Anhydrous cosmetic composition comprising endolysin derived from staphylococcus aureus bacteriophage and mannitol
By using anhydrous Staphylococcus aureus phage endolysin in cosmetic compositions in combination with mannitol, the stability and activity issues of endolysin in cosmetics are resolved, achieving long-term maintenance of its specific killing properties against Staphylococcus aureus, making it suitable for the prevention and treatment of skin diseases.
Patent Information
- Application Number
- CN202480049263.3
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- Priority Date
- 2023-06-02
- Filing Date
- 2024-05-31
- Publication Date
- 2026-02-24
AI Technical Summary
In the prior art, the stability and enzyme activity of Staphylococcus aureus phage lysins make it difficult for them to maintain antimicrobial activity in cosmetic formulations for a long time, and broad-spectrum antimicrobial agents have adverse reactions on the skin.
The cosmetic composition, in the form of an anhydrous composition, contains endosomalin derived from Staphylococcus aureus bacteriophage and mannitol. The endosomalin is contacted with mannitol to stabilize the endosomalin, ensuring that it remains active in a dry state and retains its antimicrobial activity after rehydration upon use.
Even after prolonged storage at room temperature or under high temperature conditions, the endolysin retains its Staphylococcus aureus-killing properties, making it suitable for the prevention and treatment of Staphylococcus aureus-related skin conditions such as acne and eczema, and it has good skin tolerance.
Smart Images

Figure SMS_2 
Figure SMS_3 
Figure SMS_4
Abstract
Description
Technical Field
[0001] This invention relates to an anhydrous composition (hereinafter referred to as Composition A) comprising at least (i) a substance derived from Staphylococcus aureus ( Staphylococcus aureus (ii) phage endolysin comprising a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2, and (ii) mannitol.
[0002] The present invention also relates to compositions (hereinafter referred to as Composition B), particularly cosmetic compositions, which contain at least one such anhydrous composition (Composition A) in a physiologically acceptable medium, particularly anhydrous composition (Composition A) in dissolved form.
[0003] The present invention also relates particularly to the use of the compositions of the invention (composition A or B) for the prevention and / or treatment of skin conditions associated with Staphylococcus aureus colonization in individuals in need, and especially for the prevention and / or treatment of acne and / or eczema in individuals in need.
[0004] The present invention also relates to a non-therapeutic cosmetic method for caring for keratin materials, particularly skin, comprising topically applying composition A or B according to the invention to these keratin materials.
[0005] The present invention further relates to a method for stabilizing endolysin derived from Staphylococcus aureus phage, particularly a method for drying endolysin derived from Staphylococcus aureus phage, said endolysin comprising a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2, said method comprising contacting the endolysin with mannitol and using mannitol to stabilize, particularly drying, the endolysin derived from Staphylococcus aureus phage.
[0006] Existing technology Human skin permanently harbors a diverse array of microorganisms (bacteria, yeasts, and fungi). The essential resident microbiota for healthy skin primarily includes Propionibacterium acnes (Propionibacterium acnes). Cutibacterium acnes Staphylococcus (Staphylococcus epidermidis) Staphylococcus epidermidis ) and Staphylococcus aureus ( Staphylococcus hominis ( ), Corynebacteria and Streptococci, and fungal flora mainly including Malassezia.
[0007] Some dermatological conditions are often caused by the disruption of the ecological balance of the resident flora after the dominant colonization of opportunistic microorganisms that are detrimental to the skin, such as Staphylococcus aureus (which is known to be associated with atopic dermatitis (eczema), oily or seborrheic skin, and acne).
[0008] To counteract this over-colonization of opportunistic microorganisms that are harmful to the skin, the common practice is to use broad-spectrum antimicrobial agents or bacteriostatic agents. However, the use of these compounds raises issues of nonspecificity in targeting both the unwanted opportunistic flora and the resident beneficial flora, as well as the risk of bacterial resistance or imbalance due to selective resistant bacteria, and skin tolerance (irritation, allergies, etc.).
[0009] Therefore, there is still a need to discover new compounds with good antimicrobial efficacy, which do not have the above-mentioned drawbacks and have good skin tolerance.
[0010] Therefore, it has been demonstrated that endolysins derived from Staphylococcus aureus phages (i.e., phages infecting Staphylococcus aureus) can specifically target and lyse Staphylococcus aureus, thereby specifically destroying the bacteria while preserving the resident skin flora (WO 2012 / 150858 A1). However, it is known that one of the main obstacles to the application of endolysins targeting Staphylococcus species is the stability of these proteins and / or their enzymatic activity, particularly the maintenance of this activity over time.
[0011] In fact, it has been observed that the cleavage of these enzymes is significantly weakened by their interaction with raw materials, especially when endosomalins are introduced into formulations, particularly cosmetic formulations.
[0012] Therefore, there is a need for formulations that can increase the stability of endosomalin over time and / or at temperature, particularly its stability over time and at temperature. In fact, since endosomalin needs to be stored at -80°C, such improvements in endosomalin stability would allow for fewer restrictions on supply, distribution, storage, and use conditions compared to current practices.
[0013] It is known that endosomalins lose their activity in aqueous solutions. During their freeze-drying or spray-drying, the inventors have found that the stability of endosomalins is unexpectedly increased by using mannitol as a drying carrier, particularly compared to equivalent aqueous compositions.
[0014] Additives are also required to promote the retention of the antimicrobial activity of the anhydrous form of endosomalin over time. In particular, these endosomalins retain their activity after rehydration in the composition, especially cosmetic compositions, for use with keratin materials, particularly on the skin.
[0015] Additives are also required, the purpose of which is to (i) promote the retention of the antimicrobial activity of the endosomal in the anhydrous formulation over time, and (ii) preserve the specificity of these endosomal against target bacteria, particularly Staphylococcus aureus in this invention.
[0016] Invention disclosure The purpose of this invention is to solve at least one of the above-mentioned technical problems.
[0017] Specifically, the inventors have now discovered that mannitol demonstrates good Staphylococcus aureus-killing properties of the relevant endosomalin for several weeks after the preparation of anhydrous compositions containing it. Invention Overview As described above, the present invention thus relates to anhydrous compositions (also referred to as composition A), particularly cosmetic compositions, which contain in a physiologically acceptable medium: (i) at least one endolysin derived from Staphylococcus aureus phage; and (ii) Mannitol, The endolysin comprises a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2.
[0019] As illustrated in the following examples, the applicant has unexpectedly discovered that an anhydrous composition according to the invention (Composition A), comprising endolysin derived from Staphylococcus aureus phage and mannitol, advantageously maintains the Staphylococcus aureus-killing properties of the endolysin even after prolonged storage (e.g., 13 weeks) at room temperature in anhydrous form followed by resolution in an aqueous medium (Composition B), wherein the endolysin comprises a protein sequence having at least 80%, particularly at least 90%, and more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2. Furthermore, this combination allows the Staphylococcus aureus-killing properties of the endolysin to be maintained even at very high temperatures (45°C for 2 months, 40°C for 3 months, and 110°C for 1 hour).
[0020] The present invention also relates to compositions (referred to as Composition B), particularly cosmetic compositions, which contain at least one anhydrous composition (Composition A) according to the invention in a physiologically acceptable medium, particularly anhydrous composition (Composition A) in soluble form.
[0021] Therefore, the present invention also relates particularly to the use of the compositions of the present invention (composition A or B) for the prevention and / or treatment of skin conditions associated with Staphylococcus aureus colonization in individuals in need, and especially for the prevention and / or treatment of acne and / or eczema in individuals.
[0022] Furthermore, the present invention also relates to a method for stabilizing endolysin derived from Staphylococcus aureus phage, particularly a method for drying endolysin derived from Staphylococcus aureus phage, the method comprising contacting the endolysin with mannitol, said endolysin comprising a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2, specifically, said endolysin comprising a protein sequence consisting of reference amino acid sequence SEQ ID NO: 1.
[0023] The present invention also relates to a non-therapeutic cosmetic method for caring for keratin materials, particularly skin, comprising topically applying a composition (composition A or B) according to the invention to these keratin materials.
[0024] The present invention also relates to the use of mannitol for stabilization, particularly for drying endosomalins derived from Staphylococcus aureus bacteriophages.
[0025] The present invention also relates to a kit for formulating cosmetic products, the kit comprising at least: (i) the anhydrous composition (composition A) according to the present invention; and (ii) A cosmetic composition containing an aqueous gel or emulsion; The anhydrous composition (i) and the cosmetic composition (ii) are each in a separate compartment, which are spatially separated.
[0026] The present invention also relates to a cosmetic composition comprising at least one anhydrous composition (composition A) according to the invention dispersed in an oil.
[0027] Detailed Explanation "Cosmetic" refers to compositions compatible with keratin materials, particularly skin, mucous membranes, and skin appendages, and even more so with the skin. The compositions according to the invention are non-therapeutic.
[0028] "Anhydrous composition" refers to a composition characterized by the absence of water or the presence of water in such a small amount that a qualified person can determine that it is free of or substantially free of water. For example, an "anhydrous" composition according to the invention may contain less than 10% by weight, particularly less than 5% by weight, particularly less than 2% by weight, and preferably less than 0.5% by weight of water relative to the total weight of the composition. Preferably, an "anhydrous" composition according to the invention does not contain a detectable amount of water, where "detectable amount" means an amount detectable by means of devices conventionally used in the art to measure water content.
[0029] In particular, the anhydrous composition according to the invention can be in the form of a lyophilized product or a spray-dried product, especially in the form of a lyophilized product.
[0030] "Keratin materials" specifically refer to skin, mucous membranes, fibers, eyelashes, and skin appendages.
[0031] "Skin" refers to all the skin of the body, and preferably the skin of the face, scalp, neckline, neck, arms and forearms, eyelids, around the mouth or behind the ears, elbows, back of the knees, hands, wrists and ankles, or even more preferably the skin of the face (especially the forehead, nose, cheeks and chin), neckline and neck.
[0032] Certain compositions according to the invention contain a physiologically acceptable medium, i.e., a medium having a pleasant color, odor, and feel and not causing any unacceptable discomfort, i.e., stinging, tightness, or redness (which would easily prevent the user from applying the composition). Of course, those skilled in the art will carefully select a physiologically acceptable medium such that the advantageous properties of the endolysin of the invention are not adversely affected, or are substantially not adversely affected. Thus, by way of example, a physiologically acceptable medium may consist primarily of water and / or one or more water-miscible organic solvents. A physiologically acceptable medium according to the invention preferably has a pH between 4 and 8, more particularly between 4.5 and 7.5. Therefore, compositions according to the invention may contain one or more pH adjusters.
[0033] As used herein, the term “treatment” means the relief and / or elimination of symptoms associated with a particular condition or symptom, and the complete disappearance of the condition or symptom.
[0034] In the context of this invention, the term "prevent" means to reduce the risk or probability of a given phenomenon occurring to a lesser extent.
[0035] Endolysin derived from Staphylococcus aureus bacteriophage The composition according to the invention (composition A or B) is first characterized in that it comprises at least one endolysin derived from Staphylococcus aureus phage, the endolysin comprising a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2.
[0036] In the embodiments presented herein, the endolysin is specific to Staphylococcus aureus, meaning it will effectively lyse Staphylococcus aureus but will substantially not lyse other bacteria besides Staphylococcus aureus. Specifically, the endolysin used according to the invention will lyse Staphylococcus aureus but not Staphylococcus epidermidis.
[0037] Most native Staphylococcus phage endolysins exhibiting peptidoglycan hydrolase activity, such as Ply2638 endolysin, contain a C-terminal cell wall-binding domain (CBD), a central N-acetylmuracil-L-alanine aminoamidase domain, and a cysteine-containing N-terminal alanyl-glycyl endopeptidase domain. In the case of Ply2638, this is the N-terminal glycyl-alanyl-glycine endopeptidase domain, which is homologous to peptidase M23. The latter three domains each exhibit peptidoglycan hydrolase activity with unique target binding specificity and are generally referred to as the enzymatically active domains.
[0038] The endolysin used in this invention is a recombinant chimeric endolysin specific to Staphylococcus aureus, which contains several heterologous domains.
[0039] Typically, endolysins consist of various subunits (domains), such as a cell wall-binding domain (CBD) and one or more enzymatic domains with peptidoglycan activity, such as an amidase domain, an M23 domain, and a CHAP (cysteine-, histidine-dependent amidase / peptidase) domain. The chimeric endolysin specific for Staphylococcus aureus used according to the present invention comprises several heterologous domains, including an amidase domain from bacteriophage Ply2638, a lysozyme domain (mimicking Staphylococcus aureus...), and a lysozyme domain. S. Simulans )) The M23 domain and the cell wall-binding domain of the phage Ply2638 containing endolysin.
[0040] This chimeric endolysin, which is specific to Staphylococcus aureus, is described in detail in document WO2012 / 150858, which is incorporated herein by reference in its entirety.
[0041] For the purposes of this invention, the term "endolysin derived from Staphylococcus aureus phage" refers to a natural or recombinant protein (e.g., an enzyme) or nucleic acid molecule encoding it, which is derived from one or more phages capable of cleaving the wall of a bacterium of the Staphylococcus aureus species.
[0042] The endosomal used in the context of this invention is the recombinant form.
[0043] For each amino acid or nucleic acid sequence of interest, a reference sequence is described herein. This specification also covers amino acid or nucleic acid sequences (e.g., enzyme amino acid sequences) that have a specific percentage of amino acid or nucleotide identity with the reference sequence.
[0044] For obvious reasons, throughout this specification, specific nucleic acid sequences or specific amino acid sequences that satisfy the considered nucleotide or amino acid identity must also result in the production of a protein (or enzyme) exhibiting the desired biological activity. As used herein, the “percentage of identity” between two nucleic acid sequences or two amino acid sequences is determined by comparing two best-aligned sequences through a comparison window.
[0045] Therefore, portions of the nucleotide or amino acid sequence in the comparison window may contain additions or deletions (e.g., “vacancies”) relative to a reference sequence (which does not contain these additions or deletions) in order to achieve optimal alignment between the two sequences.
[0046] The terms “sequence homology” or “sequence identity” or “homology” or “identity” are used interchangeably herein. For the purposes of this invention, this means aligning sequences for optimal comparison in order to determine the percentage of sequence homology or sequence identity between two amino acid sequences or two nucleic acid sequences. To optimize the alignment between two sequences, vacancies may be introduced in either of the two sequences being compared. This alignment can be performed over the entire length of the sequences being compared. Alignment can also be performed over shorter lengths, such as about twenty, fifty, one hundred, or more nucleic acid / bases or amino acids. Sequence identity is the percentage of identity match between two sequences in the reported aligned region.
