RNA (Ribonucleic Acid) binding protein and function and application of coding gene of RNA binding protein in plant immunity

Abstract

The invention provides RNA (Ribonucleic Acid) binding protein and a function and application of a coding gene thereof in plant immunity. The invention provides application of RNA binding protein or related biological materials thereof. The application comprises at least one of the following steps: regulating and controlling plant disease resistance; the resistance of plants to pathogenic bacteria is regulated and controlled; the RNA binding protein is a protein with an amino acid sequence as shown in SEQ ID No. 1 or 3. By overexpressing the coding gene of the RNA binding protein, the disease resistance of plants can be improved.

Description

TECHNICAL FIELD

[0001] The present application relates to the field of biotechnology, in particular, the present application relates to the function and application of RNA binding protein and its encoding gene in plant immunity. BACKGROUND

[0002] Many plant pathogens invade plants through stomata, causing serious plant diseases, affecting the yield and quality of crops, and exploring plant disease resistance genes and promoting plant resistance to pathogens is an important way to cultivate disease-resistant varieties and realize green control of plant diseases and insect pests. Arabidopsis thaliana is a model plant for plant biology research, including disease resistance research, at home and abroad, belonging to the Cruciferae of dicotyledon class. In-depth study of the function of Arabidopsis thaliana gene helps to identify important disease resistance genes and provide key basis for improving crop resistance. Solanum lycopersicum belongs to Solanaceae crops, and has high nutritional value, which is an important vegetable and fruit crop in China. Enhancing the disease resistance of Solanum lycopersicum to pathogenic bacteria helps to improve the yield and quality of Solanum lycopersicum.

[0003] Stomata are the main channel for most pathogenic bacteria and some fungi to invade plants, and plants can close stomata to limit the invasion of pathogens in response to pathogens, which is called stomatal immunity. Therefore, identifying disease resistance genes in stomatal immunity helps to achieve resistance to pathogens at the first line of defense, and effectively control plant diseases. Identifying new stomatal immunity genes and introducing them into target plants can improve the resistance of plants to pathogens at the stomatal level, which is of great significance for crop disease resistance breeding. SUMMARY

[0004] The present application aims to at least solve one of the technical problems in the prior art. The present application provides an RNA binding protein that can improve the disease resistance of plants, especially the stomatal immunity disease resistance, and the nucleic acid molecule or recombinant expression vector or transformant expressing the RNA binding protein can significantly improve the disease resistance of plants after being introduced into the plants.

[0005] Therefore, in the first aspect of the present application, the present application provides the application of RNA binding protein or its related biological material, and the application has at least one of the following: regulating the disease resistance of plants; regulating the resistance of plants to pathogens; The RNA binding protein is any of the following: (A1) the protein with the amino acid sequence shown in SEQ ID No. 1; MAEAKEENREKNEEEESVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYADGELERLEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAMESINGKHKMEGSTVPLVVKWADTERERHTRRLQKAQSHIARLGNGDPTNPSLFGALPMGYVPPYNGYGYHQPPGTYGYMLPPIQNQAAFSNMIAQPNQGNNNALQGTSPDSVPPRLARRNFPMPPGNYMGSGYPAMRGHPFPFAYPRGIVSPRPLSSSPGSISPGMSTPLGIGLSSVVQTEGPEGANLFIYNIPREFGDQELAAAFQSFGIVLSAKVFVDKATGVSKCFGFVSYDSQAAAQNAIDMMNGRHLGGKKLKVQLKRDSNNGQPSSNPSLIS (SEQ ID No. 1) (A2) a protein whose amino acid sequence is shown in SEQ ID No. 3; MAELQREEERQEEEQQSEESVKLFVGQVPKHMTESQLVEMFQEFAIVDEVNIIKDKTTRASRGCCFVICPSREEADKAVNACHNKKTLSGASSPLQVKYADGELERLEHKLFVGMLPKNVSDPEVSALFSQYGVIKDLQILRGSQQTSKGCAFLKYEKKEQAVAAIDALHGKHKMEGATVPLVVKWADTEKERQARRAQKSLSHASDSRQHPSLFGALPMGYMPPYNGYGYQTPGAYGLMQYRLPSMQNQSAFQNIVPPINQASALRGGAPDLSPGISPRNYAMSPGSYGSAYPAVPGIQYSMPYPGGVMNTRPPSGSPGSIPPSTTNSHSAASSSVSSSTGGQVEGPPGANLFIYHIPQEFGDQELANAFQPFGRVLSAKVFVDKATGVSKCFGFVSYDSTAAAQTAISMMNGCQLGSKKLKVQLKRDNKQNKHY (SEQ ID No. 3) (A3) a protein having the same function as that derived from Arabidopsis thaliana, with an amino acid sequence shown in SEQ ID No. 1, which has one or more substitutions and / or deletions and / or additions of amino acid residues; (A4) a protein having the same function as that derived from Solanum lycopersicum, with an amino acid sequence shown in SEQ ID No. 3, which has one or more substitutions and / or deletions and / or additions of amino acid residues; (A5) a protein having the same function as that derived from Arabidopsis thaliana, with an amino acid sequence having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A1) or (A3); (A6) a protein having the same function as that derived from Solanum lycopersicum, with an amino acid sequence having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A2) or (A4).

[0006] In some embodiments of the present application, the RNA-binding protein can be a protein having an amino acid sequence shown in SEQ ID No. 1, derived from Arabidopsis thaliana, named AtSAIR1.

[0007] In some embodiments of the present application, the RNA-binding protein can be a protein having an amino acid sequence shown in SEQ ID No. 3, derived from Solanum lycopersicum, named SlSAIR1.

[0008] Those skilled in the art can easily mutate the amino acid sequence of the RNA-binding protein of the present application by using known methods, such as directed evolution and point mutation. Those artificially modified amino acids having 75% or more identity to the amino acid sequence of the RNA-binding protein of the present application, as long as the protein is functionally equivalent to the RNA-binding protein, are derived from the amino acid sequence of the present application and equivalent to the sequence of the present application.

[0009] In the above-mentioned proteins, the 95% or more identity can be at least 96%, 97%, 98% identity. The 90% or more identity can be at least 91%, 92%, 93%, 94% identity. The 85% or more identity can be at least 86%, 87%, 88%, 89% identity. The 80% or more homology can be at least 81%, 82%, 83%, 84% identity. The 75% or more homology can be at least 76%, 77%, 78%, 79% identity.

