob1, myob4, myob5, and myob6 before mutation were shown in SEQ ID NO.10 - 13 respectively, and the insertion sites and sequences of the inserted parts of the mutants were shown in SEQ ID NO.22 - 25.

[0046] SEQ ID NO.10 (Amino acid sequence of myob1 mutant before mutation):

[0047]

[0048] SEQ ID NO. 22 (Nucleotide sequence inserted between the coding genes of amino acids at positions 962 and 963 of the amino acid sequence shown in SEQ ID NO. 10 by the myob1 mutant):

[0049] AATGATTTACTTGTTGAGAGAGAAAAACTAATACAAGATTTAGAAGCTGAGATTGAATACTTCCGGGACCAGACCCCTCAGAAGAAGAATAAGCTAGATGTTGCAGAAAAAGTGACCGAGATGGATTCCCCTAGTGAGGGAATGAGCAACAAGATACAGAGTTGTTTAGTTGGGTTCGACGAAGAGAGATTATACATCACCAGTTGTCTGGAGAAGATTGAAAACAGAGTAAATGGCAAGGCTCATGACGATAATCTACCAGCACAAGAATCTGTTTCTGAGCTACATGAGAGAGTAGAAAGGCTGAAGGGAGACTTATACTTCCTAGAACAAGTTATGAATTGCAGCCCGGGCCGTCGACCACGCGTGCCCTATTCTGAGTCGTAA。

[0050] SEQ ID NO. 11 (Amino acid sequence before mutation of the myob4 mutant):

[0051] MDSNLIFDQKVINGFAPVLTYAACEWFLILLMFIDALLSYLLVWFARYCRLQMPCFLCSKLLHPLHWRFLLCRNHRSEVSSYMSCQNHGNNLADCRGMCDDCLLSFTKMTGPNPDMNRLLLGKLGYDLLSRSHFAHPRSCSCCNKPWRTRHHTQRLIRLGSRGRNSSSKPNIPAPRHLTRRGSGGSLKKMRDHIATSGSEYVDVGSRDGMAHVGYTELKIHSDSESEFLFSDDDAFLHITDFNVEPSEKRTHKSRRRKSFDDKKMSNHKQPVLQDNQYKKIHVEDNETVESSMLGYNLENRTRQKQPVKAKEHDDVLSELITMSEARPFLLGSPRKYAAGVVTQNENEAEVSGSSSPSGGEFLSPSAENGASREIRIQEHDDSSDFSQNITSSAMEIEEFEAAIEQKESDHMDVSGSVANEPSSDEENEVEGDSKPLISNNMSDSLEQEQSGEEESEVNENNVAEEYFSNEEEDEVNGHTEPLTSKSESGSFAEEQSSEDEDGSNIYSVAKDHSSNEEDVDNEESEPMTSNNVTGVVKEEHSAKEEHGDHEETEPLTSLNISKEEPSLEHSDKDSLKITETRNTSNGSPELKHSASVESFVSISSDIEGESLVEVLKQQLEHGRKSLRDLNKEFEEERNASAIATNQAMAMITRLQEEKAALHMEALQYLRMMDEQAEHDMDALERANDVLADREKEIQDLEMELEYYRVKYPDEPREEILASMGILGNTEETNVTSPTDETSIKDSTDTKLTGSPSAEN。

[0052] SEQ ID NO.23 (Nucleotide sequence inserted at the 5' UTR region of the gene encoding the protein shown in SEQ ID NO.11, 21 bp in length from the first exon in the myob4 mutant):

[0053] AACTCTTCTCCACGACCCGATTTTATGGAATTACCATAAGCT。

[0054] SEQ ID NO.12 (Amino acid sequence before mutation in the myob5 mutant):