[0047] Sequence comparison and determination of the percentage of sequence identity between two sequences can be performed using mathematical algorithms. Those skilled in the art will recognize that several different computer programs can be used to align two sequences and determine their identity (Kruskal, JB (1983) An overview of sequence comparison in D. Sankoff and J.B. Kruskal, (ed.), Time warps, string edits and macromolecules: the theory and practice of sequence comparison, pp. 1-44, Addison Wesley).
[0048] The percentage of sequence identity between two amino acid sequences or two nucleotide sequences can be determined using the Needleman-Wunsch algorithm used to align two sequences (Needleman, SB and Wunsch, CD (1970) J. Mol. Biol., 48, 443-453). This algorithm allows for the alignment of both amino acid and nucleotide sequences. The Needleman-Wunsch algorithm is executed in the NEEDLE computer program.
[0049] For the purposes of this invention, the NEEDLE program of the EMBOSS software package (version 2.8.0 or later, EMBOSS: The European Molecular Biology Open Software Suite (2000) Rice, P. Longden, J. and Bleasby, A. Trends in Genetics 16, (6) pp. 276-277, http: / / emboss.bioinformatics.nl / ) was used. For protein sequences, EBLOSUM62 was used for the substitution matrix. For nucleotide sequences, EDNAFULL was used. Optional parameters used were a vacancy opening penalty of 10 and a vacancy extension penalty of 0.5. No terminal vacancy penalty was added. In the output section, the response question “simple identity and similarity” was specified as yes, and “SRS pairwise” was specified as the output alignment format.
[0050] After alignment using the NEEDLE program described above, the percentage of sequence identity between the query sequence and the sequence of this invention is calculated as follows: the total length of the alignment is the number of matching positions in the alignment of identical amino acids or nucleotides in both sequences divided by the total number of empty positions in the alignment. The identity defined here can be obtained from NEEDLE using the NOBRIEF option and is marked as "Longest Identity" in the program's output.
[0051] The similarity of nucleotide and amino acid sequences, i.e., the percentage of sequence identity, can be determined using several other known algorithms, preferably the mathematical algorithm of Karlin and Altschul (Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), using hmalign (HMMER package, http: / / hmmer.wustl.edu / ) or the CLUSTAL algorithm (Thompson, JD, Higgins, DG & Gibson, TJ (1994) Nucleic Acids Res. 22, 4673-80), which can be obtained for example at https: / / www.ebi.ac.uk / Tools / msa / clustalo / , or the GAP program (mathematical algorithm of the University of Iowa), or the mathematical algorithm of Myers and Miller (1989 - Cabios 4: 11-17), or Clone Manager 9, by sequence alignment. The preferred parameters used are the default parameters as defined in https: / / www.ebi.ac.uk / Tools / msa / clustalo / .
[0052] The degree of sequence identity (sequence matching) can be calculated using, for example, BLAST, BLAT, or BlastZ (or BlastX). Similar algorithms are incorporated into the BLASTN and BLASTP programs of Altschul et al. (1990) J. Mol. Biol., 215, 403-410. BLAST polynucleotide searching is performed using the BLASTN program with a score of 100 and a word length of 12 to obtain polynucleotide sequences homologous to nucleic acids encoding the protein of interest.
[0053] BLAST protein search was performed using the BLASTP program with a score of 50 and a word length of 3 to obtain amino acid sequences homologous to the SHC peptide. Gapped BLAST, as described in Altschul et al. (1997) NucleicAcids Res. 25, 3389-3402, was used to obtain alignments with vacancies for comparison. When using the BLAST and Gapped BLAST programs, the default settings for each program were used. Sequence matching analysis could be supplemented by established homology mapping techniques, such as Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl. 1: 154-162) or Markov random fields. When percentages of sequence identity are mentioned in this patent application, unless otherwise stated, these percentages are calculated relative to the total length of the longest sequence.
[0054] In a particular implementation, the percentage of identity between two sequences is determined using CLUSTAL O (version 1.2.4).
[0055] Therefore, as described above, the endolysin used according to the present invention comprises a protein sequence having at least 80%, particularly at least 90%, and more particularly at least 95% sequence identity with an amino acid sequence selected from the reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2.
[0056] In particular, the endosomalin may comprise a protein sequence consisting of the reference amino acid sequence SEQ ID NO:1.
[0057] The term "at least 80% sequence identity between two sequences" means that the first sequence can have 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the second sequence, regardless of whether they are amino acid sequences or nucleic acid sequences.
[0058] The protein sequences described in this article may be encoded by one or more allele variants.
[0059] Allelic variants represent any of two or more alternative forms of a gene occupying the same chromosomal locus. Preferred nucleic acid variants are nucleotide sequences containing one or more silent mutations. Optionally or in combination, nucleic acid variants can also be obtained by introducing nucleotide substitutions that do not produce another amino acid sequence of the polypeptide encoded by the nucleotide sequence, but which corresponds to the codon usage of the host organism intended to produce the polypeptide of the present invention. According to a preferred embodiment, the nucleic acid variant encodes a polypeptide that still retains its biological function. More preferably, the nucleotide sequence variant encodes a polypeptide exhibiting cell wall binding and / or cleavage activity with Staphylococcus species. Even more preferably, the nucleic acid variant encodes a polypeptide exhibiting increased cell wall binding and / or cleavage activity with Staphylococcus species, as defined below. The nucleic acid encoding a polypeptide exhibiting cell wall binding and / or cleavage activity with Staphylococcus species can be isolated from any microorganism.
[0060] All these variants can be obtained using techniques known to those skilled in the art, such as library screening via hybridization (nucleic acid blotting procedure) under low to medium to high stringency conditions. Low to medium to high stringency conditions refer to pre-hybridization and hybridization at 42°C, with 5× SSPE, 0.3% SDS, 200 pg / ml of cleaved and denatured salmon sperm DNA, and with 25%, 35%, or 50% formamide for low to medium to high stringency, respectively. The hybridization reaction is then washed three times for 30 minutes each, with each wash using 2× SSC, 0.2% SDS, and at 55°C, 65°C, or 75°C for low to medium to high stringency.
[0061] The binding of the domain to the peptidoglycan cell wall of Staphylococcus spp. can be assessed using assays known to those skilled in the art. In a preferred embodiment, immunohistochemistry and / or gene fusion techniques (which generate labeled constructs of any domain) are used to assess the specific binding of peptides, polypeptides, or proteins to the peptidoglycan cell wall of Staphylococcus spp. The signal quantification methods used in the above-described immunohistochemistry or fusion techniques are known in the art.
[0062] In one embodiment, binding to the peptidoglycan cell wall of Staphylococcus spp. can be quantified using a fluorescent fusion construct comprising a polypeptide containing a domain included in the first protein sequence as described above. Loessner et al. describe such a cell wall binding assay in detail (Molecular Microbiology 2002, 44(2): 335-349). In this assay, a solution containing the fluorescent fusion construct or a negative control (preferably green fluorescent protein (GFP)) is subjected to Staphylococcus spp. cells (preferably Staphylococcus aureus cells, more preferably Staphylococcus aureus BB255 cells) for a specific period of time, after which the cells are centrifuged to allow the bound fluorescent fusion construct to settle. For the purposes of this invention, the measure of cell binding is obtained by subtracting the fluorescence signal of Staphylococcus spp. cells exposed to the fluorescent fusion construct from the fluorescence signal of Staphylococcus spp. cells exposed to the negative control, preferably GPF.
[0063] According to the present invention, examples of suitable assessments of the binding of endosomalin to the cell wall of Staphylococcus species are particularly illustrated in WO 2012 / 150858 A1.
[0064] Preferably, in the context of this text, when an increase in fluorescence signal of sedimented cells is detected using this assay, the protein sequence is considered to contain a domain for binding to the peptidoglycan cell wall of Staphylococcus spp. Preferably, the binding is considered specific.
[0065] According to a specific implementation scheme, the binding activity with the cell wall of Staphylococcus species is measured by immunohistochemistry and / or gene fusion techniques, particularly fluorescent fusion techniques, and more particularly fusion with green fluorescent protein.
[0066] A "heterologous protein sequence" refers to a protein sequence that is not naturally functionally linked to the first protein sequence as an adjacent sequence, i.e., the amino acid or nucleic acid sequence encoding that protein sequence. As used herein, the term "heterologous" may mean "recombination." The term "recombination" refers to a genetic entity that is different from what is normally found in nature. When applied to nucleotide sequences or nucleic acid molecules, this means that the nucleotide sequence or nucleic acid molecule is the product of various combinations of cloning, restriction, and / or ligation steps, as well as other processes that result in constructs that differ from those found in nature.
[0067] Such protein or nucleic acid recombination methods are well known to those skilled in the art.
[0068] As described above, the endolysin used according to the present invention comprises a heterologous protein sequence containing a cleavage domain that exhibits peptidoglycan hydrolase activity.
[0069] "Peptidoglycan hydrolase activity" (also defined herein as "lytic activity") can be assessed using methods well-known to those skilled in the art. In one embodiment, lytic activity can be assessed spectrophotometrically by measuring a decrease in the turbidity of the substrate cell suspension. Preferably, lytic activity can be assessed spectrophotometrically by measuring a decrease in the turbidity of the Staphylococcus aureus suspension, the turbidity being measured by OD using a spectrophotometer (Libra S22, Biochrom). 595 To quantify. More preferably, 200 nM of a polypeptide encoded by a nucleic acid molecule as identified herein is reacted with PBS buffer at pH 7.4 and 120 mM sodium chloride in an initial OD of 1 ± 0.05. 600 The Staphylococcus aureus suspension (as assessed by spectrophotometry (Libra S22, Biochrom)) was incubated together at 37°C for 30 minutes. The OD values were measured from the values prior to 30 minutes of incubation. 595 Subtract the OD after 30 minutes of incubation 595 The decrease in turbidity is calculated. In the context of this text, a protein sequence is considered to contain a cleavage domain when a decrease in turbidity of at least 10%, 20%, 30%, 40%, 50%, or 60% is detected using this assay. Preferably, a decrease of at least 70% is detected.
[0070] According to one specific implementation, the cleavage activity of endosomalin is measured spectrophotometrically by measuring the decrease in turbidity of a Staphylococcus aureus suspension.
[0071] The endopeptidase domain used in this article is preferably cleaved in the cell wall of Staphylococcus spp., particularly in Staphylococcus aureus, Staphylococcus mimicus, and Staphylococcus carinatum. S. carnosus The pentaglycine cross-linking bridges found in the cell walls of Staphylococcus aureus (Trayer, HR and Buckley, CE (1970) Molecular properties of lysostaphin, a specific bacteriolytic agent for Staphylococcus aureus. J. Biol. Chem. 245, 4842-4846).
[0072] The amidase domain used in this paper is preferably preferred for hydrolyzing substrates containing γ-glutamyl groups.
[0073] The functionality and activity of such domains in a polypeptide can be demonstrated by characterizing the cleavage product after incubating any of the polypeptides containing these domains together with purified peptidoglycan.
[0074] According to a specific implementation, the endopeptidase and / or amidase activities of endosomalin are measured by characterizing the cleavage products.
[0075] According to a specific implementation, the endopeptidase and / or amidase activities of anendolysin can be measured by measuring the optical density of bacteria in the presence of anendolysin. Such methods are specifically described in Park et al. (Characterization of anendolysin, LysBPS13, from a Bacillus cereus bacteriophage, FEMSMicrobiolLett. 2012 Jul.; 332(1): 76-83) and Grishin et al. (A Simple Protocol for the Determination of Lysostaphin Enzymatic Activity, Antibiotics (Basle). 2020 Dec. 17; 9(12): 917).
[0076] Preferably, each protein sequence and nucleotide sequence encoding the second or third domain is of bacterial or bacteriophage origin.
[0077] According to a particular embodiment, the second and third protein sequences are independently derived from enzymes selected from Staphylococcus aureus Φ2638a phage endolysin and staphylococcal lysin. Specifically, one of the second and third protein sequences is derived from Staphylococcus aureus Φ2638a phage endolysin, and the other sequence of the second and third protein sequences is derived from staphylococcal lysin.
[0078] The endolysin comprises a protein sequence encoded by a nucleic acid sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with the reference nucleic acid sequence SEQ ID NO: 3. Specifically, the endolysin may comprise a protein sequence encoded by a nucleic acid sequence comprising the reference nucleic acid sequence SEQ ID NO: 3.
[0079] The endolysin containing the protein sequence encoded by the reference nucleic acid sequence SEQ ID NO: 3 differs from the endolysin of Staphylococcus aureus Φ2638a phage in that the N-terminal M23 endopeptidase domain is replaced by the M23 endopeptidase domain from lysostaphin, which mimics Staphylococcus aureus.
[0080] Endolysins suitable for use in this invention can be obtained by any method known to those skilled in the art for producing recombinant proteins. In particular, endolysins according to the invention can be obtained by introducing one or more genes of interest, such as the nucleic acid sequences described above, into the genome of a host organism via a vector.
[0081] On the other hand, a nucleic acid construct comprising at least one of the nucleic acid sequences as defined above is described.
[0082] Expression vectors comprising such nucleic acid constructs are also described. Preferably, the expression vector comprises the nucleotide sequence as described above, operatively linked to one or more control sequences that guide the generation or expression of the encoded polypeptide in cells, subjects, or cell-free expression systems.
[0083] Expression vectors can be considered recombinant expression vectors. These vectors can be composed of plasmids, granules, bacteriophages, or viruses, and are transformed by introducing nucleic acid molecules according to the invention. Such transformation vectors, based on the host organism to be transformed, are well known to those skilled in the art and are extensively described in the literature.
[0084] Another subject of this article is a method for transforming a host organism by integrating at least one of the described nucleic acid sequences, the transformation being carried out by any suitable method known and extensively described in the specialized literature, and more particularly by the aforementioned vectors.
[0085] On the other hand, cells are described that comprise nucleic acid constructs or expression vectors as defined above. The cells can be any microorganism, prokaryotic or eukaryotic cell suitable for expressing endolysins suitable for use in this invention. In a preferred embodiment, the cells are *Escherichia coli* (…). E. coli Cells. In an even more preferred embodiment, the cells are Escherichia coli CL1blue MRF.
[0086] The obtained endosomal can then be purified using purification methods known in the art, such as column chromatography, high performance liquid chromatography, etc.
[0087] In one particular embodiment, one or more protein sequences, as defined in the text, may include a sequence encoding a tag to facilitate the purification of the resulting endolysin. Preferably, the tag is selected from, but is not limited to, FLAG tags, His tags, HA tags, and Myc tags. More preferably, the tag is a 6×His tag. Even more preferably, the tag is the same N-terminal 6×His tag as SEQ ID NO: 4.