[0010] The "protein having the same function as the amino acid sequence defined in (A1) or (A3)" as referred to herein means that the target protein has the same or similar biological function and physiological and biochemical characteristics as the protein shown in (A1) or (A3) of the present application. The typical biological function of the protein shown in (A1) or (A3) is to improve the immune resistance or disease resistance of a plant. By up-regulating the expression amount and / or activity of the (A1) or (A3) protein, the disease resistance of a plant can be improved.

[0011] In some embodiments of the present application, the relevant biological material is a nucleic acid molecule capable of expressing the RNA-binding protein (AtSAIR1 protein, SlSAIR1 protein), or an expression cassette, a recombinant expression vector, a recombinant microorganism, or a transgenic cell line containing the nucleic acid molecule.

[0012] A recombinant expression vector containing the AtSAIR1 gene and / or SlSAIR1 gene expression cassette is constructed. The plant expression vector used can be an Agrobacterium binary vector or a Gateway system vector, such as pBin438, pCAMBIA1302, pCAMBIA2301, pCAMBIA1301, pCAMBIA1300, pBI121, pGWB411, pGWB412, pGWB405, pCAMBIA1391-Xa, or pCAMBIA1391-Xb. The AtSAIR1 and / or SlSAIR1 When constructing the recombinant expression vector, any one of the enhanced, constitutive, tissue-specific, or inducible promoters can be added before the transcription initiation nucleotide, such as the cauliflower mosaic virus (CAMV) 35S promoter, the ubiquitin gene Ubiqutin promoter (pUbi), etc., which can be used alone or in combination with other plant promoters; in addition, when constructing the plant expression vector using the gene of the present application, enhancers, including translation enhancers or transcription enhancers, can also be used, and these enhancer regions can be the ATG start codon or the adjacent region start codon, etc., but must be the same reading frame as the coding sequence to ensure correct translation of the entire sequence. The source of the translation control signal and the start codon is wide, and can be natural or synthetic. The translation initiation region can be from the transcription initiation region or the structural gene.

[0013] In order to facilitate the identification and screening of transgenic plant cells or plants, the plant expression vector used can be processed, such as adding a gene that can express an enzyme or a luminescent compound that can produce a color change (GUS gene, luciferase gene, etc.), a resistant antibiotic marker (gentamicin marker, kanamycin marker, etc.), or an anti-chemical reagent marker gene (such as an anti-herbicide gene).

[0014] In the above application, the vector can be a plasmid, cosmid, bacteriophage or viral vector.

[0015] In the above application, the microorganism can be yeast, bacteria, algae or fungi. The bacteria can be from Escherichia, Erwinia, Agrobacterium (such as Agrobacterium tumefaciens EHA105), Flavobacterium, Alcaligenes, Pseudomonas, Bacillus, etc.

[0016] In some embodiments of the present application, the gene encoding the RNA binding protein is any one of the following: (B1) the nucleotide sequence is a DNA molecule shown in SEQ ID No. 2; (B2) a nucleotide sequence is a DNA molecule as shown in SEQ ID No. 4; (B3) hybridizes with the DNA molecule defined in (B1) and encodes a DNA molecule which encodes a protein having the same function as that derived from Arabidopsis thaliana; (B4) hybridizes with the DNA molecule defined in (B2) and encodes a DNA molecule which encodes a protein having the same function as that derived from Solanum lycopersicum; (B5) has at least 80% identity with the nucleotide sequence defined in (B1) or (B3) and encodes a DNA molecule which encodes a protein having the same function as that derived from Arabidopsis thaliana.

[0017] (B6) has at least 80% identity with the nucleotide sequence defined in (B2) or (B4) and encodes a DNA molecule which encodes a protein having the same function as that derived from Solanum lycopersicum.

[0018] In some embodiments of the present application, in the plant, the expression amount and / or activity of the RNA binding protein is increased, the disease resistance of the plant is enhanced, the resistance of the plant to the pathogenic bacteria is enhanced; and / or in the plant, the expression amount and / or activity of the RNA binding protein is decreased, the disease resistance of the plant is weakened, the resistance of the plant to the pathogenic bacteria is weakened.

[0019] In some embodiments of the present application, the plant includes but is not limited to at least one of Arabidopsis thaliana, Solanum lycopersicum, Glycine max, Oryza sativa, Nicotiana benthamiana.

[0020] In some embodiments of the present application, the pathogenic bacteria includes but is not limited to at least one of Pseudomonas syringae, Xanthomonas campestris.

[0021] In a second aspect of the present application, the present application provides an application of a substance capable of increasing the expression amount and / or activity of an RNA binding protein in a plant, the application including at least one of the following: enhancing the disease resistance of the plant; enhancing the resistance of the plant to pathogenic bacteria; The RNA binding protein is any one of the following: (A1) a protein having the amino acid sequence shown in SEQ ID No. 1; (A2) a protein having the amino acid sequence shown in SEQ ID No. 3; (A3) a protein having the amino acid sequence shown in SEQ ID No. 1 after substitution and / or deletion and / or addition of one or more amino acid residues and having the same function as that derived from Arabidopsis thaliana; (A4) a protein having the amino acid sequence shown in SEQ ID No. 3 after substitution and / or deletion and / or addition of one or more amino acid residues and having the same function as that derived from Solanum lycopersicum; (A5) a protein having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A1) or (A3) and having the same function as that derived from Arabidopsis thaliana; (A6) a protein having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A2) or (A4) and having the same function as that derived from Solanum lycopersicum.

[0022] In some embodiments of the present application, the RNA-binding protein can be a protein having an amino acid sequence shown in SEQ ID No. 1, derived from Arabidopsis thaliana, and named AtSAIR1.

[0023] In some embodiments of the present application, the RNA-binding protein can be a protein having an amino acid sequence shown in SEQ ID No. 3, derived from Solanum lycopersicum, and named SlSAIR1.

[0024] In some embodiments of the present application, the plant includes, but is not limited to, at least one of Arabidopsis thaliana, Solanum lycopersicum, Glycine max, Oryza sativa, and Nicotiana benthamiana.

[0025] In some embodiments of the present application, the pathogenic bacteria include, but are not limited to, at least one of Pseudomonas syringae and Xanthomonas campestris.