[0055] MSNRSFKNFIEEELGTFPQFLIYALLEWILIIILFIDGFLAFFSNQIAKFFDLKIPCLLCTRLDHVLVSRNPDFYYNDSICDAHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKETDVDT YKSLIGILHKDLELLIDDERELQLAFPVAGSKKDENFYQVENRTNNSNDRFQRQQRCSCCGQIMKLKSDKPKSNNQSFFGAPSPSPRVSFNQRTLDLSNIKYTDLPEDDDALNTKGASLDAVDDRTPSFVKGGNKFFGIPLSDSAQNSPRWSVRSMKKSFVDQNGLESEVLDGDSILQHLNRQVRLDRKSLMDLYMELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEEMKELEAGIEVYRLRYGLLREERGEAEEFLDEETKPVSDLPVCSSNHEEDLEQMKDSAEDSIGNNGVMIIEEEKENGSRKDMLVKEISEITERLNAIESKGELLQQISDVLDVSEGEAILLQISQNLHMLRSFIEMPTES。

[0056] SEQ ID NO.24 (Nucleotide sequence inserted at the 5’UTR region of the gene encoding the protein shown in SEQ ID NO.11, 105 bp in length from the first exon in the myob5 mutant):

[0057] CAGAGGTTATTAGCTTTATTATCTAGTCCTCTATATTTGGATTGGGAAAAGAATTAATTTGACCAATAATACCTGAAATAACGG。

[0058] SEQ ID NO.13 (Amino acid sequence before mutation in the myob6 mutant):

[0059] MYIQLLCFFLFLFLLLQATMSKRSFKKFVEQELGSLPHFLIYTVLEWSLIVFLFIDGVIAFLSNQFAKFFDLNIPCLLCTRIDHILVPRDPQFYYNESICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKDSDCDTYKSLIGILHKDLELLIDDERDLPLAFKKDDNLVQTTKNLVDYKTNNIKNDSLKQHCSCCGELLKIKSEKLPKNNNSFLAPAPSPRVSHNKLSENESEFKDMDVDRTPSFVRGGNKFFGIPLSDSAQNSPRWSVRSLKKSVLNKTENASDTTDPTGESILNQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMSSELAKREEEMKELEAEFEVYREKYGCLTDQEDAREEFHKQNGNASAYDDCQETKPVSDLAVSSSNQQENGENIDQNGQSKRSEESTAENVVSADEEKGSESKEGIVKELSEITERLSTLQSNGDLLKHIADVLDVSEGEAILLQISQNLHMLRSFVAMPSESMNL (The bold positions are the 473rd and 474th amino acids).

[0060] SEQ ID NO.25 (Nucleotide sequence inserted between the coding genes of the 472nd and 473rd amino acids of the amino acid sequence shown in SEQ ID NO.13 of the myob6 mutant):

[0061] AAAGCGTGATTCATTACTAGCCCGTCGAGCATTCGGGGTCGATAGGTCTGATCCTTCCAACCCTTTTTTGTCTTGGGCTAGCTGGTGTGAACATCGGGATCTGGGAGTGAAACGCAACGAAAGGATAGTAATTGACCTTCCAGAGATCACAGAGAGACTAACTACTCTTCAATCAAATGGTGATTTATTGAAACACATTGCTGATGTTTTGGATGTTAGTGAAGGAGAAGCAATTCTATTGCAGATATCTCAGAATTTGCACCTGCTTCGTAGTTTTGTTGCTATGCCTTCTGAATCCATGAACTTGTAATACAATTTTTTTCCATTTCTTAGAGAACAAGCAAGCTGCAGCCCGGGCCGTCGACCACGCGTGCCCTATAGTGAGTCGCCAACCCCCCGCCTCCGCGTCCTTTTC CCGCCTTTCCCTAATCCGCAGATTCGTCTTCTTC。

[0062] Example 2 Detection of changes in transcription levels in single mutants at the RNA level

[0063] Extract the RNA of Arabidopsis thaliana seedlings grown on MS medium for 7 days. Reverse transcribe the four single mutants according to the RNA concentration to obtain 600 ng of cDNA. Use the reverse-transcribed cDNA as a template to amplify the fragments across the intron region (primer sequences are shown in Table 3) to identify whether the gene mutation affects the transcription process.

[0064] Table 3 Primers for identifying mutants at the RNA level

[0065]

[0066] It can be seen from Figure 3 that the expression levels of myob4 and myob5 mutants in semi-quantitative PCR are significantly lower than those of the wild type (Col-0). Since the T-DNA insertions of myob4 and myob5 are both at the 5'UTR position, and the part of the 5'UTR is not involved in the transcription process after being spliced by mature RNA, it is not appropriate to design forward and reverse primers at the 5'UTR end for real-time fluorescence quantitative PCR. Therefore, the RNA of the mutants was extracted for semi-quantitative PCR to compare the transcription between the wild type and the mutants.