[0088] The anhydrous composition (composition A) according to the invention may contain an amount of endolysin derived from Staphylococcus aureus phage as described above, ranging from 0.01% to 0.6% by weight relative to the total weight of the anhydrous composition, particularly from 0.05% to 0.5% by weight relative to the total weight of the anhydrous composition, and even more particularly from 0.1% to 0.3% by weight relative to the total weight of the anhydrous composition.
[0089] The composition (composition B) according to the invention may contain an amount of endolysin derived from Staphylococcus aureus phage as described above, ranging from 0.0001 wt% to 0.1 wt% relative to the total weight of the composition, particularly from 0.0005 wt% to 0.01 wt% relative to the total weight of the composition, and even more particularly from 0.001 wt% to 0.005 wt% relative to the total weight of the composition.
[0090] Mannitol Mannitol or hexane-1,2,3,4,5,6-hexanol is a polyol structurally derived from mannose.
[0091] It can play a variety of roles in cosmetic compositions, such as acting as a humectant, fixative, masking agent, moisturizer, and skin care agent. In particular, in the compositions according to the invention, mannitol acts as an endosomal stabilizer.
[0092] Mannitol corresponds to the following chemical formula (I).
[0093] [Chemical Formula 1] (I) The anhydrous composition (composition A) according to the invention may contain mannitol in a range of 30% to 90% by weight relative to the total weight of the anhydrous composition, particularly 40% to 80% by weight relative to the total weight of the anhydrous composition, and even more particularly 45% to 75% by weight relative to the total weight of the anhydrous composition.
[0094] The composition (composition B) according to the invention may contain mannitol in the range of 0.01% to 21% by weight relative to the total weight of the composition, particularly 0.05% to 9% by weight relative to the total weight of the composition, and even more particularly 0.1% to 3% by weight relative to the total weight of the composition.
[0095] The composition according to the invention (composition A or B) may contain one or more endosomal and mannitol according to the invention, wherein the weight ratio of endosomal / mannitol is between 0.001 and 0.003, and particularly between 0.002 and 0.003.
[0096] An example of suitable mannitol according to the invention is mannitol sold by ROQUETTE® under the name "Beauté by Roquette® PO 260".
[0097] The anhydrous composition according to the present invention (also known as composition A) As described above, the anhydrous composition according to the invention comprises at least one endolysin derived from Staphylococcus aureus phage, said endolysin comprising a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2, and specifically, said endolysin comprises a protein sequence consisting of reference amino acid sequence SEQ ID NO: 1. It also comprises mannitol.
[0098] As described above, the anhydrous composition according to the invention may contain an amount of endolysin derived from Staphylococcus aureus phage as described above, ranging from 0.01% to 0.6% by weight relative to the total weight of the anhydrous composition, particularly from 0.05% to 0.5% by weight relative to the total weight of the anhydrous composition, and even more particularly from 0.1% to 0.3% by weight relative to the total weight of the anhydrous composition.
[0099] As also described above, the anhydrous composition according to the invention may contain mannitol in a range of 30% to 90% by weight relative to the total weight of the anhydrous composition, particularly 40% to 80% by weight relative to the total weight of the anhydrous composition, and even more particularly 45% to 75% by weight relative to the total weight of the anhydrous composition.
[0100] The anhydrous composition (composition A) according to the invention is particularly free of sucrose (i.e. contains 0% by weight of sucrose relative to the total weight of the composition).
[0101] The anhydrous composition according to the invention can be obtained by freeze-drying or spray-drying. In particular, the anhydrous composition according to the invention is obtained by freeze-drying.
[0102] Therefore, the anhydrous composition according to the invention can be in the form of a lyophilized product or a spray-dried product. In particular, the anhydrous composition according to the invention is in the form of a lyophilized product.
[0103] Obtaining a lyophilized or spray-dried form involves performing either lyophilization or spray drying, respectively. Lyophilization or spray drying can be performed according to conventional methods known to those skilled in the art (Fakhrossadat Emami et al., Pharmaceutics. 2018 Sep; 10(3): 131).
[0104] Preferably, the anhydrous composition according to the invention is in the form of powder, cake, tablet, gel capsule or sheet, especially powder.
[0105] For anhydrous compositions, it may be advantageous to further include freeze-drying additives, particularly to promote freeze-drying for texturing the composition and also to promote rehydration of the freeze-dried form. Of course, those skilled in the art will carefully select physiologically acceptable media so that the advantageous properties of the endosomal inoculants of the present invention are not adversely affected, or are substantially not adversely affected. Examples of freeze-drying additives include cellulose derivatives such as HPMC.
[0106] The anhydrous composition (composition A) according to the invention can be adjusted such that dispersing the entire composition in a fixed amount of physiologically acceptable medium provides a diluted composition intended for single use.
[0107] For example, the contact operation of the anhydrous composition (composition A) according to the invention can be performed immediately by direct immersion in bath water. A more gradual contact operation is also conceivable. Therefore, there are shower head devices constructed to allow the anhydrous composition intended for, for example, nursing purposes to be placed in the head. Then, upon contact with water diffusing through the head, the gradual dissolution of the anhydrous composition is ensured.
[0108] According to the uses described herein, such compositions can be applied directly to keratin materials in their anhydrous form, or they can be dissolved in physiologically acceptable media, particularly aqueous media, to form compositions (composition B) according to the invention, which, in addition to physiologically acceptable media, specifically contain the anhydrous composition (composition A) according to the invention.
[0109] In cases where the anhydrous composition (composition A) of the present invention is not used directly but must first be dissolved, its use is combined with the use of a physiologically acceptable medium, which is a fluid form suitable for dissolving the anhydrous composition, as detailed below.
[0110] The present invention further relates to a method for stabilizing endolysin derived from Staphylococcus aureus bacteriophage, particularly a method for drying endolysin derived from Staphylococcus aureus, the method comprising contacting the endolysin with mannitol, the endolysin comprising a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2, particularly the endolysin comprising a protein sequence consisting of reference amino acid sequence SEQ ID NO: 1.
[0111] The "stabilization method" for endolysins refers to a method that maintains the physical integrity of endolysins and preserves their enzymatic activity, particularly their cytotoxic activity against Staphylococcus aureus.
[0112] The contact procedure can be performed, for example, according to methods known in the art (Fakhrossadat Emami et al., Pharmaceutics. 2018 Sep; 10(3): 131).
[0113] The stabilization method, particularly the drying method, includes the steps of mixing (i) endosomalin and (ii) mannitol in an aqueous liquid, particularly water, and then freeze-drying it.
[0114] Advantageously, the contact operation is carried out at a (endolysin) / (mannitol) weight ratio between 0.001 and 0.003, and particularly between 0.002 and 0.003.
[0115] The present invention also relates to the use of mannitol for stabilization, particularly drying, of endolysin derived from Staphylococcus aureus bacteriophage. Specifically, the endolysin comprises a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2, particularly comprising a protein sequence consisting of reference amino acid sequence SEQ ID NO: 1. This use specifically includes mixing (i) the endolysin and (ii) mannitol in an aqueous liquid, particularly water, and then freeze-drying the mixture.
[0116] As mentioned above, the contact operation is advantageously carried out at a (endolysin) / (mannitol) weight ratio between 0.001 and 0.003, and particularly between 0.002 and 0.003.
[0117] Composition (Composition B) comprising the anhydrous composition (Composition A) according to the present invention. Such compositions (composition B) according to the invention particularly contain, in addition to physiologically acceptable media, and especially water, an anhydrous composition according to the invention. Composition A ).
[0118] Therefore, such a composition (composition B) also comprises: (i) at least one endolysin derived from Staphylococcus aureus phage; and (ii) Mannitol, The endolysin comprises a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from the reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2. In particular, the endolysin comprises a protein sequence consisting of the reference amino acid sequence SEQ ID NO: 1.
[0119] As defined above, physiologically acceptable media may contain water and / or one or more water-miscible organic solvents.
[0120] In particular, the composition (composition B) according to the invention may contain at least 40% by weight of water relative to the total weight of the composition, especially ranging from 40% to 95% by weight, more particularly from 50% to 90% by weight, especially from 75% to 95% by weight, and even more particularly from 80% to 95% by weight relative to the total weight of the composition.
[0121] The water may be sterile softened water and / or floral water and / or natural spring water or mineral water.
[0122] In this invention, "water-miscible organic solvent" refers to an organic compound that is a liquid at room temperature and has a miscibility of more than 50% by weight in water at 25°C and atmospheric pressure.
[0123] The water-miscible organic solvent that can be used in the composition (composition B) of the present invention can also be volatile.
[0124] Among the water-miscible organic solvents in which the compositions (composition B) of the present invention can be used, examples include lower monohydric alcohols (e.g., ethanol and isopropanol) and polyhydric alcohols (e.g., propylene glycol and glycerol) having 2 to 5 carbon atoms.
[0125] According to one embodiment, the composition according to the invention may be free of lower monohydric alcohols having 2 to 5 carbon atoms.
[0126] The water-miscible organic solvent may be present in composition B according to the invention in an amount ranging from 5% to 20% by weight relative to the total weight of the composition, preferably from 10% to 15% by weight relative to the total weight of the composition.
[0127] The compositions according to the invention contain mannitol in a total content ranging from 0.01% to 21% relative to the total weight of the composition, particularly from 0.05% to 9% relative to the total weight of the composition, and even more particularly from 0.1% to 3% relative to the total weight of the composition.
[0128] Such a composition (composition B) according to the invention, which contains, in addition to a physiologically acceptable medium, an anhydrous composition (composition A) according to the invention, can be obtained, in particular, by a method comprising at least the following steps: (a) providing a physiologically acceptable aqueous medium, (b) providing the anhydrous composition (composition A) according to the invention, in particular in the form of a lyophilized form or in the form of a spray-dried form, in particular in the form of a lyophilized form, and (c) immediately contacting the anhydrous composition (composition A) (b) with the aqueous medium (a) under conditions suitable for the dissolution of the components of the anhydrous composition (composition A) in the medium.
[0129] According to a particular embodiment, such a composition (composition B) according to the invention, which contains, in addition to a physiologically acceptable medium, an anhydrous composition (composition A) according to the invention, can be obtained by a method comprising the steps of dissolving the anhydrous composition (composition A) according to the invention in water or hot water in a bath or shower, and thus intending to bring it into contact with keratin materials, and in particular, with the skin.
[0130] Other ingredients In addition to the compounds described above, the compositions according to the invention (composition A or B, especially B) may of course contain one or more other components besides mannitol as defined above.
[0131] Of course, those skilled in the art will carefully select one or more additional ingredients so that the advantageous properties of the endosomal in this invention are not adversely affected or are substantially not adversely affected.
[0132] The other ingredients are present in the composition at their usual levels in the cosmetic composition, in particular at their usual levels that enable them to maintain their cosmetic properties, and even more particularly at their usual levels that enable them to maintain their cosmetic properties when they are the sole ingredients of the composition according to the invention having such properties.
[0133] Therefore, the compositions according to the invention may contain one or more of the following additional ingredients selected from: surfactants; fatty substances; colorants; preservatives; fragrances; pH adjusters, such as organic acids, such as citric acid; antioxidants; hydrophilic gelling agents, such as hydroxypropyl methylcellulose; amino acids, such as arginine; carbohydrates; chelating agents; sugar alcohols; cosmetic surfactants; and mixtures thereof.
[0134] Of course, those skilled in the art will carefully select such or such optional additional ingredients and / or their amounts so that the advantageous properties of the compositions according to the invention are not affected, or substantially not affected, by any contemplated additions.
[0135] Other components, unlike those listed below, may be present in the compositions according to the invention at concentrations between 0.001 wt% and 20 wt% relative to the total weight of the composition, particularly between 0.01 wt% and 10 wt%, and even more particularly between 0.1 wt% and 5 wt%.
[0136] According to a particular embodiment, the composition according to the invention may contain at least one additional component selected from oils, aromatic alcohols of formula (II), organic fillers, nonionic surfactants, and mixtures thereof.
[0137] Oil The compositions according to the present invention may contain at least one oil.
[0138] For the purposes of this invention, "oil" refers to oil heated at 25°C and atmospheric pressure (1.013 × 10⁻⁶). 5 The following (Pa) refers to water-immiscible compounds that are liquids.
[0139] "Immeasurable" means that under the above temperature and pressure conditions, a mixture of equal amounts of water and oil, after stirring, does not produce a stable solution containing only a single phase. If desired, observe 100g of the mixture by visual inspection or with a phase contrast microscope, obtained by thoroughly stirring with a Rayneri stirrer that generates eddies (200 to 1000 rpm) within the mixture, and allow the resulting mixture to stand at room temperature for 24 hours in a sealed flask before observation.
[0140] "Hydrocarbon oil" refers to an oil that primarily contains hydrogen and carbon atoms, along with one or more optional functional groups selected from hydroxyl, ester, ether, and carboxylic acid functional groups. Therefore, hydrocarbon oil does not contain any silicon or fluorine atoms.
[0141] The term "silicone oil" refers to an oil containing at least one silicon atom, and in particular at least one Si-O group, and more particularly an organopolysiloxane.
[0142] The term "fluorinated oil" refers to an oil that contains at least one fluorine atom.
[0143] The term "nonpolar hydrocarbon oil" refers to hydrocarbon oils that contain only carbon and hydrogen atoms, especially non-aromatic hydrocarbons (also known as hydrocarbons).
[0144] The term "polar hydrocarbon oil" refers to a hydrocarbon oil that primarily contains hydrogen and carbon atoms and one or more functional groups selected from hydroxyl, ester, ether, and carboxylic acid functional groups.
[0145] In particular, the compositions according to the invention may contain at least one oil selected from volatile and non-volatile oils, especially oils other than liquid paraffin.
[0146] Volatile oils "Volatile oil" refers to an oil (or non-aqueous medium) that evaporates within one hour of contact with skin at room temperature and atmospheric pressure. Volatile oils are volatile cosmetic oils that are liquid at room temperature, and particularly those with a non-zero vapor pressure at room temperature and atmospheric pressure, specifically ranging from 0.13 Pa to 40000 Pa (10). -3 Vapor pressures ranging from 1.3 Pa to 13000 Pa (0.01 to 100 mmHg), and even more particularly from 1.3 Pa to 1300 Pa (0.01 to 10 mmHg).
[0147] According to a particular embodiment of the invention, the volatile oil has a flash point below 120°C and a vapor pressure less than 5 Pa, more particularly wherein the flash point is below 90°C and the vapor pressure is greater than 1 Pa, even more particularly wherein the flash point is below or equal to 60°C and the vapor pressure is greater than 5 Pa, and even more particularly wherein the flash point is below 60°C and the vapor pressure is greater than 100 Pa.