[0026] In a third aspect of the present application, the present application provides an application of a substance capable of reducing the expression amount and / or activity of an RNA-binding protein in a plant, and the application includes at least one of the following: reducing the disease resistance of a plant; reducing the resistance of a plant to pathogenic bacteria; The RNA-binding protein is any one of: (A1) a protein having an amino acid sequence shown in SEQ ID No. 1; (A2) a protein having an amino acid sequence shown in SEQ ID No. 3; (A3) a protein having the same function as that derived from Arabidopsis thaliana, with substitution and / or deletion and / or addition of one or more amino acid residues in the amino acid sequence shown in SEQ ID No. 1; (A4) a protein having the same function as that derived from Solanum lycopersicum, with substitution and / or deletion and / or addition of one or more amino acid residues in the amino acid sequence shown in SEQ ID No. 3; (A5) a protein having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A1) or (A3) and having the same function as that derived from Arabidopsis thaliana; (A6) a protein having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A2) or (A4) and having the same function as derived from Solanum lycopersicum.

[0027] In some embodiments of the present application, the RNA-binding protein can be a protein having an amino acid sequence shown in SEQ ID No. 1, derived from Arabidopsis thaliana, and named as AtSAIR1.

[0028] In some embodiments of the present application, the RNA-binding protein can be a protein having an amino acid sequence shown in SEQ ID No. 3, derived from Solanum lycopersicum, and named as SlSAIR1.

[0029] In some embodiments of the present application, the plant includes, but is not limited to, at least one of Arabidopsis thaliana, Solanum lycopersicum, Glycine max, Oryza sativa, and Nicotiana benthamiana.

[0030] In some embodiments of the present application, the pathogenic bacteria include, but are not limited to, at least one of Pseudomonas syringae and Xanthomonas campestris.

[0031] In a fourth aspect of the present application, a method for improving the disease resistance of a plant or the resistance of a plant to pathogenic bacteria is provided. According to embodiments of the present application, the method includes: increasing the expression amount and / or activity of an RNA-binding protein in a recipient plant; The RNA-binding protein is any one of: (A1) a protein having an amino acid sequence shown in SEQ ID No. 1; (A2) a protein having an amino acid sequence shown in SEQ ID No. 3; (A3) a protein having the same function as derived from Arabidopsis thaliana and having the amino acid sequence shown in SEQ ID No. 1 after substitution and / or deletion and / or addition of one or more amino acid residues; (A4) a protein having the same function as derived from Solanum lycopersicum and having the amino acid sequence shown in SEQ ID No. 3 after substitution and / or deletion and / or addition of one or more amino acid residues; (A5) a protein having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A1) or (A3) and having the same function as derived from Arabidopsis thaliana; (A6) a protein having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A2) or (A4) and having the same function as derived from Solanum lycopersicum.

[0032] The method can be achieved by hybridization means or by transgenic means.

[0033] In some embodiments of the present application, the RNA binding protein can be a protein with an amino acid sequence shown in SEQ ID No. 1, from Arabidopsis thaliana, named AtSAIR1.

[0034] In some embodiments of the present application, the RNA binding protein can be a protein with an amino acid sequence shown in SEQ ID No. 3, from Solanum lycopersicum, named SlSAIR1.

[0035] In some embodiments of the present application, the plant includes but is not limited to at least one of Arabidopsis thaliana, Solanum lycopersicum, Glycine max, Oryza sativa, Nicotiana benthamiana.

[0036] In some embodiments of the present application, the pathogenic bacteria include but are not limited to at least one of Pseudomonas syringae, Xanthomonas campestris.

[0037] In a fifth aspect, the present application provides a method for breeding a disease-resistant transgenic plant. According to embodiments of the present application, the method includes: introducing a nucleic acid molecule capable of expressing an RNA binding protein into a recipient plant to obtain a transgenic plant: The RNA binding protein is any one of: (A1) a protein with an amino acid sequence shown in SEQ ID No. 1; (A2) a protein with an amino acid sequence shown in SEQ ID No. 3; (A3) a protein with an amino acid sequence shown in SEQ ID No. 1, which has one or more substitutions, deletions and / or additions of amino acid residues and is derived from Arabidopsis thaliana and has the same function; (A4) a protein with an amino acid sequence shown in SEQ ID No. 3, which has one or more substitutions, deletions and / or additions of amino acid residues and is derived from Solanum lycopersicum and has the same function; (A5) a protein with an amino acid sequence having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A1) or (A3) and is derived from Arabidopsis thaliana and has the same function; (A6) a protein with an amino acid sequence having 99% or more, 95% or more, 90% or more, 85% or more, 80% or more, or 75% or more identity to the amino acid sequence defined in (A2) or (A4) and is derived from Solanum lycopersicum and has the same function.

[0038] In some embodiments of the present application, the nucleic acid molecule capable of expressing an RNA binding protein is introduced into the recipient plant in the form of a recombinant vector.

[0039] In the above method, the recombinant vector (for overexpression) is introduced into the recipient plant, which can be specifically achieved by using a Ti plasmid, a Ri plasmid, a plant viral vector, direct DNA transformation, microinjection, electroporation, Agrobacterium-mediated transformation, and other conventional biological methods to transform plant cells or tissues, and the transformed plant tissues are cultivated into plants.

[0040] In the above method, the transgenic plant is understood to include not only the first generation to the second generation transgenic plant, but also its offspring. For the transgenic plant, the gene can be propagated in the species, or the gene can be transferred into other varieties of the same species, especially commercial varieties, by using conventional breeding techniques. The transgenic plant includes seeds, callus, whole plants, and cells.

[0041] In the above aspects, the nucleic acid molecule can be DNA, such as cDNA, genomic DNA, or recombinant DNA; or the nucleic acid molecule can be RNA, such as mRNA, etc.

[0042] In some embodiments of the present application, the nucleic acid molecule capable of expressing the RNA binding protein can be any one of the following: (B1) a DNA molecule having the nucleotide sequence shown in SEQ ID No. 2; (B2) a DNA molecule having the nucleotide sequence shown in SEQ ID No. 4; (B3) a DNA molecule hybridizing with the DNA molecule defined in (B1) and encoding a protein having the same function as AtSAIR1 from Arabidopsis thaliana; (B4) a DNA molecule hybridizing with the DNA molecule defined in (B2) and encoding a protein having the same function as SlSAIR1 from Solanum lycopersicum; (B5) a DNA molecule having at least 80% identity with the nucleotide sequence defined in (B1) or (B3) and encoding a protein having the same function as AtSAIR1 from Arabidopsis thaliana.