[0067] It can be seen from Figure 4It can be seen that the expression levels of myob1 and myob6 mutants are significantly lower than those of the wild type (Col-0) in the results of real-time fluorescence quantitative PCR experiments.

[0068] Example 3 Identification of the flower, silique morphology and pollen viability of myob single mutants

[0069] According to the statistics of the tissue expression levels of MyoB I (A) family members on the Arabidopsis eFP-brower website, it was found that the expression levels of its family members were relatively high in pollen. Therefore, the focus of phenotypic observation in this invention was placed on flower tissues.

[0070] Sterilize the seeds of Col-0, myob1, myob4, myob5 and myob6 Arabidopsis at the same time. Put the seeds into 1.5 mL centrifuge tubes (at about the 0.1 mL position). Fill a glass beaker with 100 mL of 84 disinfectant and add 3 mL of concentrated hydrochloric acid. Immediately place it in a sealed and dry glass jar for 4 h. After sterilization, add 1 mL of sterilized ddH2O to each centrifuge tube in a laminar flow hood. After vernalization at 4 °C for 2 d, sow them on MS solid medium. Place them in the plant room for 6 d and then transfer them to soil culture. After culturing under long-day light conditions for 30 d, collect their flowers and pollen, and observe the flower morphology and identify the pollen viability by I2-KI staining method (see Figure 5 ). It can be seen from Figure 5 that there are no abnormal phenotypes in the flower morphology and pollen grain viability of the single mutants.

[0071] Statistical analysis was performed on the silique length and seed number of Arabidopsis after 45 d of soil culture. The results showed that the siliques of the single mutants were generally shorter than those of the wild type, and the number of seeds in each silique of the single mutants was significantly less than that of the wild type (see A in Figure 6 ), and the seed fertility of the mutants also differed significantly from that of the wild type (see B-D in Figure 6 ). Importantly, it was found that more than 50% of the siliques produced by each single mutant plant showed the phenomenon of shriveled seeds (see Figure 7 ).

[0072] The above-described embodiments are only descriptions of the preferred embodiments of the present invention, and do not limit the scope of the present invention. Without departing from the design spirit of the present invention, various deformations and improvements made by those of ordinary skill in the art to the technical solutions of the present invention should fall within the protection scope determined by the claims of the present invention.

Claims

1. Use of Arabidopsis myosin binding protein MyoBs in regulating the yield of Arabidopsis, characterized in that, By reducing the expression of Arabidopsis myosin-binding protein MyoBs, the yield of Arabidopsis is reduced; The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

2. A method for regulating the yield of Arabidopsis thaliana, characterized in that, By reducing the expression of Arabidopsis myosin-binding protein MyoBs, the yield of Arabidopsis is reduced; The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

3. Application of Arabidopsis myosin-binding protein MyoBs in shortening the length of Arabidopsis fruit pods, characterized in that, The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

4. A method for shortening the silique length of Arabidopsis thaliana, characterized in that, By reducing the expression of Arabidopsis myosin-binding protein MyoBs, the length of Arabidopsis siliques is shortened; The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

5. Use of Arabidopsis myosin binding protein MyoBs in reducing the number of Arabidopsis seeds, characterized in that, The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

6. A method for reducing the number of Arabidopsis thaliana seeds, characterized in that, By reducing the expression of Arabidopsis myosin-binding protein MyoBs, the number of Arabidopsis seeds is reduced; The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

7. Use of Arabidopsis myosin binding protein MyoBs in reducing the fertility of Arabidopsis seeds, characterized in that, The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

8. A method for reducing the fertility of Arabidopsis thaliana seeds, characterized in that, By reducing the expression of Arabidopsis myosin-binding protein MyoBs, the number of shriveled seeds in Arabidopsis seeds is increased, reducing the fertility of Arabidopsis seeds; The amino acid sequence of the Arabidopsis myosin-binding protein MyoBs includes one or several of the sequences shown in SEQ ID NO.10-13.

Images