[0148] Volatile oils can be selected from volatile hydrocarbon oils, for example: - Hydrocarbon oils containing 8 to 16 carbon atoms, especially: a) Branched C8-C16 alkanes, alone or as mixtures, such as isoalkanes (also known as isoparaffins), such as C8-C9 isoparaffins, C13-C16 isoparaffins, isododecane, isodecane, isohexadecane, and oils, for example, sold under the trade names Isopar or Permethyl, especially isododecane (also known as 2,2,4,4,6-pentamethylheptane), which, for example, is sold by Ineos, and more particularly isododecane; b) Straight-chain C6-C16 alkanes, alone or as mixtures, such as hexane, decane, undecane, tridecane, iso-alkanes, such as n-dodecane (C12) and n-tetradecane (C14) sold by Sasol under the reference names Parafol 12-97 and Parafol 14-97, respectively, undecane-tridecane mixtures, mixtures of n-undecane (C11) and n-tridecane (C13) obtained in Examples 1 and 2 of Cognis' patent application WO 2008 / 155059, and mixtures thereof, and mixtures of n-undecane (C11) and n-tridecane (C13) from BASF Cetiol Ultimate®; c) Volatile C5-C12 cyclic non-aromatic alkanes; - Short-chain esters containing a total of 3 to 8 carbon atoms, such as methyl acetate, ethyl acetate, propyl acetate, n-butyl acetate or isobutyl acetate, which are sold, for example, by Solvay, Dow or Oxea; - A volatile carbonate hydrocarbon oil with the structure R'1-OC(O)-O-R'2, wherein R'1 and R'2 may be the same or different, and each independently represents a straight-chain, branched, or cyclic C4-C8 alkyl group, particularly a straight-chain C4-C8 alkyl group. It is preferable that R1 and R2 are the same. In particular, R'1 and R'2 represent a straight-chain butylalkyl or pentyl group. Advantageously, the ether oil is selected from dibutyl carbonate or dipentyl carbonate; A volatile ether oil of the formula R1-O-R2, wherein R1 and R2 may be the same or different, and each independently represents a straight-chain, branched, or cyclic C4-C8 alkyl group, particularly a straight-chain or branched C4-C8 alkyl group. Preferably, R1 and R2 are the same. Straight-chain alkyl groups that may be mentioned include butyl and pentyl. Branched alkyl groups that may be mentioned include 1-methylpropyl, 2-methylpropyl, tert-butyl, and 1,1-dimethylpropyl.
[0149] In particular, the volatile hydrocarbon oil is selected from C8-C16 alkanes, especially straight-chain C8-C16 alkanes, and even more particularly from C9-C12 alkanes, and even more particularly from mixtures of C9-C12 alkanes, such as VegelightSilk® sold by BioSynthIs.
[0150] The volatile oil can be selected from volatile silicone oils, for example: - Silicone oils, which particularly contain 2 to 7 silicon atoms, optionally containing alkyl or alkoxy groups containing 1 to 10 carbon atoms. As volatile silicone oils that can be used in this invention, polydimethylsiloxane, cyclopentanedimethylsiloxane, dodecylpentane, cyclohexanedimethylsiloxane, octamethylcyclotetrasiloxane, decamethylcyclopentane, dodecylcyclohexasiloxane, heptamethylhexyltrisiloxane, heptamethyloctyltrisiloxane, hexamethyldisiloxane, octamethyltrisiloxane, decamethyltetrasiloxane, and dodecylpentane, and mixtures thereof, having viscosities of 5 and 6 cSt, are particularly mentioned. Dodecylpentane, for example, under the reference name DM-Fluid-2cs sold by Shin-Etsu, or cyclohexanedimethylsiloxane, for example, under the reference name Xiameter PMX-0246 Cyclohexasiloxane sold by Dow Chemical, are particularly mentioned.
[0151] Non-volatile oils The term "non-volatile oil" refers to an oil having a non-zero vapor pressure of less than 2.66 Pa, and more particularly less than 0.13 Pa, at 25°C and atmospheric pressure. For example, the vapor pressure can be measured by static methods or by the permeability method via isothermal thermogravimetric analysis, depending on the vapor pressure of the oil (OECD Standard 104).
[0152] Non-volatile oils can be of natural or synthetic origin, especially natural ones.
[0153] In non-volatile oils, the following can be mentioned: - Non-volatile fluorinated oils, which may be particularly selected from fluorinated polyethers, and from fluorosilicone oils and fluorosilicones as described in EP-A-847752; - Non-volatile silicone oils, which may be particularly selected from non-volatile silicones having the following INCI names: polydimethylsiloxane, polydimethylsiloxane alcohol, trimethylpentaphenyltrisiloxane, tetramethyltetraphenyltrisiloxane, diphenylpolydimethylsiloxane, trimethylsiloxyphenylpolydimethylsiloxane, phenylpolytrimethylsiloxane, diphenylsiloxyphenylpolytrimethylsiloxane; and mixtures thereof.
[0154] These products are specifically sold by Dow Corning under the names PH-1555 HRI Cosmetic Fluid (trimethylpentaphenyltrimethoxane) and Dow Corning 556 Cosmetic Grade Fluid (phenyl polytrimethylsiloxane); diphenyl polydimethylsiloxanes, such as products KF-54, KF54HV, KF-50-300CS, KF-53d and KF-50-100CS or Diphenylsiloxy Phenyl Trimethicone KF56 A sold by Shin-Etsu; and products Belsil PDM 1000 and Belsil PDM 20 (trimethylsiloxyphenyl polydimethylsiloxane) sold by Wacker Chemie, either alone or as mixtures. - Nonpolar, nonvolatile hydrocarbon oils, which may be particularly selected from straight-chain or branched compounds of mineral or synthetic origin, such as: i) squalane, for example, the reference name Neossance Squalane sold by Amyris, or isoeicosane; ii) straight-chain, saturated hydrocarbons, especially C14-C30 hydrocarbons and more particularly C15-C28 hydrocarbons, such as mixtures whose INCI names are, for example, mixtures of (C15-C19) alkanes, (C18-C21) alkanes, (C21-C28) alkanes, such as products Gemseal40, Gemseal60 and Gemseal 120 sold by Total, Emogreen L19 sold by SEPPIC, and Emogreen L15 sold by SEPPIC; iii) hydrogenated or non-hydrogenated polybutene, such as those sold by Ineos. Products sold by Oligomers in the Indopol series, products with the INCI name of hydrogenated polyisobutylene; iv) hydrogenated or non-hydrogenated polyisobutylene, especially hydrogenated, such as non-volatile compounds of the Parleam® series sold by Nippon Oil Fats; v) hydrogenated or non-hydrogenated polydecene, such as non-volatile compounds of the Puresyn® series sold by ExxonMobil; vi) decene / butene copolymers, butene / isobutylene copolymers; and vii) mixtures thereof. - Polar, non-volatile hydrocarbon oils, which can be selected from: i) Saturated, unsaturated, straight-chain or branched C10-C26 fatty alcohols, which are liquid at room temperature (25°C), especially monohydric alcohols. In particular, C10-C26 alcohols are fatty alcohols, and they are especially branched when they contain at least 16 carbon atoms; in particular, fatty alcohols contain 10 to 24 carbon atoms, and more particularly 12 to 22 carbon atoms, especially, for example, lauryl alcohol, isostearyl alcohol, oleyl alcohol, 2-butyloctanol, 2-undecylpentadecanol, 2-hexyldecyl alcohol, isocetyl alcohol, octyldodecyl alcohol and mixtures thereof; ii) Triglycerides composed of fatty acid esters of glycerol, particularly whose fatty acids may have chain lengths ranging from C4 to C36, and especially from C18 to C36; these oils may be straight-chain or branched and saturated or unsaturated; for example, heptanoic or caprylic triglycerides, caprylic / capric triglycerides, vegetable oils such as wheat germ oil, sunflower oil, grapeseed oil, sesame oil, corn oil, almond oil, castor oil, shea butter, avocado oil, olive oil, soybean oil, sweet almond oil, palm oil, rapeseed oil, cottonseed oil, hazelnut oil, macadamia nut oil, jojoba oil, alfalfa oil, poppy seed oil, pumpkin seed oil, zucchini oil (marrow) Oils including blackcurrant oil, evening primrose oil, millet oil, barley oil, quinoa oil, rye oil, safflower oil, candlenut oil, passionflower oil, musk rose oil, peanut oil, coconut oil, argan oil, passionflower oil, and kaya oil; liquid fractions of shea butter and cocoa butter; and mixtures thereof. iii) Straight-chain aliphatic hydrocarbon esters of formula RC(O)-OR', wherein RC(O)-O- represents a carboxylic acid residue containing 2 to 40 carbon atoms, and R' represents a hydrocarbon chain containing 1 to 40 carbon atoms, an aliphatic hydrocarbon ester of alkylene glycol, especially ethylene glycol or propylene glycol, advantageously having a total number of carbon atoms of at least 10. Examples of such esters may include isoamyl laurate, cetearyl octanoate, isopropyl stearate or isostearyl octanoate, ethyl palmitate, 2-ethylhexyl palmitate, isostearyl isostearate, octyl stearate, isostearyl heptanoate, octanoate, decanoate or castor oil esters of alcohols or polyols, such as propylene glycol dioctanoate, cetyl octanoate, cocoyl octanoate / decanoate, tridecyl octanoate, 2-ethylhexyl palmitate, alkyl benzoate, polyethylene glycol diheptanoate. Esters, propylene glycol bis(2-ethylhexanoate) and mixtures thereof, hexyl laurate, neopentanoates, such as isodecyl neopentanoate, isotridecyl neopentanoate, isostearyl neopentanoate or 2-octyldodecyl neopentanoate, isononanoates, such as isononyl isononanoate, isotridecyl isononanoate or octyl isononanoate, erucic acid esters, isopropyl lauroyl sarcosinate, diisopropyl sebacate, isocetyl stearate, isodecyl neopentanoate, isostearyl benzyl acid or myristyl myristate; and mixtures thereof; iv) Hydroxylated esters, such as polyglycerol-2 triisostearate; v) Aromatic esters, such as tridecyl trimellitate, C12-C15 alcohol benzoate, 2-phenylethyl benzoate and butyl octyl salicylate; vi) Straight-chain fatty acid esters having a total number of carbon atoms ranging from 35 to 70, such as pentaerythritol tetranonanoate; vii) Esters of C24-C28 branched fatty acids or fatty alcohols, such as triisoarachidyl citrate, pentaerythritol tetraisonononate, triisostearate, tri(2-decyltetradecanoate)glyceryl, pentaerythritol tetraisostearate, polyglycerol-2-tetraisostearate or pentaerythritol tetra(2-decyltetradecanoate). viii) Polyesters obtained by condensation of dimers and / or trimers of unsaturated fatty acids and diols, such as those with the following INCI names: dilinoleic acid / butanediol copolymer or dilinoleic acid / propylene glycol copolymer; polyesters obtained by condensation of fatty acid dimers and diol dimers, such as dimer linoleyl alcohol dimer linoleate. Synthetic ethers of the formula R1-O-R2 (ix), wherein R1 and R2 may be the same or different, and each independently represents a straight-chain, branched, or cyclic C6-C24 alkyl group, particularly C6-C18 alkyl, and more particularly C8-C12 alkyl. It is preferable that R1 and R2 are the same. Straight-chain alkyl groups that may be mentioned include hexyl, heptyl, octyl, nonyl, decyl, undecyl, dodecyl, tridecyl, tetradecyl, pentadecyl, hexadecyl, heptadecanyl, octadecyl, nonadecanyl, eicosyl, benzyl, dodecyl, tridecyl, and tetradecyl. Branched alkyl groups that may be mentioned include 1,1-dimethylpropyl, 3-methylhexyl, 5-methylhexyl, ethylhexyl, 2-ethylhexyl, 5-methyloctyl, 1-ethylhexyl, 1-butylpentyl, 2-butyloctyl, isotriadecyl, 2-pentylnonyl, 2-hexyldecyl, isostearyl, 2-heptylundecyl, 2-octyldodecyl, 1,3-dimethylbutyl, l-(l-methylethyl)-2-methylpropyl, 1,1,3,3-tetramethylbutyl, 3,5,5-trimethylhexyl, l-(2-methylpropyl)-3-methylbutyl, 3,7-dimethyloctyl, and 2-(l,3,3-trimethylbutyl)-5,7,7-trimethyloctyl. As cyclic alkyl groups, references may be made to cyclohexyl, 3-methylcyclohexyl and 3,3,5-trimethylcyclohexyl, dilauryl ether, diisostearyl ether, dioctyl ether, nonylphenyl ether, cetyl dimethyl butyl ether, cetyl isobutyl ether and mixtures thereof. In non-volatile ether oils, references may be made to dioctyl ether, for example, under the reference name Cetiol OE sold by BASF; x) A carbonate of the formula R8-OC(O)-O-R9, wherein R8 and R9 may be the same or different, representing a straight or branched C4 to C12, and especially C6 to C10 alkyl chain; the carbonate oil may be dicaprylyl carbonate (or dioctyl carbonate), which is sold by BASF under the name Cetiol CC®, bis(2-ethylhexyl) carbonate, which is sold by Evonik under the name Tegosoft DEC®, dipropylheptyl carbonate (from BASF's Cetiol 4 AII), dibutyl carbonate, dinepentyl carbonate, dipentyl carbonate, dinepentyl carbonate, dinepentyl carbonate, diheptyl carbonate, diisononyl carbonate or dinonyl carbonate, and more particularly dioctyl carbonate; xi) Vinylpyrrolidone copolymers, such as vinylpyrrolidone / 1-hexadecene copolymers (INCI name); xii) Higher C6-C26 fatty acids that are liquid at room temperature (25°C), such as oleic acid, linoleic acid, linolenic acid, or isostearic acid; and xiii) Its mixture.
[0155] According to a particular embodiment, the composition comprises at least one oil selected from volatile C8-C16 alkane oils, non-volatile silicone oils, non-polar non-volatile hydrocarbon oils other than liquid paraffin, polar non-volatile hydrocarbon oils as defined above, and mixtures thereof, more particularly selected from polar non-volatile hydrocarbon oils and mixtures thereof.
[0156] According to a particular embodiment, the composition comprises at least one oil selected from polar nonvolatile hydrocarbon oils; more particularly, the composition according to the invention comprises at least one oil selected from polar nonvolatile hydrocarbon oils and does not contain any nonpolar nonvolatile hydrocarbon oils; even more particularly, the composition according to the invention comprises at least one oil selected from polar nonvolatile hydrocarbon oils and does not contain any nonpolar nonvolatile hydrocarbon oils, nonvolatile fluorinated oils, nonvolatile silicone oils, or volatile oils.