[0043] (B6) a DNA molecule having at least 80% identity with the nucleotide sequence defined in (B2) or (B4) and encoding a protein having the same function as SlSAIR1 from Solanum lycopersicum.

[0044] In some embodiments of the present application, the RNA binding protein can be a protein having the amino acid sequence shown in SEQ ID No. 1, from Arabidopsis thaliana, named AtSAIR1.

[0045] In some embodiments of the present application, the RNA binding protein can be a protein having the amino acid sequence shown in SEQ ID No. 3, from Solanum lycopersicum, named SlSAIR1.

[0046] In some embodiments of the present invention, the plant includes, but is not limited to, at least one of Arabidopsis thaliana, tomato, soybean, rice, and native tobacco.

[0047] Beneficial effects: The inventors accidentally discovered during experiments that the virus originated from Arabidopsis thaliana. AtSAIR1 Genes and those derived from tomatoes SlSAIR1 Genes are related to a plant's disease resistance and resistance to pathogenic bacteria. Therefore, the inventors cloned genes in Arabidopsis thaliana and tomato plants, respectively. AtSAIR1 Genes and SlSAIR1 Genes, research confirms AtSAIR1 Genes and SlSAIR1 Genes play a positive regulatory role in plant disease resistance responses, and overexpression of both genes can significantly improve plant disease resistance. The gene obtained in this invention originates from the plant itself and is relatively conserved in plants, enabling stable inheritance of resistance. This invention demonstrates potential application value in enhancing plant disease resistance through molecular breeding using genetic engineering techniques.

[0048] Additional aspects and advantages of the invention will be set forth in part in the description which follows, and in part will be obvious from the description, or may be learned by practice of the invention. Attached Figure Description

[0049] The above and / or additional aspects and advantages of the present invention will become apparent and readily understood from the description of the embodiments taken in conjunction with the following drawings, in which: Figure 1 As in Embodiment 2 of the present invention pCambia 1300-AtSAIR1 Carrier spectrum; Figure 2 In Embodiment 2 of the present invention AtSAIR1 Overexpression in plants AtSAIR 1. Detection of mRNA levels of gene 1, with the internal reference gene being... Actin2 Results are expressed as mean ± standard deviation, with each point representing a biological replicate. Col-0 represents the wild-type plant. sair1-1 The plants are mutants. OX1 and OX2 are two transgenic plants that overexpress OX1, with OX1 having a higher overexpression level and OX2 having a slightly lower overexpression level. Figure 3 In Embodiment 3 of the present invention sair1 mutants and SAIR1 Phenotypic analysis of overexpression plants; among which, A represents the spraying of pathogens. Pst DC3000 (OD) 600nm =0.2) After the pathogen was treated, the bacterial growth on the leaves of plants of each genotype was measured. Samples were taken and tested 3 days after the pathogen was treated. The results are expressed as mean ± standard deviation, and each point represents a biological replicate. B and C represent the LUC imaging results (B) and numerical quantitative statistics (C) of the pathogen invasion experiment. Leaves from the genotype plants shown in the figure were removed and immersed in water after the stomata were opened. Psm In ES4326-lux bacteria (OD) 600nm =0.5) One hour later, LUC imaging observation was performed, and numerical quantitative statistics were conducted; Figure 4 In Embodiment 3 of the present invention AtSAIR1 Evolutionary conservation analysis was conducted on common economic crops such as tobacco, tomato, rice, and soybean, showing... SAIR1 Evolutionary conservation; Figure 5 This refers to the knockdown of tomatoes in Example 4 of the present invention. SAIR1 Phenotypic analysis of plants after expression; among which, A is knocking down the tomato. SAIR1 Detection of gene expression levels; B represents spraying pathogens. Pst DC3000 (OD) 600nm =0.2) After treatment with pathogens, the bacterial growth on the leaves of plants of each genotype was measured. Samples were taken and tested 3 days after treatment. The results are expressed as mean ± standard deviation. C represents the phenotype of tomato leaves after spraying with the pathogen; Figure 6 In Embodiment 5 of the present invention AtSAIR1 The phase separation of the anti-disease gene translation-promoting effect; among them, A is induced by pathogens. AtSAIR1 The formation of aggregates in guard cells, and the effect of truncating IDR2. AtSAIR1 It cannot form aggregates; B represents the loss of the ability to promote the translation of disease-fighting genes by SAIR1ΔIDR2, which cannot form aggregates (SAIR1ΔIDR2 is AtSAIR1 of the truncated disordered region IDR2 of the protein, and IDR2 is amino acids 314-349 located in AtSAIR1). Detailed Implementation

[0050] The embodiments of the present invention are described in detail below. The embodiments described below are exemplary and are only used to explain the present invention, and should not be construed as limiting the present invention.

[0051] In this document, the term "embodiment" means that a particular feature, structure, or characteristic described in connection with an embodiment may be included in at least one embodiment of this application. The appearance of this phrase in various places throughout the specification does not necessarily refer to the same embodiment, nor is it a separate or alternative embodiment mutually exclusive with other embodiments. It will be explicitly and implicitly understood by those skilled in the art that the embodiments described herein can be combined with other embodiments.

[0052] For the sake of brevity, only some numerical ranges are specifically disclosed herein. However, any lower limit can be combined with any upper limit to form a range not explicitly recited; and any lower limit can be combined with any other lower limit to form a range not explicitly recited, and the same applies to any upper limit, which can be combined with any other upper limit to form a range not explicitly recited. Further, each individual disclosed point or single numerical value can be combined with any other point or single numerical value to form a range not explicitly recited, either as a lower or upper limit, or in combination with other lower or upper limits.

[0053] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this application belongs; the terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting of this application; the description and claims of this application as well as the above abstract are intended to be construed in accordance with the terms of the patent laws of the United States and not according to the terms of the patent laws of any other country, including but not limited to the terms of the patent laws of the European Patent Convention, the Patent Cooperation Treaty, the Japanese Patent Law and the Korean Patent Law.

[0054] In this document, the terms "comprising" or "including" are to be construed as open-ended terms, i.e., meaning "including, but not limited to," as contrasted to "consisting essentially of" or "consisting of."

[0055] In this document, the terms "optional", "optionally" or "optional" generally mean that the subsequently described event or circumstance can or can not occur, and that the description includes instances where the event or circumstance occurs and instances where it does not.

[0056] In this document, the term "expression cassette" refers to DNA capable of expressing an RNA-binding protein (AtSAIR1 protein or SlSAIR1 protein) in a host cell, which can include not only a promoter for initiating transcription of a gene AtSAIR1 gene or SlSAIR1 a promoter for initiating transcription of a gene AtSAIR1 gene or SlSAIR1terminator. Further, the expression cassette can also include an enhancer sequence. Promoters useful in the present application include, but are not limited to, constitutive promoters, tissue-, organ-, and development-specific promoters, and inducible promoters. Examples of promoters include, but are not limited to, the ubiquitin promoter (pUbi); the constitutive promoter 35S of the cauliflower mosaic virus; the wound-inducible promoter from tomato, leucine aminopeptidase ("LAP", Chao et al. (1999) Plant Physiol 120:979-992); the chemically-inducible promoter from tobacco, pathogenesis-related 1 (PR1) (induced by salicylic acid and BTH (benzothiadiazole-7-thiohydroxy acid S-methyl ester)); the tomato protease inhibitor II promoter (PIN2) or the LAP promoter (both inducible by jasmonate acid methyl ester); the heat shock promoter (U.S. Patent 5,187,267); the tetracycline-inducible promoter (U.S. Patent 5,057,422); seed-specific promoters, such as the millet seed-specific promoter pF128 (CN101063139B (Chinese Patent 2007 1 0099169.7)), seed storage protein-specific promoters (e.g., the promoters for phaseolin, napin, oleosin, and soybean beta conglycin (Beachy et al. (1985) EMBO J. 4:3047-3053)). They can be used alone or in combination with other plant promoters. All references cited herein are incorporated in their entirety. Suitable transcription terminators include, but are not limited to, the Agrobacterium nopaline synthase terminator (NOS terminator), the cauliflower mosaic virus CaMV 35S terminator, the tml terminator, the pea rbcS E9 terminator, and the nopaline synthase and octopine synthase terminators (see, e.g., Odell et al. (1985) Nature 313:810; Rosenberg et al. (1987) Gene, 56:125; Guerineau et al. (1991) Mol. Gen. Genet, 262:141; Proudfoot (1991) Cell, 64:671; Sanfacon et al. Genes Dev., 5:141; Mogen et al. (1990) Plant Cell, 2:1261; Munroe et al. (1990) Gene, 91:151; Ballad et al. (1989) Nucleic Acids Res. 17:7891; Joshi et al. (1987) Nucleic Acid Res., 15:9627).

[0057] In the present context, the term "identity" when used to describe an amino acid sequence or a nucleic acid sequence relative to a reference sequence is determined by the percent of identical amino acids or nucleotides between two amino acid sequences or nucleic acid sequences by conventional methods, for example, see, Ausubel et al., eds. (1995) Current Protocols in Molecular Biology, Chapter 19 (Greene Publishing and Wiley-Interscience, New York); and the ALIGN program (Dayhoff (1978) Atlas of Protein Sequence and Structure 5: Suppl. 3 (National Biomedical Research Foundation, Washington, D.C.). There are a number of algorithms that can be used to align sequences and determine sequence identity, including the homology alignment algorithm of Needleman et al. (1970) J. Mol. Biol. 48:443; the local homology algorithm of Smith et al. (1981) Adv. Appl. Math. 2:482; the search for similarity method of Pearson et al. (1988) Proc. Natl. Acad. Sci. 85:2444; the Smith-Waterman algorithm (Meth. Mol. Biol. 70:173-187 (1997); and the BLAST family of algorithms (see Altschul et al. (1990) J. Mol. Biol. 215:403-410). Computer programs are available that use these algorithms to perform the comparisons, including, but not limited to: ALIGN or Megalign (DNASTAR) software, or WU-BLAST-2 (Altschul et al., Meth. Enzym., 266:460-480 (1996)); or GAP, BESTFIT, BLAST Altschul et al., supra, FASTA, and TFASTA, available in the Genetics Computing Group (GCG) package, Version 8, Madison, Wisconsin, USA; and CLUSTAL in the PC / Gene program from Intelligenetics, Mountain View, California.

[0058] Examples of the present application are described in detail below. The examples described below are illustrative only and are not intended to be limiting on the present application. Unless otherwise indicated, the techniques or conditions described in the examples are not limiting on the present application. The examples are not intended to be all-inclusive in terms of methods of their practice or scope of their application. Unless otherwise indicated, the reagents or instruments used in the examples are conventional products available commercially.

[0059] Example 1: Cloning of AtSAIR1 and SlSAIR1 genes 1) Cloning of AtSAIR1 gene Total RNA was extracted from seedlings of Arabidopsis thaliana Columbia-0 wild type plants using RNA extraction kit (purchased from Novagen, RNA-easy Isolation Reagent) and RNA reverse transcription kit (purchased from abm, All-In-One 5xRT MasterMix, Cat. No. G592) and cDNA was obtained by reverse transcription.

[0060] The cDNA obtained above was used as a template for PCR amplification with forward primer 1: CTACAAATCTATCTCTCTCGAGGTACCATGGCGGAAGCGAAGGAGG (SEQ ID No. 5) and reverse primer 2: CTCCGACCGGTGCACTAGTGTCGACGGAGATTAAGGAAGGATTAC (SEQ ID No. 6), and a DNA band of about 1.3 kb was obtained. The PCR product obtained was sequenced and confirmed to be the nucleotide sequence of SEQ No. 2, i.e. AtSAIR1, and the protein sequence encoded by the gene is the amino acid sequence of SEQ No. 1.

[0061] 2) Cloning of SlSAIR1 gene Total RNA was extracted from tomato plants using a similar method as in 1) and cDNA was obtained by reverse transcription.