[0157] According to a specific implementation plan, the polar non-volatile hydrocarbon oil is selected from: i) Saturated, unsaturated, straight-chain or branched C10-C26 fatty alcohols, which are liquid at room temperature (25°C), especially monohydric alcohols. In particular, C10-C26 alcohols are fatty alcohols, and they are especially branched when they contain at least 16 carbon atoms; more particularly, fatty alcohols contain 10 to 24 carbon atoms, and even more particularly 12 to 22 carbon atoms, especially, for example, lauryl alcohol, isostearyl alcohol, oleyl alcohol, 2-butyloctanol, 2-undecylpentadecanol, 2-hexyldecyl alcohol, isocetyl alcohol, octyldodecyl alcohol and mixtures thereof; ii) Triglycerides composed of fatty acid esters of glycerol, particularly whose fatty acids may have chain lengths ranging from C4 to C36, and especially from C18 to C36; these oils may be straight-chain or branched and saturated or unsaturated; for example, heptanoic or caprylic triglycerides, caprylic / capric triglycerides, vegetable oils such as wheat germ oil, sunflower oil, grapeseed oil, sesame oil, corn oil, almond oil, castor oil, shea butter, avocado oil, olive oil, etc., may be specifically mentioned. Olive oil, soybean oil, sweet almond oil, palm oil, rapeseed oil, cottonseed oil, hazelnut oil, macadamia nut oil, jojoba oil, alfalfa oil, poppy seed oil, pumpkin seed oil, zucchini oil, blackcurrant oil, evening primrose oil, millet oil, barley oil, quinoa oil, rye oil, safflower oil, tamarisk oil, passion fruit oil, musk rose oil, peanut oil, coconut oil, argan oil, passion fruit oil, kaya oil; liquid fractions of shea butter and cocoa butter; and mixtures thereof; iii) Straight-chain aliphatic hydrocarbon esters of formula RC(O)-OR', wherein RC(O)-O- represents a carboxylic acid residue containing 2 to 40 carbon atoms, and R' represents a hydrocarbon chain containing 1 to 40 carbon atoms, an aliphatic hydrocarbon ester of alkylene glycol, especially ethylene glycol or propylene glycol, advantageously having a total number of carbon atoms of at least 10. Examples of such esters may include isoamyl laurate, cetearyl octanoate, isopropyl stearate or isostearyl octanoate, ethyl palmitate, 2-ethylhexyl palmitate, isostearyl isostearate, octyl stearate, isostearyl heptanoate, octanoate, decanoate or castor oil esters of alcohols or polyols, such as propylene glycol dioctanoate, cetyl octanoate, cocoyl octanoate / decanoate, tridecyl octanoate, 2-ethylhexyl palmitate, alkyl benzoate, polyethylene glycol diheptanoate. Esters, propylene glycol bis(2-ethylhexanoate) and mixtures thereof, hexyl laurate, neopentanoates, such as isodecyl neopentanoate, isotridecyl neopentanoate, isostearyl neopentanoate or 2-octyldodecyl neopentanoate, isononanoates, such as isononyl isononanoate, isotridecyl isononanoate or octyl isononanoate, erucic acid esters, isopropyl lauroyl sarcosinate, diisopropyl sebacate, isocetyl stearate, isodecyl neopentanoate, isostearyl benzyl acid or myristyl myristate; and mixtures thereof; Synthetic ethers of the formula R1-O-R2 (ix), wherein R1 and R2 may be the same or different, and each independently represents a straight-chain, branched, or cyclic C6-C24 alkyl group, particularly C6-C18 alkyl, and more particularly C8-C12 alkyl. It is preferable that R1 and R2 are the same. Straight-chain alkyl groups that may be mentioned include hexyl, heptyl, octyl, nonyl, decyl, undecyl, dodecyl, tridecyl, tetradecyl, pentadecyl, hexadecyl, heptadecanyl, octadecyl, nonadecanyl, eicosyl, benzyl, dodecyl, tridecyl, and tetradecyl. Branched alkyl groups that may be mentioned include 1,1-dimethylpropyl, 3-methylhexyl, 5-methylhexyl, ethylhexyl, 2-ethylhexyl, 5-methyloctyl, 1-ethylhexyl, 1-butylpentyl, 2-butyloctyl, isotriadecyl, 2-pentylnonyl, 2-hexyldecyl, isostearyl, 2-heptylundecyl, 2-octyldodecyl, 1,3-dimethylbutyl, l-(l-methylethyl)-2-methylpropyl, 1,1,3,3-tetramethylbutyl, 3,5,5-trimethylhexyl, l-(2-methylpropyl)-3-methylbutyl, 3,7-dimethyloctyl, and 2-(l,3,3-trimethylbutyl)-5,7,7-trimethyloctyl. As cyclic alkyl groups, references may be made to cyclohexyl, 3-methylcyclohexyl and 3,3,5-trimethylcyclohexyl, dilauryl ether, diisostearyl ether, dioctyl ether, nonylphenyl ether, cetyl dimethyl butyl ether, cetyl isobutyl ether and mixtures thereof. In non-volatile ether oils, references may be made to dioctyl ether, for example, under the reference name Cetiol OE sold by BASF; x) A carbonate of the formula R8-OC(O)-O-R9, wherein R8 and R9 may be the same or different, representing a straight or branched C4 to C12, and especially C6 to C10 alkyl chain; the carbonate oil may be dicaprylyl carbonate (or dioctyl carbonate), which is sold by BASF under the name Cetiol CC®, bis(2-ethylhexyl) carbonate, which is sold by Evonik under the name Tegosoft DEC®, dipropylheptyl carbonate (from BASF's Cetiol 4 AII), dibutyl carbonate, dinepentyl carbonate, dipentyl carbonate, dinepentyl carbonate, dinepentyl carbonate, diheptyl carbonate, diisononyl carbonate or dinonyl carbonate, and more particularly dioctyl carbonate; More specifically, the polar non-volatile hydrocarbon oils are selected from: ii) Triglycerides composed of fatty acid esters of glycerol, particularly whose fatty acids may have chain lengths ranging from C4 to C36, and especially from C18 to C36; these oils may be straight-chain or branched and saturated or unsaturated; for example, heptanoic or caprylic triglycerides, caprylic / capric triglycerides, vegetable oils such as wheat germ oil, sunflower oil, grapeseed oil, sesame oil, corn oil, almond oil, castor oil, shea butter, avocado oil, olive oil, etc., may be specifically mentioned. Olive oil, soybean oil, sweet almond oil, palm oil, rapeseed oil, cottonseed oil, hazelnut oil, macadamia nut oil, jojoba oil, alfalfa oil, poppy seed oil, pumpkin seed oil, zucchini oil, blackcurrant oil, evening primrose oil, millet oil, barley oil, quinoa oil, rye oil, safflower oil, tamarisk oil, passionflower oil, musk rose oil, peanut oil, coconut oil, argan oil, passionflower oil, kaya oil; liquid fractions of shea butter and cocoa butter; and mixtures thereof.
[0158] According to one particular embodiment, the composition comprises at least one oil selected from the following: - Polar, non-volatile hydrocarbon oils of the triglyceride type, composed of fatty acids and glycerol esters, particularly whose fatty acids can have chain lengths ranging from C4 to C36, and especially C18 to C36. These oils can be straight-chain or branched, and saturated or unsaturated, and are selected from soybean oil, jojoba seed oil, shea butter olein, caprylic and caprylic triglycerides, and mixtures thereof. - Volatile C8-C16 alkane oils, such as C9-C12 alkanes and isoparaffins. -Non-polar, non-volatile oils such as squalane, A synthetic ether-type polar nonvolatile hydrocarbon oil of formula R1-O-R2, wherein R1 and R2 may be the same or different, and each independently represents a straight-chain, branched, or cyclic C6-C24 alkyl group, particularly C6-C18 alkyl, and more particularly C8-C12 alkyl, such as dioctyl ether. - Non-volatile silicone oils, such as polydimethylsiloxane, - Polar, non-volatile hydrocarbon oils of the saturated, unsaturated, straight-chain or branched C10-C26 fatty alcohol type, which are liquid at room temperature (25°C), such as octyldodecaneol. - Polar, non-volatile hydrocarbon oils, such as carbonates of the formula R8-OC(O)-O-R9, where R8 and R9 may be the same or different, representing straight-chain or branched C4 to C12, especially C6 to C10 alkyl chains, such as dioctyl carbonate, and - Its mixture.
[0159] According to a particular implementation, the oil is selected from octyldodecanool, soybean oil, shea butter, dioctyl carbonate, polydimethylsiloxane, jojoba oil, isoparaffins, isononyl isononanoate, caprylic / capric triglycerides, C9-C12 alkanes, squalane, dioctyl ether, and mixtures thereof.
[0160] According to a particular implementation scheme, the oil is selected from soybean oil, shea butter, jojoba oil, isononyl isononanoate, caprylic / capric triglyceride, and mixtures thereof.
[0161] According to one particular embodiment, the composition is free of liquid paraffin, i.e., the composition contains 0% liquid paraffin.
[0162] The oils according to the invention can advantageously be present in the compositions according to the invention at conventional levels for cosmetic compositions, particularly at conventional levels that allow them to exert their cosmetic effects in the compositions of the invention, especially in the cosmetic compositions according to the invention, and even more particularly at conventional levels that allow them to exert their cosmetic effects when they are the only substance exerting such cosmetic effects in the compositions according to the invention.
[0163] Oils can perform a variety of cosmetic functions, such as thickening agents, maintaining the consistency of emulsions under cold conditions, or providing a smooth appearance to the composition, especially in the case of emulsions. They can also help promote the spread and glide of the composition on the skin, as well as its penetration. Finally, oils can act on the skin through their occlusive effect, their lubricating effect (for contact), or their emollient / moisturizing effect.
[0164] The compositions according to the invention may contain a total oil content ranging from 1% to 80% by weight relative to the total weight of the composition, particularly from 2% to 60% by weight relative to the total weight of the composition, even more particularly from 5% to 40% by weight relative to the total weight of the composition, and even more particularly from 10% to 30% by weight.
[0165] "Total oil content" refers to the sum of the contents of each of the aforementioned oils present in the composition, or, when only one of these oils is present in the composition, the content of that oil.
[0166] Aromatic alcohols The compositions according to the invention may further comprise at least one aromatic alcohol of formula (II), its salt, especially a salt of an organic or inorganic base, its optical isomer, its geometric isomer, or a solvation thereof such as a hydrate: [Chemical Formula 2] in: -R 1 It indicates that the group is selected from the following: a) Straight-chain or branched hydroxy (C1-C4) alkyl groups, especially hydroxy (C1-C2) alkyl groups. b) Selected from -OR 5 -C(O)R 6 -C(O)OR 7 and -(CH2) n -C(H)(R 8 )-C(O)R 9 group, in: R 5 Represents a straight-chain or branched (C3-C4) alkyl group, which may optionally be substituted with one or more hydroxyl (OH) groups. R 6 Representing a hydrogen atom or a straight-chain or branched (C1-C4) alkyl, phenyl, or benzyl group, optionally substituted with one or more hydroxyl groups. R 7 Represents a straight-chain or branched (C1-C4) alkyl, phenyl, or benzyl group, optionally substituted with one or more hydroxyl groups. R 8 Represents a hydrogen atom or a straight-chain or branched (C1-C4) alkyl group, such as methyl or ethyl, in particular, R 8 Represents a hydrogen atom; R 9 Representing a hydrogen atom, or a straight or branched chain optionally substituted with one or more hydroxyl groups, especially a straight chain (C1-C2). 12 Alkyl groups, or straight or branched groups optionally substituted with one or more hydroxyl groups, particularly straight (C2-C3) alkyl groups. 12 alkenyl, n is 0, 1, or 2; in particular, n is 1. -R 2 This represents a hydrogen atom; a halogen atom, especially a chlorine atom; or a hydroxyl group; and -R 3 Represents a hydrogen atom, or a group selected from hydroxyl and straight-chain or branched (C1-C6) alkoxy groups, especially (C1-C4) alkoxy groups such as methoxy-OCH3 or ethoxy-OC2H5; in particular, R 3 Represents a hydrogen atom or an ethoxy group; and -R 4 It can be a hydrogen atom or a hydroxyl group; The group R should be understood 1 R 2 R 3 or R 4 At least one of them contains or represents a hydroxyl group.
[0167] More specifically, the aromatic alcohols of formula (II) of the present invention make: -When R1 -C(O)OR 7 When the group is present, then R 2 It is an -OH group; -When R 1 -C(O)R 6 When the group is present, then R 2 R 3 and R 4 At least one of them is an -OH group; -When R 1 It represents -(CH2) n -C(H)(R 8 )-C(O)R 9 When the group is present, then R 2 It is an -OH group.
[0168] In particular, aromatic alcohols can have the following formula (II): [Chemical Formula 3] in: R 1 Selected from: i) Straight-chain or branched hydroxy (C1-C4) alkyl groups, especially hydroxy (C1-C2) alkyl groups, such as hydroxymethyl or hydroxyethyl. ii)-OR 5 Group, wherein R 5 It indicates (C3-C4) hydroxyalkyl, in particular, -OR 5 It represents -O-CH2-CH(OH)-CH2OH. iii)-C(O)R 6 Group, wherein R 6 Indicates a straight-chain or branched (C1-C4) alkyl group, particularly -C(O)R 6 It represents -C(O)-CH3, iv)-C(O)OR 7 Group, wherein R 7 Indicates a straight-chain or branched (C1-C4) alkyl group, specifically, R 7 Indicates methyl, ethyl, propyl, isopropyl, butyl, isobutyl, or benzyl, and v)-CH2-CH2-C(O)R 9 Group, wherein R 9 It indicates a straight-chain or branched (C1-C6) alkyl group, in particular, -CH2-CH2-C(O)R 9 This indicates the -CH2-CH2-C(O)CH3 group; -R 2 Selected from hydrogen atoms; halogen atoms, especially chlorine atoms; and hydroxyl groups; R 3 It can be a hydrogen atom, a methoxy group, or an ethoxy group; and R 4 It can be a hydrogen atom or a hydroxyl group; The group R should be understood 1 R 2 or R 4 At least one of them contains or represents a hydroxyl group.
[0169] These compounds often act as preservatives, particularly in cosmetic compositions. Some also function as fragrances, especially in cosmetic compositions.
[0170] The term "organic base or inorganic basic salt" refers to a salt of a base or alkali as defined below. Examples of basic salts include alkali metal hydroxides such as sodium hydroxide, potassium hydroxide, and lithium hydroxide; alkaline earth metal hydroxides such as calcium hydroxide and magnesium hydroxide; hydroxides of other metals such as aluminum hydroxide and zinc hydroxide; ammonia and organic amines such as unsubstituted or hydroxylated monoalkylamines, dialkylamines, or trialkylamines; dicyclohexylamine; tributylamine; pyridine; N-methyl-N-ethylamine; diethylamine; triethylamine; mono(2-hydroxyalkylamine), di(2-hydroxyalkylamine), or tri(2-hydroxyalkylamine), such as mono(2-hydroxyethyl)amine, di(2-hydroxyethyl)amine, or tri(2-hydroxyethyl)amine, 2-hydroxy-tert-butylamine, tri(hydroxymethyl)methylamine; N,N-dialkyl-N-(hydroxyalkyl)amine, such as N,N-dimethyl-N-(2-hydroxyethyl)amine; N-methyl-D-glucosamine; and amino acids such as arginine and lysine.