[0062] The cDNA obtained above was used as a template for PCR amplification with forward primer 1: CTCTCTCGAGGTACCTCTAGAATGGCGGAGTTGCAGAG (SEQ ID No. 7) and reverse primer 2: cgcgtacgagatctgGAATTCATAATGTTTATTCTGTTTGTTGTCCC (SEQ ID No. 8), and a DNA band of about 1.3 kb was obtained. The PCR product obtained was sequenced and confirmed to be the nucleotide sequence of SEQ No. 4, i.e. SlSAIR1, and the protein sequence encoded by the gene is the amino acid sequence of SEQ No. 3.

[0063] Example 2: Construction of overexpression AtSAIR1 Arabidopsis plant 1) Overexpression vector pCambia 1300-AtSAIR1 Construction The PCR product in Example 1 was ligated with the Kpnl and Sail enzyme-digested pCAMBIA 1300.1 vector using the ClonExpress II One Step Cloning Kit from Novagen to configure a seamless cloning ligation reaction system, and a ligation product was obtained. The ligation product was transformed into DH5a E. coli competent cells, and positive clones were screened on LB plates containing kanamycin. pCambia 1300 The bacterial liquid of the positive clone was extracted for plasmid, and sequencing was performed. The sequencing results were compared with the sequence on the recombinant vector, and it was confirmed that the results were correct. The plasmid was named pCAMBIA 1300.1-AtSAIR1, and the schematic diagram of its structure is shown in

[0064] pCambia 1300-AtSAIR1 Figure 1

[0065] The pCAMBIA 1300.1-AtSAIR1 plasmid was transformed into GV3101 Agrobacterium competent cells by electroporation, and positive clones were screened on double-antibiotic LB plates containing kanamycin / chloramphenicol. The positive clones were picked for colony PCR verification, and the correct Agrobacterium could be used for genetic transformation of Arabidopsis. pCambia 1300-AtSAIR1 2) Obtaining overexpression

[0066] Arabidopsis AtSAIR1 2a) Arabidopsis floral dip infection: the correct Agrobacterium monoclonal was picked into 1 mL of liquid LB containing the corresponding resistance and shaken overnight, then transferred to 4 mL of liquid LB and shaken for 12 h. 1 mL of bacterial liquid was shaken in 100 mL of liquid LB containing the corresponding resistance overnight, and the bacterial cells were collected around 10 am the next day, and the OD value was adjusted to 1.0 with the floral dip infection liquid. The Arabidopsis inflorescences were immersed in the floral dip infection liquid for about 10 s, then taken out, placed in the dark, covered with a plastic cover to keep the humidity for 24 h, and then the Arabidopsis was placed in normal conditions for culture; about 10 days later, secondary infection was performed for continuous culture until the seeds matured, and the T1 generation of Arabidopsis seeds was harvested for screening. 600nm

[0067] ​​​​​2b) Screening of transgenic seedlings: After sterilizing T1 generation seeds, they were evenly spread on 1 / 2 MS medium containing hygromycin resistance with sterile water. After incubation for 10-14 days, resistant transgenic plants were observed to have grown longer roots and true leaves. Positive plants were transferred to soil for further cultivation. After the plants reached a suitable size, real-time quantitative PCR and protein level detection were performed for identification. For real-time quantitative PCR, the primer pair used was primer 1: AGCTATGACTCACAAGCCGC (SEQ ID No. 9), primer 2: TGGCCATTGTTGCTGTCTCT (SEQ ID No. 10), and the overexpression level was analyzed.

[0068] To eliminate the possibility of disease resistance caused by accidental factors during the genetic modification process, the inventors constructed two strains. AtSAIR1 The plants OX1 and OX2 were overexpressed, with higher overexpression levels in OX1 and slightly lower overexpression levels in OX2.

[0069] For each plant AtSAIR1 The mRNA level was detected, and the results were as follows: Figure 2 As shown, the two obtained plants AtSAIR1 Overexpression of plant AtSAIR1 The mRNA levels of the two plants were 2.1 times and 3.5 times that of the wild-type plants, respectively, indicating that both plants were... AtSAIR1 Overexpression of transgenic plants. Compared to wild-type plants (Col-0), silencing the AtSAIR1 gene... sair1-1 The mutant plants (T-DNA insertion mutants, purchased from the Arabidopsis Biological Resource Center (ABRC)) had almost zero mRNA levels.

[0070] Example 3: Detection of resistance to pathogens in overexpressing plants 1) Pathogen growth experiment pathogens Pseudomonas syringae pv.tomato ( Pst DC3000 was activated on NYG medium (5 g / L tryptone, 3 g / L yeast extract, 20 mL / L glycerol, 15 g / L agar powder) and incubated upside down at 28°C for 1-2 days. A small amount of bacterial cells was scraped from the cell and added to 4 mL of liquid NYG medium containing the appropriate antibiotic. The mixture was incubated overnight with shaking. After centrifugation at 4000 rpm for 10 min, the supernatant was discarded, and the bacterial cells were resuspended in 10 mM MgCl2. The OD was then adjusted. 600nmAdjust to 0.2. Select similarly sized and flat leaves from Arabidopsis thaliana plants cultured under short-day conditions for approximately 4 weeks. Add the bacterial solution to a final concentration of 0.02% Silwet-L77 and spray the pathogen evenly onto both the upper and lower surfaces of the leaves using a spray bottle. Wipe away any residual bacterial solution from the leaf surface with a soft paper towel, cover with a complete plastic cap for one day, then replace with a cap with four corners cut off for two more days, continuing the culture for a total of 3 days.

[0071] Three days later, samples were taken from the sprayed leaves for testing. Leaf discs were removed from the middle of each leaf using a 6 mm punch, with two leaf discs constituting one biological replicate, for a total of four biological replicates. The replicates were placed in 1.5 mL centrifuge tubes, and 300 μL of sterile 10 mM MgCl2 and two zirconium beads were added. The tubes were ground at 50 Hz for 300 s, and then 10 mM MgCl2 was added to bring the total volume to 1 mL. The solution was serially diluted to 10,000 times, and 50 μL of each serially diluted solution was plated onto NYG solid medium containing the corresponding antibiotics and incubated upside down at 28°C for 1-2 days. Once the colonies had grown to visible single clones, they were counted and converted to the number of pathogen colony-forming units (CFU) per square centimeter of leaf. The differences were statistically analyzed for significance.