[0171] For the purposes of this invention, the term "alkyl" refers to a saturated, straight-chain or branched, substituted or unsubstituted monovalent hydrocarbon group, particularly methyl, ethyl, propyl, isopropyl, butyl or tert-butyl.
[0172] The term "hydroxyalkyl" refers to a saturated, straight-chain or branched hydrocarbon group containing at least one -OH group. Hydroxy (C1-C4)alkyl is a saturated, straight-chain or branched C1-C4 hydrocarbon group containing at least one -OH group, particularly a single -OH group. Hydroxy (C1-C2)alkyl is a saturated, straight-chain or branched C1-C2 hydrocarbon group containing at least one -OH group, particularly a single -OH group.
[0173] According to a particular embodiment, the hydroxy(C1-C4)alkyl group is selected from hydroxymethyl, 2-hydroxyethyl, 2-hydroxypropyl, 3-hydroxypropyl, 1-(hydroxymethyl)-2-methylpropyl, 2-hydroxybutyl, 3-hydroxybutyl, 4-hydroxybutyl, 2,3-dihydroxypropyl, 1-(hydroxymethyl)-2-hydroxyethyl, 2,3-dihydroxybutyl, 3,4-dihydroxybutyl, and 2-(hydroxymethyl)-3-hydroxypropyl. Specifically, the hydroxy(C1-C4)alkyl group is hydroxymethyl or 2-hydroxyethyl.
[0174] A "halogen atom" refers to one of the chemical elements in Group 17 of the periodic table, namely fluorine, chlorine, bromine, or iodine. In particular, the halogen atom is a chlorine atom.
[0175] According to a specific implementation plan, R 1 Selected from (C1-C2) hydroxyalkyl, 2-hydroxyethyl, hydroxymethyl, -O-CH2-CH(OH)-CH2OH, -CH2-CH2-C(O)-CH3 and -C(O)-OCH3 groups. -R 2 Selected from hydrogen atoms, halogen atoms, especially chlorine atoms, and hydroxyl groups. R 3 Selected from hydrogen atoms and -O-C2-H5 groups, and R 4 It is a hydrogen atom.
[0176] According to one implementation plan, R 1 R represents hydroxy(C1-C4)alkyl, more particularly hydroxy(C1-C2)alkyl. 2 R represents a hydrogen atom. 3 Represents hydrogen atoms and R 4 It represents a hydrogen atom.
[0177] According to a specific implementation plan, R 1 R represents 2-hydroxyethyl. 2 R represents a hydrogen atom. 3 Represents hydrogen atoms and R 4 It represents a hydrogen atom.
[0178] According to a specific implementation plan, R 1 R represents hydroxymethyl. 2 R represents a hydrogen atom. 3 Represents hydrogen atoms and R 4 It represents a hydrogen atom.
[0179] According to a specific implementation plan, R 1 Indicates -OR 5 Group, wherein R 5R represents a straight-chain or branched (C3-C4) alkyl group substituted with one or more hydroxyl groups. 2 R represents a halogen atom. 3 Represents hydrogen atoms and R 4 Represents a hydrogen atom. More specifically, R 1 Indicates -OR 5 Group, wherein R 5 R represents a straight-chain (C3-C4) alkyl group substituted with two hydroxyl groups. 2 R represents a halogen atom. 3 Represents hydrogen atoms and R 4 It represents a hydrogen atom.
[0180] According to a specific implementation plan, R 1 Represents the -O-CH2-CH(OH)-CH2OH group, R 2 R represents a chlorine atom. 3 Represents hydrogen atoms and R 4 It represents a hydrogen atom.
[0181] According to a specific implementation plan, R 1 It represents -(CH2) n -C(H)(R) 8 -C(O)R 9 Group, wherein R 8 Represents a hydrogen atom or a methyl or ethyl group, and R 9 Indicates a straight chain (C1-C1) that is optionally substituted with a hydroxyl group. 12 )alkyl or optionally hydroxylated (C2-C 12 )alkenyl, and n as defined above; in particular, n is 1, R 2 R represents a hydroxyl group. 3 Represents -OCH3 or -OC2H5 groups and R 4 Represents a hydrogen atom. More specifically, R 1 It represents -CH2-CH2-C(O)R 9 Group, R 9 Indicates a straight chain (C1-C) 12 )alkyl, especially straight-chain (C1-C6) alkyl, such as methyl, R 2 R represents a hydroxyl group. 3 Represents the -OC2H5 group and R 4 It represents a hydrogen atom.
[0182] According to a specific implementation plan, R 1 -C(O)OR 7 Group, wherein R 7 R represents a straight-chain or branched (C1-C4) alkyl, phenyl, or benzyl group optionally substituted with one or more hydroxyl groups. 2 R represents a hydroxyl group.3 Represents hydrogen atoms and R 4 It represents a hydrogen atom.
[0183] According to a specific implementation plan, R 1 Represents the -C(O)-OCH3 group, R 2 R represents a hydroxyl group. 3 Represents hydrogen atoms and R 4 It represents a hydrogen atom.
[0184] According to a particular embodiment, the aromatic alcohol of formula (II) is selected from phenylethanol; benzyl alcohol; chlorophenoxy (also known as 3-(4-chlorophenoxy)-1,2-propanediol); gingerone; ethyl gingerone (also known as 4-(3-ethoxy-4-hydroxyphenyl)but-2-one); vanillin; parabens, especially (C1-C6) alkyl esters or aryl esters of parabens, especially methylparaben, ethylparaben, propylparaben, isopropylparaben, butylparaben, isobutylparaben, or benzylparaben; their salts and mixtures thereof.
[0185] According to a particular embodiment, the aromatic alcohol of formula (II) is selected from phenylethanol; benzyl alcohol; chlorophenoxy (also known as 3-(4-chlorophenoxy)-1,2-propanediol); gingerone; ethyl gingerone (also known as 4-(3-ethoxy-4-hydroxyphenyl)but-2-one); p-hydroxybenzoic acid esters, especially methyl p-hydroxybenzoate; their salts and mixtures thereof.
[0186] The compositions according to the invention particularly comprise a total content of aromatic alcohols of formula (II) ranging from 0.01 wt% to 3 wt% relative to the total weight of the composition, particularly from 0.05 wt% to 1.5 wt% relative to the total weight of the composition, and even more particularly from 0.1 wt% to 1.0 wt%.
[0187] The term “total content of aromatic alcohols of formula (II)” refers to the sum of the contents of each aromatic alcohol of formula (II) present in the composition, or, when only one aromatic alcohol of formula (II) is present in the composition, it refers to the content of that aromatic alcohol of formula (II).
[0188] Organic fillers The compositions according to the present invention may also contain one or more organic fillers.
[0189] For the purposes of this invention, the term "organic filler" is intended to mean any form of colorless or white organic, natural or synthetic solid particles that are insoluble in and dispersed in the medium of the composition.
[0190] The compositions according to the invention may further comprise at least one organic filler selected from unmodified starch, N-acyl amino acids, their salts, and mixtures thereof.
[0191] Unmodified starch The compositions according to the present invention may contain one or more unmodified starches.
[0192] For the purposes of this invention, "unmodified starch" refers to natural starch, or starch that has not been chemically or physically modified, particularly by one or more of the following reactions: pregelatinization, oxidation, crosslinking, esterification, etherification, amidation, and heat treatment.
[0193] The unmodified starch molecules used in this invention can be derived from starch of any plant source, particularly cereal and tuber crops; more specifically, they can be starch from corn, rice, cassava, barley, potato, wheat, sorghum, peas, or oats.
[0194] According to a particular implementation, the unmodified starch is selected from corn starch, rice starch, potato starch and mixtures thereof; in particular, the unmodified starch is selected from corn starch or potato starch.
[0195] According to one particular embodiment, the composition according to the invention is completely free of cassava starch; in particular, the composition according to the invention is completely free of unmodified cassava starch.
[0196] According to one particular embodiment, the unmodified starch in the composition used in the present invention is corn starch, such as corn starch sold by Roquette under the name Beauty-by-Roquette ST005.
[0197] Starch may be present in the composition according to the invention in an amount ranging from 0.1% to 10% relative to the total weight of the composition, particularly from 0.5% to 5% relative to the total weight of the composition, and more particularly from 1% to 2.5% relative to the total weight of the composition, for example, in an amount of 1%, 1.5% or 2% relative to the total weight of the composition.
[0198] N-acyl amino acids and their salts The compositions according to the invention may contain one or more N-acyl amino acids, their salts, and mixtures thereof.
[0199] According to the present invention, the “salt” of an N-acyl amino acid refers to a salt formed from an inorganic or organic acid or an inorganic or organic base.
[0200] Examples of acid salts include sulfates, citrates, acetates, oxalates, chlorides, bromides, iodides, nitrates, bisulfates, phosphates, isonicotinates, lactates, salicylates, tartrates, tannates, pantothenates, hydrogen tartrates, ascorbic acid salts, succinates, maleates, gentisinates, fumarates, gluconates, glucurons, glycosides, formates, benzoates, glutamates, methanesulfonates, ethanesulfonates, benzenesulfonates, p-toluenesulfonates, glutamates, and aspartates.
[0201] Examples of basic salts may include hydroxides of alkali metals such as sodium, potassium, and lithium; hydroxides of alkaline earth metals such as calcium and magnesium; hydroxides of other metals such as aluminum and zinc; ammonia and organic amines such as unsubstituted or hydroxylated monoalkylamines, dialkylamines, or trialkylamines; dicyclohexylamine; tributylamine; pyridine; N-methyl-N-ethylamine; diethylamine; triethylamine; mono(2-hydroxyalkylamine), di(2-hydroxyalkylamine), or tri(2-hydroxyalkylamine), such as mono(2-hydroxyethyl)amine, di(2-hydroxyethyl)amine, or tri(2-hydroxyethyl)amine, 2-hydroxy-tert-butylamine, or tri(hydroxymethyl)methylamine; N,N-dialkyl-N-(hydroxyalkyl)amine, such as N,N-dimethyl-N-(2-hydroxyethyl)amine; N-methyl-D-glucosamine; and amino acids such as arginine and lysine.
[0202] N-acyl amino acids suitable as organic fillers according to the invention comprise at least one acyl group having 8 to 22 carbon atoms, particularly 2-ethylhexanoyl, decanoyl, lauroyl, myristoyl, palmitoyl, stearoyl, or cocoyl, especially lauroyl.
[0203] The amino acid can be, for example, lysine, glutamic acid or alanine, with lysine being preferred.
[0204] Amino acids can be in D or L configuration, especially L.
[0205] According to a particular embodiment of the invention, the C8-C22 N-acyl amino acid is selected from lauroyl lysine, its salts and mixtures thereof, particularly N-lauroyl-L-lysine, its salts and mixtures thereof.
[0206] N-Lauroyl-L-lysine is specifically sold by Ajinomoto under the name Amihope LL®.
[0207] N-acyl amino acids and their salts may be present in the compositions according to the invention in a range of 0.1% to 15% by weight, particularly 1% to 10% by weight, and more particularly 2% to 4% by weight, for example 3% by weight, relative to the total weight of the composition.
[0208] Organic fillers may be present in the compositions according to the invention in a total amount ranging from 0.1% to 15% by weight, particularly from 0.5% to 10% by weight, and more particularly from 1% to 4% by weight relative to the total weight of the composition.
[0209] The composition according to the invention may comprise one or more lysosomes according to the invention and one or more organic fillers, wherein the weight ratio of lysosome / organic filler is between 0.0001 and 0.04, particularly between 0.0002 and 0.004, and even more particularly between 0.0006 and 0.002.
[0210] Nonionic surfactants The compositions according to the invention may further comprise at least one nonionic surfactant, particularly selected from nonionic surfactants containing one or more carbohydrate residues, C6-C 30 Nonionic surfactants of the fatty acid chain alkanolamide type.
[0211] For the purposes of this invention, the term "surfactant" refers to any compound that alters the surface tension between two surfaces. Surfactant compounds are amphiphilic molecules, meaning they have two parts with different polarities: one part is lipophilic (retaining fatty acids) and nonpolar, and the other part is hydrophilic (miscible with water) and polar. Therefore, they allow the two immiscible phases to dissolve by interacting with the nonpolar (i.e., lipophilic and therefore hydrophobic) phase via their hydrophobic portion; while for the polar phase, it will interact via its hydrophilic portion.
[0212] The term "nonionic surfactant" refers to a surfactant that does not have a net charge (i.e., it does not become ionized in water).
[0213] Nonionic surfactants containing one or more carbohydrate residues The compositions according to the invention may further contain at least one nonionic surfactant comprising one or more carbohydrate residues.
[0214] For the purposes of this invention, "carbohydrate" refers to sugar or carbohydrate-type compounds, which correspond to molecules that are essentially composed of carbon, hydrogen, and oxygen atoms.
[0215] According to one particular implementation, the carbohydrate residue is a monosaccharide containing 5 to 6 carbon atoms, more particularly selected from glucose, fructose, xylose or galactose, and even more particularly glucose.
[0216] According to a particular embodiment, the nonionic surfactant containing one or more carbohydrate residues is selected from: (i) Fatty acid esters of sugars, such as fatty acid (poly)glycerides of glucose or alkyl glucose, having straight or branched, saturated or unsaturated C6-C22 hydrocarbon chains, especially C16-20 hydrocarbon chains. (ii) fatty alcohol ethers of sugars, such as alkyl (poly)glycosides; and (iii) Its mixture.
[0217] According to a particular embodiment, the nonionic surfactant comprising one or more carbohydrate residues is selected from alkyl (poly)glycosides and fatty acid (poly)glycerides of glucose or alkyl glucose having straight or branched, saturated or unsaturated C6-C22 hydrocarbon chains, particularly C16-20 hydrocarbon chains, and mixtures thereof.
[0218] -alkyl(poly)glycoside Alkyl (poly)glycoside type nonionic surfactants are specifically represented by the following general formula (III): [Chemical Formula 4] R 1 O-(R 2 O) t -(G) v (III) in: -R 1 It means a straight-chain or branched alkyl or alkenyl group containing 6 to 24 carbon atoms, and particularly 8 to 20 carbon atoms, or an alkylphenyl group containing 6 to 24 carbon atoms, and particularly 8 to 20 carbon atoms; -R 2 This indicates an alkylene group containing 2 to 4 carbon atoms. -G indicates a sugar unit containing 5 to 6 carbon atoms; -t indicates a range of 0 to 10, and specifically values from 0 to 4; -v indicates a range of 1 to 15, and specifically values from 1 to 4.
[0219] According to a particular embodiment, the alkyl (poly)glycoside surfactant is a compound of the above formula, wherein: -R 1 This refers to a straight-chain or branched, saturated or unsaturated alkyl group containing 8 to 20 carbon atoms. -R 2 This indicates an alkylene group containing 2 to 4 carbon atoms. -t indicates a range of 0 to 3, and specifically, a value equal to 0. -G indicates glucose, fructose, or galactose, especially glucose. - The degree of aggregation, i.e., the value of v, can range from 1 to 15, and especially from 1 to 4; the average degree of aggregation is more specifically between 1 and 2.
[0220] The glycosidic bonds between sugar units are usually of the 1-6 or 1-4 type, especially the 1-4 type.
[0221] Examples of alkyl (poly)glycosides include octyl / decyl glucoside, such as the product sold by SEPPIC under the name Oramix CG 110L®; decyl glucoside sold by Applechem under the name Sorbithix L-100®; arachidonic glucoside, optionally as a mixture with arachidonic alcohol and betaine alcohol, such as the product sold by SEPPIC under the name Montanov 202®; cetylstearyl glucoside, optionally as a mixture with cetylstear alcohol, such as the product sold by SEPPIC under the name Montanov 68MB®, by BASF under the name Emulgade PL 68 / 50®, and by Evonik Goldschmidt under the name Tego Care CG 90 MB®; cocoyl glucoside, such as the product sold by BASF under the name Lamesoft PO65®; and octyldodecanoyl xyloside, such as the product sold by SEPPIC under the name Fluidanov 20X.
[0222] Alkyl (poly)glycosides can be used as mixtures with at least one fatty alcohol, particularly fatty alcohols containing 6 to 24 carbon atoms, and more particularly 8 to 20 carbon atoms.
[0223] For example, fatty alcohols and alkyl (poly)glycosides can be used in combination, wherein the alkyl portion of the alkyl (poly)glycoside is the same as the alkyl portion of the selected fatty alcohol.
[0224] The fatty alcohol / alkyl polyglycoside emulsion mixtures defined above are known in themselves. They are particularly described in applications WO92 / 06778, WO95 / 13863 and WO98 / 47610, and prepared according to the preparation methods indicated in these documents.
[0225] In fatty alcohol / alkyl (poly)glycoside mixtures, products sold by SEPPIC under the name Montanov® may be mentioned, such as the following mixtures: - Arachidol and betaine / arachidol glucoside - Montanov 202® -Cetearylstearyl / Cetearylstearyl glucoside-Montanov 68MB®.
[0226] In one particular embodiment, the composition according to the invention comprises an alkyl (poly)glycoside surfactant selected from octyl / decyl glucoside, arachidonic acid glucoside, and mixtures thereof.
[0227] In one particular embodiment, the composition according to the invention does not contain any decyl glucoside.
[0228] - Fatty acid (poly)glycerides of glucose or alkyl glucose Fatty acid (poly)glycerides containing glucose or alkyl glucose with straight or branched, saturated or unsaturated C6-C22 hydrocarbon chains, especially fatty acid (poly)glycerides containing alkyl glucose with straight, saturated C6-C22 hydrocarbon chains, especially C16-20 hydrocarbon chains, and even more particularly C18 hydrocarbon chains.
[0229] Among fatty acid (poly)glycerides containing straight-chain or branched, saturated or unsaturated C6-C22 hydrocarbon chains of glucose or alkyl glucose, polyglycerol-3-methylglucose distearate is most particularly preferred.
[0230] In commercial products, one may mention the product sold by Evonik Goldschmidt under the name Tego Care 450.
[0231] The nonionic surfactant containing one or more carbohydrate residues may be present in the composition according to the invention in an amount ranging from 0.01 wt% to 10 wt% relative to the total weight of the composition, particularly from 0.05 wt% to 8 wt%, more particularly from 0.1 wt% to 5 wt%, and even more particularly from 0.2 wt% to 3 wt% relative to the total weight of the composition.
[0232] The composition according to the invention may comprise one or more endosomal agents according to the invention and one or more nonionic surfactants according to the invention containing one or more carbohydrate residues, wherein the mass ratio of endosomal agent to nonionic surfactant containing one or more carbohydrate residues is between 0.0001 and 0.5, particularly between 0.0002 and 0.1, more particularly between 0.0004 and 0.05, and even more preferably between 0.0006 and 0.02.
[0233] C6-C30 fatty acid alkanolamides The composition according to the invention may also contain at least one component selected from C6-C. 30 Nonionic surfactants of fatty acid chain alkanolamides.
[0234] Such surfactants can be selected from mono- and di-alkanolamides of formula (IV): [Chemical Formula 5] R 1 CONR 2 R 3 (IV) in: R1 It is a straight-chain or branched, saturated or unsaturated hydrocarbon group containing 6 to 30 carbon atoms.
[0235] R 2 and R 3 Independently hydrogen or a straight-chain or branched, saturated or unsaturated alkanoic group containing 1 to 10 carbon atoms, provided that R 2 and R 3 Only one of them is hydrogen.
[0236] Examples of surfactants of this type include lauric acid monoethanolamide, lauric acid diethanolamide, lauric acid monopropanolamide, lauric acid monoisopropanolamide, myristic acid monoethanolamide, myristic acid diethanolamide, palmitic acid monoethanolamide, stearic acid monoethanolamide (stearamide MEA), acid monoethanolamide, oleic acid diethanolamide, oleic acid monoisopropanolamide, coconut oil fatty acid monoethanolamide (cocamide MEA), coconut oil fatty acid monopropanolamide, coconut oil fatty acid monoisopropanolamide (cocamide MIPA), erucic acid diethanolamide, palm vegetable oil fatty acid monoethanolamide, and mixtures thereof.
[0237] According to a specific implementation scheme, R in equation (IV) 1 It is a straight-chain or branched, saturated or unsaturated hydrocarbon group containing 8 to 18 carbon atoms. R 2 and R 3 Independently hydrogen or a straight-chain or branched, saturated or unsaturated alkanoic group containing 2 to 5 carbon atoms, provided that R 2 and R 3 Only one of them is hydrogen.
[0238] According to a specific implementation scheme, in equation (IV), R 2 It is hydrogen, and R 3 It is a saturated, straight-chain or branched alkanolic group containing 2 to 5 carbon atoms.
[0239] According to a specific implementation scheme, the appropriate formula (IV) C6-C 30 Fatty acid chain alkanolamides are selected from coconut oil fatty acid monoethanolamide (INCI: cocoamide MEA or cocoamide monoethanolamine), coconut oil fatty acid monoisopropanolamide (INCI: cocoamide MIPA or cocoamide monoisopropanolamine), and mixtures thereof.
[0240] Such products are available, for example, coconut oil fatty acid monoethanolamide (cocamide MEA) sold by Cognis (BASF) under the name Comperlan® 100, and coconut oil fatty acid monoisopropanolamide (cocamide MIPA) sold by Innospec Active Chemicals under the trade name Empilan® CIS.
[0241] According to a particular implementation, the C6-C 30 Fatty acid chain alkanolamides are cocamidoyl alcoholamines.
[0242] According to the C6-C of the present invention 30 Fatty acid alkanolamides may be present in amounts ranging from 0.5% to 10% by weight, more particularly from 0.1% to 5% by weight, relative to the total weight of the composition.
[0243] According to a particular embodiment, the composition according to the invention (composition A or B) comprises less than 2% by weight of fatty acids that are solid at room temperature (25°C) relative to the total weight of the composition; more particularly, the composition according to the invention comprises less than 1% by weight of fatty acids that are solid at room temperature (25°C) relative to the total weight of the composition, or even contains no (0% by weight of) fatty acids that are solid at room temperature (25°C) relative to the total weight of the composition, and particularly does not contain any stearic acid.
[0244] According to a particular embodiment, the composition according to the invention (composition A or B) contains less than 0.5% by weight of benzoic acid and / or its salts, particularly alkali metal or alkaline earth metal benzoates such as sodium benzoate, sorbic acid and / or their salts, particularly alkali metal or alkaline earth metal sorbates, including potassium sorbate, more particularly less than 0.1% by weight, or even none (0% by weight of benzoic acid and / or their salts, including sodium benzoate, and sorbic acid and / or their salts, including potassium sorbate) relative to the total weight of the composition.
[0245] According to a particular embodiment, the composition according to the invention (composition A or B) comprises less than 0.1% by weight of carrageenan, gellan gum, dextran gum, gum arabic, pectin, xanthan gum, guar gum such as hydroxypropyl guar gum, hydrogenated soybean lecithin, sodium alginate, polyacrylamide methylpropanesulfonic acid, carbomer, cellulose, sodium polyacrylate, konjac gum, agar, and arugula gum, relative to the total weight of the composition; more particularly, according to an embodiment of the invention, the composition is free of (0% by weight relative to the total weight of the composition) carrageenan, gellan gum, dextran gum, gum arabic, pectin, xanthan gum, guar gum such as hydroxypropyl guar gum, hydrogenated soybean lecithin, sodium alginate, polyacrylamide methylpropanesulfonic acid, carbomer, cellulose, sodium polyacrylate, konjac gum, agar, and arugula gum.
[0246] According to a particular embodiment, the composition according to the invention (composition A or B) contains an amount of anionic surfactant less than 0.5% by weight relative to the total weight of the composition; more particularly, the composition is free of anionic surfactant (0% by weight relative to the total weight of the composition).
[0247] According to a particular embodiment, the composition according to the invention (composition A or B) contains a cationic surfactant in an amount less than or equal to 0.5% by weight relative to the total weight of the composition; more particularly, the composition is free of cationic surfactant (0% by weight relative to the total weight of the composition).
[0248] According to a particular embodiment, the composition according to the invention (composition A or B) contains an amount of amphoteric surfactant less than or equal to 0.5% by weight relative to the total weight of the composition; more particularly, the composition is free of amphoteric surfactant (0% by weight relative to the total weight of the composition).
[0249] According to a particular embodiment, the composition according to the invention (composition A or B) contains an amount of zwitterionic surfactant less than or equal to 0.5% by weight relative to the total weight of the composition; and more particularly, it contains no zwitterionic surfactant (0% by weight relative to the total weight of the composition).
[0250] According to a particular embodiment, the composition according to the invention (composition A or B) comprises an anionic, cationic, amphoteric, and zwitterionic surfactant in an amount less than 0.5% by weight relative to the total weight of the composition, more particularly less than 0.1% by weight relative to the total weight of the composition, and even more particularly less than 0.01% by weight relative to the total weight of the composition; even more preferably, according to a particular embodiment, the composition is free of anionic, cationic, amphoteric, and zwitterionic surfactants (0% by weight relative to the total weight of the composition).
[0251] According to a particular embodiment, the composition according to the invention (composition A or B) comprises less than 0.5% by weight of the total amount of glyceryl stearate citrate, alkyl sulfate salts such as sodium lauryl sulfate, alkyl ether sulfate salts such as sodium lauryl ether sulfate, disodium cocoamphodiacetate, fatty acid polyglycerides such as polyglycerol-4-isostearate and polyglycerol-4-diisostearate, polyhydroxystearate sebacate and sodium stearate, glyceryl stearate citrate, alkyl sulfate salts such as sodium lauryl sulfate, alkyl ether sulfate salts such as sodium lauryl ether sulfate, disodium cocoamphodiacetate, fatty acid polyglycerides such as polyglycerol-4-isostearate and polyglycerol-4-diisostearate, polyhydroxystearate sebacate and sodium stearate.
[0252] According to a particular embodiment, the composition according to the invention (composition A or B) comprises less than 1% by weight of kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin and mica relative to the total weight of the composition, and more particularly comprises less than 0.5% by weight of kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin and mica relative to the total weight of the composition, or even contains no (0% by weight relative to the total weight of the composition) kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin and mica.
[0253] According to a particular embodiment, the composition according to the invention (composition A or B) comprises less than 0.1% by weight of the following relative to the total weight of the composition: fatty acids that are solid at room temperature (25°C), and particularly do not contain any stearic acid; benzoic acid and / or its salts, particularly alkali metal or alkaline earth metal benzoates such as sodium benzoate; sorbic acid and / or its salts, particularly alkali metal or alkaline earth metal sorbates, including potassium sorbate; carrageenan, gellan gum, dextran gum, gum arabic, pectin, xanthan gum, guar gum such as hydroxypropyl guar gum. Hydrogenated soybean lecithin, sodium alginate, polyacrylamide methylpropanesulfonic acid, carbomer, sodium polyacrylate, konjac gum, agar, and prickly pear gum; glyceryl stearate citrate, alkyl sulfate salts such as sodium lauryl sulfate, alkyl ether sulfate salts such as sodium lauryl ether sulfate, disodium cocoamphodiacetate, fatty acid polyglycerol esters such as polyglycerol-4-isostearate and polyglycerol-4-diisostearate, polyhydroxystearate sebacate, and sodium stearate; kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin, and mica.
[0254] The compositions according to the invention (composition A or B) may in particular be free of sucrose (i.e. contain 0% by weight of sucrose relative to the total weight of the composition).
[0255] The composition (composition B) according to the invention, which includes the anhydrous composition (composition A), may also contain water, particularly more than 35% by weight, and especially more than 40% by weight, relative to the total weight of the composition. Specifically, the composition (composition B) according to the invention may contain a water content between 45% by weight and 99% by weight relative to the total weight of the composition.
[0256] The composition (composition B) according to the invention, particularly the composition (composition A) comprising the anhydrous composition according to the invention, can be any form conventionally used in the cosmetics field, such as an aqueous gel, lotion, foam, micellar water, cream, paste, or serum.
[0257] The compositions according to the invention (composition A or B) are preferably suitable for topical application.
[0258] Therefore, the composition (composition B) according to the invention, especially the composition (composition B) comprising the anhydrous composition (composition A) according to the invention, can contain all the ingredients commonly used in contemplated topical application and application.
[0259] The compositions according to the invention (Composition B), particularly those comprising the anhydrous composition according to the invention (Composition A), can advantageously be in emulsion form, especially by dispersing an anhydrous phase in a fatty phase (W / O) or a fatty phase in an anhydrous phase (O / W), having a milky liquid or semi-liquid consistency, or a soft consistency, or even in the form of a multiple emulsion (W / O / W or O / W / O). These compositions are prepared according to methods generally known.
[0260] More particularly, compositions according to the invention (Composition B), especially compositions (Composition B) comprising the anhydrous composition of the invention (Composition A), are intended for topical application and may preferably be in the form of an emulsion, preferably in the form of an oil-in-water emulsion. Preferably, such emulsions are intended not to be washed off after application.