[0072] Experimental results are as follows Figure 3 As shown, compared to wild-type plants, sair1-1 The mutant exhibited a significantly susceptible phenotype, with a higher number of pathogens than the wild type, while AtSAIR1 Overexpression resulted in reduced pathogen proliferation in plants, exhibiting a significant disease resistance phenotype. This result indicates... AtSAIR1 Positively regulates plant disease resistance.

[0073] 2) Pathogen invasion experiment pathogens Pseudomonas syringae pv.maculicola ( Psm After ES4326-lux is activated by shaking, OD is... 600nm Adjust the pH to 0.5, immerse the leaves (after opening the stomata) in a MES-KCl solution containing pathogens for 1 hour, then wash away the bacteria adhering to the leaf surface with sterile water containing 0.02% Silwet-L77. The rotor can be added to the solution and stirred at maximum speed for 10 seconds to thoroughly clean the leaves. Remove the leaves, wipe off the surface moisture, and observe them using a plant in vivo imaging system.

[0074] Experimental results are as follows Figure 3 As shown, sair1-1 The amount of pathogen invading plant leaves was significantly higher in the mutant than in the wild type, and AtSAIR1 Overexpressing plants showed almost no pathogen signal ( Figure 3 B), the quantitative results are consistent with this ( Figure 3 C).

[0075] The above results indicate that AtSAIR1 Positively regulates plant disease resistance.

[0076] In addition, the inventors AtSAIR1 The genes underwent phylogenetic analysis, and the results are as follows: Figure 4 As shown, the SAIR1 gene is conserved in a variety of economic crops, suggesting that it may play a similar function.

[0077] Example 4: Tomato SlSAIR1 Detection of resistance to pathogens in silent plants 1) Tomato SlSAIR1 Obtaining Silent Plants When the radicles of tomato seeds reach 1.0–1.5 cm in length, they are inoculated. A certain amount of germinated seeds are placed in Agrobacterium infection solution, and then the container is placed in a vacuum permeator. Vacuum is drawn, and when the pressure reaches -25 kPa, the vacuum is stopped and maintained for 30 seconds. Then, the air is gradually released until the pressure is restored. The seedlings are then removed and sown in plug trays, and cultured under the conditions of 16 h light / 8 h darkness and 22℃ / 18℃.

[0078] 2) Tomato SlSAIR1 Detection of resistance to pathogens in silent plants The experimental procedure was similar to that in Example 3. The pathogen *Pseudomonas syringae* pv. tomato (Pst) DC3000 was evenly sprayed onto both the upper and lower surfaces of the leaves using a spray bottle. Three days later, samples of the treated leaves were taken for testing. The experimental results are as follows: Figure 5 As shown, compared to not being silent SlSAIR1 The plant, knocked down SlSAIR1 The resulting tomatoes exhibited a significantly susceptible phenotype, with higher pathogen counts than the wild type. This result indicates... SlSAIR1 Positively regulates plant disease resistance.

[0079] Example 5: AtSAIR1 Phase separation and its translation-promoting effect on disease-fighting genes 1) AtSAIR1 Observation of condensate formation Leaves of stable transgenic Arabidopsis plants were sampled using a 6 mm perforator. Leaf discs were placed with the lower epidermis facing upwards, and a suitable amount of sterile water was added. A coverslip was placed on top, and the entire leaf was gently pressed to ensure it was fully moistened. The samples were then observed under a laser confocal fluorescence microscope. The laser intensity and gain were adjusted to appropriate levels, and images were taken and saved. Experimental results are as follows: Figure 6 As shown in A, pathogenic induction AtSAIR1 The formation of aggregates in guard cells, and the effect of truncating IDR2. AtSAIR1 It cannot form aggregates.

[0080] 2) Bioluminescence assay of translation efficiency in transient tobacco expression system The AtSAIR1 or AtSAIR1 The ΔIDR2 protein and the corresponding dual luciferase reporter vector were transiently expressed in tobacco, and four 8 mm discs were taken from the leaves as a biological replicate, ground into powder in liquid nitrogen and added with 100 μL of passive lysis buffer (PLB) to release the luciferase enzyme, which was incubated for 15 min at room temperature with shaking. After centrifugation at maximum speed for 15 min, 20 μL of supernatant were taken and placed in a white 96-well plate, and the Dual-Glo® Luciferase Assay System (Promega, Cat#E1910) was used for the detection with a multi-function microplate reader, where the amount of LABII was 50 μL and the amount of Stop solution was 50 μL. The data were recorded. The results of the experiment are shown in Figure 2, where the SAIR1, which is unable to form aggregates, loses the ability to promote translation of the resistance gene. Figure 6 B, the SAIR1, which is unable to form aggregates, loses the ability to promote translation of the resistance gene.

[0081] In the description of the present specification, the description of the terms "one embodiment", "some embodiments", "an example", "a specific example", or "some examples" and the like means that the specific features, structures, materials or characteristics described in connection with the embodiment or example are included in at least one embodiment or example of the present application. In the present specification, the illustrative description of the above terms does not necessarily refer to the same embodiment or example. Also, the specific features, structures, materials or characteristics described can be combined in any appropriate manner in any one or more embodiments or examples. In addition, the person skilled in the art can combine and combine the different embodiments or examples described in the present specification and the features of the different embodiments or examples, without contradiction.

[0082] Although the embodiments of the present application have been shown and described above, it is understood that the above-described embodiments are exemplary and are not to be construed as limiting the present application, and the person skilled in the art can make changes, modifications, replacements and variations to the above-described embodiments within the scope of the present application.

Claims

1. The application of RNA-binding proteins or related biological materials, wherein the application has at least one of the following: Regulating plant disease resistance; Regulating plant resistance to pathogens; The RNA-binding protein is any one of the following: (A1) The amino acid sequence of the protein is shown in SEQ ID No. 1; (A2) The amino acid sequence of the protein is shown in SEQ ID No. 3; (A3) A protein derived from Arabidopsis thaliana with the same function, having undergone substitution and / or deletion and / or addition of one or more amino acid residues of the amino acid sequence shown in SEQ ID No.

1. (A4) A protein derived from tomato with the same function, derived from the amino acid sequence shown in SEQ ID No. 3 by substitution and / or deletion and / or addition of one or more amino acid residues. (A5) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A1) or (A3) and is derived from Arabidopsis thaliana and has the same function. (A6) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A2) or (A4) and is derived from a tomato protein with the same function.

2. The application according to claim 1, characterized in that, The gene encoding the RNA-binding protein is any one of the following: (B1) The nucleotide sequence is the DNA molecule shown in SEQ ID No. 2; (B2) The nucleotide sequence is the DNA molecule shown in SEQ ID No. 4; (B3) hybridizes with DNA molecules defined by (B1) and encodes DNA molecules that have the same function as proteins derived from Arabidopsis thaliana; (B4) hybridizes with DNA molecules defined by (B2) and encodes DNA molecules derived from tomatoes that have the same functional protein; (B5) shares at least 80% nucleotide sequence identity with (B1) or (B3) and encodes a DNA molecule containing a functionally identical protein derived from Arabidopsis thaliana. (B6) has at least 80% identity with the nucleotide sequence defined by (B2) or (B4) and encodes a DNA molecule that is derived from a tomato and has the same function.

3. The application according to claim 1 or 2, characterized in that, In the plant, increased expression and / or activity of the RNA-binding protein enhances the plant's disease resistance and its resistance to pathogens; and / or In the plant, the expression level and / or activity of the RNA-binding protein are reduced, the plant's disease resistance is weakened, and the plant's resistance to pathogens is reduced.

4. The application of a substance capable of increasing the expression level and / or activity of RNA-binding proteins in plants, said application including at least one of the following: Improve plant disease resistance; To enhance plant resistance to pathogens; The RNA-binding protein is any one of the following: (A1) The amino acid sequence of the protein is shown in SEQ ID No. 1; (A2) The amino acid sequence of the protein is shown in SEQ ID No. 3; (A3) A protein derived from Arabidopsis thaliana with the same function, having undergone substitution and / or deletion and / or addition of one or more amino acid residues of the amino acid sequence shown in SEQ ID No.

1. (A4) A protein derived from tomato with the same function, derived from the amino acid sequence shown in SEQ ID No. 3 by substitution and / or deletion and / or addition of one or more amino acid residues. (A5) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A1) or (A3) and is derived from Arabidopsis thaliana and has the same function. (A6) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A2) or (A4) and is derived from a tomato protein with the same function.

5. The application of a substance capable of reducing the expression level and / or activity of RNA-binding proteins in plants, said application including at least one of the following: Reduce plant disease resistance; Reduce plant resistance to pathogens; The RNA-binding protein is any one of the following: (A1) The amino acid sequence of the protein is shown in SEQ ID No. 1; (A2) The amino acid sequence of the protein is shown in SEQ ID No. 3; (A3) A protein derived from Arabidopsis thaliana with the same function, having undergone substitution and / or deletion and / or addition of one or more amino acid residues of the amino acid sequence shown in SEQ ID No.

1. (A4) A protein derived from tomato with the same function, derived from the amino acid sequence shown in SEQ ID No. 3 by substitution and / or deletion and / or addition of one or more amino acid residues. (A5) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A1) or (A3) and is derived from Arabidopsis thaliana and has the same function. (A6) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A2) or (A4) and is derived from a tomato protein with the same function.

6. A method for improving plant disease resistance or plant resistance to pathogens, characterized in that, include: It increases the expression level and / or activity of RNA-binding proteins in recipient plants; The RNA-binding protein is any one of the following: (A1) The amino acid sequence of the protein is shown in SEQ ID No. 1; (A2) The amino acid sequence of the protein is shown in SEQ ID No. 3; (A3) A protein derived from Arabidopsis thaliana with the same function, having undergone substitution and / or deletion and / or addition of one or more amino acid residues of the amino acid sequence shown in SEQ ID No.

1. (A4) A protein derived from tomato with the same function, derived from the amino acid sequence shown in SEQ ID No. 3 by substitution and / or deletion and / or addition of one or more amino acid residues. (A5) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A1) or (A3) and is derived from Arabidopsis thaliana and has the same function. (A6) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A2) or (A4) and is derived from a tomato protein with the same function.

7. A method for cultivating disease-resistant transgenic plants, characterized in that, include: By introducing nucleic acid molecules capable of expressing RNA-binding proteins into recipient plants, transgenic plants are obtained. The RNA-binding protein is any one of the following: (A1) The amino acid sequence of the protein is shown in SEQ ID No. 1; (A2) The amino acid sequence of the protein is shown in SEQ ID No. 3; (A3) A protein derived from Arabidopsis thaliana with the same function, having undergone substitution and / or deletion and / or addition of one or more amino acid residues of the amino acid sequence shown in SEQ ID No.

1. (A4) A protein derived from tomato with the same function, derived from the amino acid sequence shown in SEQ ID No. 3 by substitution and / or deletion and / or addition of one or more amino acid residues. (A5) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A1) or (A3) and is derived from Arabidopsis thaliana and has the same function. (A6) has 99%, 95%, 90%, 85%, 80%, or 75% identity with the amino acid sequence defined by (A2) or (A4) and is derived from a tomato protein with the same function.

8. The method according to claim 7, characterized in that, The nucleic acid molecule capable of expressing RNA-binding protein is introduced into the recipient plant in the form of a recombinant vector.

9. The method according to claim 8, characterized in that, The nucleic acid molecule is any one of the following: (B1) The nucleotide sequence is the DNA molecule shown in SEQ ID No. 2; (B2) The nucleotide sequence is the DNA molecule shown in SEQ ID No. 4; (B3) hybridizes with DNA molecules defined by (B1) and encodes DNA molecules that have the same function as proteins derived from Arabidopsis thaliana; (B4) hybridizes with DNA molecules defined by (B2) and encodes DNA molecules derived from tomatoes that have the same functional protein; (B5) has at least 80% identity with the nucleotide sequence defined by (B1) or (B3) and encodes a DNA molecule that has the same function as a protein derived from Arabidopsis thaliana; (B6) has at least 80% identity with the nucleotide sequence defined by (B2) or (B4) and encodes a DNA molecule that is derived from a tomato and has the same function.

10. The application or method according to any one of claims 1-9, characterized in that, The RNA-binding protein includes at least one of AtSAIR1 protein and SlSAIR1 protein; Optionally, the plant includes, but is not limited to, at least one of Arabidopsis thaliana, tomato, soybean, rice, and native tobacco; Optionally, the pathogenic bacteria include, but are not limited to, at least one of *Pseudomonas syringae* and *Xanthomonas scabra*.

Images