[0261] The compositions according to the invention (composition A or B) are preferably intended to be applied to the skin.
[0262] The composition (composition B) according to the invention, particularly comprising the anhydrous composition (composition A) according to the invention in addition to a physiologically acceptable medium, and especially the mixture of the anhydrous composition (composition A) according to the invention with a physiologically acceptable medium, can be applied by any means that enables uniform distribution, and particularly by using cotton swabs, sticks, brushes, gauze, scrapers or pads, or by spraying, and the composition (composition B) according to the invention can be removed by rinsing with water or with a mild detergent or may not be removed.
[0263] Preferably, the skin is the skin of the face, scalp, neckline, neck, arm, or forearm, or even more preferably the skin of the face (especially the forehead, nose, cheeks, and chin), neckline, and neck.
[0264] Alternatively, the composition (composition B) according to the invention, particularly the composition (composition A) according to the invention, may be in the form of a facial and / or body care or makeup product, and may be packaged, for example, as a cream in a jar or as a fluid in a tube or pump bottle or dropper bottle.
[0265] In particular, the composition (composition B) according to the invention, especially the composition (composition A) according to the invention, can be used on all keratinous materials, such as skin, scalp, hair, eyelashes, eyebrows, nails, or mucous membranes, especially in the form of hygiene products, such as products for cleaning skin, mucous membranes, and / or hair or beard, especially for cleaning skin (facial and / or body skin) and / or removing makeup from skin (facial and / or body skin), in the form of shower products, in the form of shampoos and conditioners, in the form of shaving products, in the form of body washes, and in the form of exfoliating products (also known as peelers or deep cleansers) for use on both face and body or hands after the addition of exfoliating particles.
[0266] The composition (composition B) according to the invention, particularly the composition (composition A) according to the invention, can be manufactured by any known method commonly used in the cosmetics field.
[0267] Prior to formation, the components are mixed in an order and under conditions readily determined by those skilled in the art.
[0268] According to a particular mode of the invention, other agents intended to enhance the appearance and / or texture of the skin may also be added to the composition according to the invention (composition A or B).
[0269] Purpose and Implementation Method According to one aspect, the present invention relates to an anhydrous composition (composition A) according to the invention or a composition according to the invention comprising the anhydrous composition (composition B) for the prevention and / or treatment of skin conditions associated with Staphylococcus aureus colonization in individuals in need, and particularly for cosmetic use, especially for the prevention and / or treatment of acne and / or eczema in individuals in need.
[0270] In particular, such compositions are suitable for topical application.
[0271] The non-therapeutic cosmetic method according to the invention for caring for keratin materials, particularly skin, especially acne-prone skin, may specifically include at least the topical application of an anhydrous composition (composition A) according to the invention or a composition according to the invention (composition B) containing the anhydrous composition, particularly containing the anhydrous composition in a dissolved form, to these keratin materials.
[0272] Skin may have acne or be at risk of having acne and / or have eczema or be at risk of having eczema.
[0273] The cosmetic uses and methods considered according to the present invention are non-therapeutic.
[0274] The cosmetic uses and methods of the present invention are preferably performed by topical application of the anhydrous composition according to the present invention (composition A) or a composition according to the present invention containing the anhydrous composition according to the present invention (composition B).
[0275] Topical application consists of applying the cosmetic composition externally to the skin using conventional techniques for using these compositions.
[0276] For example, the cosmetic use or method according to the invention can be performed by, for instance, by daily topical application of at least one anhydrous composition according to the invention (composition A) or at least one composition according to the invention containing the anhydrous composition (composition B) (which may be formulated as, for example, a cream, gel, serum, lotion, emulsion or makeup remover).
[0277] An extended period of time may be applied, for example, once or twice a day for a day or longer, and typically for at least 3 days, at least 4 weeks or even 4 to 15 weeks, with one or more stop times where appropriate.
[0278] According to one implementation, it is applied daily (once a day) and extended for a period of time that is typically at least 4 weeks, or even 4 to 15 weeks, with one or more stop times where appropriate.
[0279] According to one embodiment, the cosmetic treatment method according to the invention may include a single application.
[0280] Unless otherwise stated, throughout the specification including the claims, the terms “between… and…” and “scope from… to…” shall be understood to mean the inclusion limit.
[0281] The following examples illustrate the invention but do not limit its scope.
[0282] In the embodiments, unless otherwise stated, the temperature is room temperature (20°C) and expressed in degrees Celsius, and the pressure is atmospheric pressure.
[0283] Example: Scheme (Experimental Conditions) Preparation of working suspensions of Staphylococcus aureus from lyophilized ATCC 6538 (according to standard NF EN 12353) recommend).
[0284] The lyophilized material was rehydrated in trypsin-soy broth, plated on trypsin-soy agar (TSA plates), and incubated at 32.5°C for 24 hours. The cells were then recovered and resuspended in a commercial cryoprotectant solution with cryobediments for storage at -80°C for up to 14 months (long-term storage).
[0285] The -80℃ frozen beads were passaged on TSA agar slants and then incubated at 32.5℃ for 24 hours to obtain the storage culture. This storage culture was stored at 4℃ for up to 9 weeks. The working culture was obtained by passaged the storage culture onto trypsin-soy agar and incubated at 35℃ for 24 hours. The working suspension was prepared by suspending the cells of this working culture in a trypsin-peptone dilution. The suspension was calibrated to 1×10⁻⁶ by measuring the absorbance at 620 nm. 8 CFU and 3×10 8 Between CFU (colony forming units) / mL.
[0286] Assess the antimicrobial activity of the samples against Staphylococcus aureus. Test the compositions in Table 1 above.
[0287] At T=2, 7, and 11 weeks of formulation preparation, 20 g aliquots of each formulation were inoculated with 0.2 ml of calibrated Staphylococcus aureus suspension. After homogenization, the microbial content in the product represents 10 μL per gram of product. 6 The concentration of Staphylococcus aureus in CFU, i.e., 10 8 A 1% inoculation of the CFU / ml suspension was performed (inoculum content was determined by spreading the suspension on trypsin-soy agar plates and incubating at 35°C for 24 hours). After contacting at room temperature (20°C ± 3°C) for t=30 minutes and t=60 minutes, 1 gram of the mixture was weighed and then 9.0 ml of Eugon LT100 supplementary broth was added, followed by mixing until completely homogenized. The mixture was then serially diluted to a 1 / 100 dilution in Eugon LT100 supplementary broth.
[0288] Spread the diluted solution on trypsin-soy agar plates and incubate at 35°C for 48 hours until the number of surviving Staphylococcus aureus colonies is counted.
[0289] Antimicrobial activity against Staphylococcus aureus is expressed as a logarithmic decrease relative to the initial concentration and is correlated with the activity of the active compound (which is the endolysin of sequence SEQ ID NO: 1), obtained by comparing the count of surviving Staphylococcus aureus in formulations having and not having the endolysin of sequence SEQ ID NO: 1.
[0290] This method is an adaptation of the challenge test method described in the standard "ISO 11930 Cosmetics - Microbiology - Evaluation of the antimicrobial protection of cosmetic products".
[0291] Preparation of the composition Prepare the following compositions according to the information given in Tables 1 to 3 below. Prepare the samples in beakers at room temperature with magnetic stirring. Pour all components into the beakers and stir until mannitol is completely dissolved between 15 and 30 minutes. The composition, after freeze-drying, is referred to hereinafter as "rehydrated freeze-dried product".
[0292] [Table 1] [Table 2] [Table 3] Examples of protocols followed in freezing and freeze-drying: The system samples to be dried were taken into stainless steel cups (30 ml / cup) and then frozen overnight at -20°C in a GX821 freezer supplied by Labo Plus. The frozen samples were then transferred to a Christ Alpha 1-2 freeze dryer supplied by FISHER SCIENTIFIC SAS. The cryocondenser temperature was set to -55°C. The freeze dryer chamber was brought under vacuum using an E2M8 vacuum pump supplied by VWRINTERNATIONAL. The pump stabilized at 0.1 mbar when the cryocondenser temperature stabilized at -55°C. The samples were recovered after 48 hours, placed in glass jars, and stored at 25°C, 40°C, and 45°C.
[0293] Sample preparation before testing: Less than 24 hours before measuring the microbiological activity of the endolysin of sequence SEQ ID No: 1, the dried form was reconstituted by manual or magnetic stirring. 0.66 g of the dried form was weighed and 29.34 g of permeate water was added. The solution had a concentration of approximately 35 ppm of the endolysin of SEQ ID No: 1.
[0294] Results and Conclusions The results are given by the logarithmic decrease in the Staphylococcus aureus population. Values close to 0 indicate no killing of Staphylococcus aureus. Values of -5.4 indicate the killing of 99.9996% of the Staphylococcus aureus population. Therefore, the tested formulation is particularly active when the value is close to -5.4.
[0295] The first series of measurements were performed after storing the samples at temperatures of 25°C, 40°C, and 45°C for up to 13 weeks.
[0296] The results are given in Table 4 below.
[0297] [Table 4] Unexpectedly, the dried form containing mannitol and the endolysin of sequence SEQ ID NO: 1 allowed the endolysin activity of sequence SEQ ID NO: 1 to be maintained over time and at the highest level (the same as the initial value of the freeze-dried material at 25°C and the raw material alone after thawing) at the highest temperature. Important temperature control times were 2 months at 45°C and 3 months at 40°C. For a contact time of 1 hour and at the various residence times listed above, the dried form showed over 99.999% Staphylococcus aureus killing activity (log reduction less than -5).
[0298] To test the stability of the endolysin of sequence SEQ ID NO: 1, the sample was freeze-dried on a mannitol support and then exposed to a heat block drying bath from Benchmark at 110°C for 1 hour. The sample was then cooled to room temperature and reconstituted to obtain a solution with a concentration of 35 ppm of the endolysin of sequence SEQ ID NO: 1. The solution was then sent for a kill test. Three replicates were performed.
[0299] The results are given in Table 5 below.
[0300] [Table 5] After 1 hour at 110°C, the inventors observed that, compared to previously presented results, all three replicates showed loss of activity, but still exhibited activity equivalent to almost 99% of the Staphylococcus aureus killing performance. Under these conditions, the endolysin of sequence SEQ ID NO: 1 on the mannitol vector was not inactivated.
[0301] Composition A comprising the anhydrous composition according to the invention or comprising such an anhydrous composition according to the invention. Examples of instant cosmetic products based on composition (composition B) The above provides two examples of cosmetic products: The first is an instant cosmetic product comprising a package or box having two spatially separated compartments, wherein the first compartment comprises an anhydrous composition (composition A) according to the invention, and the second compartment comprises a cosmetic composition containing a hydrogel or emulsion.
[0302] Packaging or kits with two compartments can be, for example, the Ariane Push-It Pack supplied by Seriplast®, which enables recovery when the powder is mixed in a liquid.
[0303] The second is a cosmetic composition comprising an anhydrous composition (composition A) according to the invention dispersed in an oil.
[0304] sequence list SEQ ID NO: 1 M23-LST AMI2638 CBD2638 (protein) AATHEHSAQWLNNYKKGYGYGPYPLGINGGMHYGVDFFMNIGTPVKAISSGKIVEAGWSNYGGGNQIGL IENDGVHRQWYMHLSKYNVKVGDYVKAGQIIGWSGSTGYSTAPHLHFQRMVNSFSNSTAQDPMPFLKSAGYGKAGGT VTTPNTGELLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQDKSKNGSVKELKHIYSNHIKGNKITAPKPSIQGVV IHNDYGSMTPSQYLPWLYARENNGTHVNGWASVYANRNEVLWYHPTDYVEWHCGNQWANANLIGFEVCESYPGRISD KLFLENEEATLKVAADVMKSYGLPVNRNTVRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNINKMKDYFIKRIKHYYD GGKLEVSKAATIKQSDVKQEVKKQEAKQIVKATDWKQNKDGIWYKAEHASFTVTAPEGIITRYKGPWTGHPQAGVLQ KGQTIKYDEVQKFDGHVWVSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK SEQ ID NO: 2 M23-LST AMI2638 CBD2638 (Protein) MRGSHHHHHHGSAATHEHSAQWLNNYKKGYGYGPYPLGINGGMHYGVDFFMNIGTPVKAISSGKIVEAG WSNYGGGNQIGLIENDGVHRQWYMHLSKYNVKVGDYVKAGQIIGWSGSTGYSTAPHLHFQRMVNSFSNSTAQDPMPF LKSAGYGKAGGTVTPTPNTGELLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQDKSKNGSVKELKHIYSNHIKGNK ITAPKPSIQGVVIHNDYGSMTPSQYLPWLYARENNGTHVNGWASVYANRNEVLWYHPTDYVEWHCGNQWANANLIGF EVCESYPGRISDKLFLENEEATLKVAADVMKSYGLPVNRNTVRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNINKMK DYFIKRIKHYYDGGKLEVSKAATIKQSDVKQEVKKQEAKQIVKATDWKQNKDGIWYKAEHASFTVTAPEGIITRYKG PWTGHPQAGVLQKGQTIKYDEVQKFDGHVWVSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK SEQ ID NO: 3 M23-LST AMI2638 CBD2638 (Nucleic Acid) GCTGCAACACATGAACATTCAGCACAATGGTTGAATAATTACAAAAAAGGATATGGTTACGGTCCTTAT CCATTAGGTATAAATGGCGGTATGCACTACGGAGTTGATTTTTTTATGAATATTGGAACACCAGTAAAAGCTATTTC AAGCGGAAAAATAGTTGAAGCTGGTTGGAGTAATTACGGAGGAGGTAATCAAATAGGTCTTATTGAAAATGATGGAG TGCATAGACAATGGTATATGCATCTAAGTAAATATAATGTTAAAGTAGGAGATTATGTCAAAGCTGGTCAAATAATC GGTTGGTCTGGAAGCACTGGTTATTCTACAGCACCACATTTACACTTCCAAAGAATGGTTAATTCATTTTCAAATTC AACTGCCCAAGATCCAATGCCTTTCTTAAAGAGCGCAGGATATGGAAAAGCAGGTGGTACAGTAACTCCAACGCCGA ATACAGGTGAGCTCTTACGCCCTAAAGACGCAAAGAAAGATGAAAAATCACAAGTATGTAGTGGTTTGGCTATGGAA AAATATGACATTACAAATTTAAATGCTAAACAAGATAAATCAAAGAATGGGAGCGTGAAAGAGTTGAAACATATCTA TTCAAACCATATTAAAGGTAACAAGATTACAGCACCAAAACCTAGTATTCAAGGTGTGGTCATCCACAATGATTATG GTAGTATGACACCTAGTCAATACTTACCATGGTTATATGCACGTGAGAATAACGGTACACACGTTAACGGTTGGGCT AGTGTTTATGCAAATAGAAACGAAGTGCTTTGGTATCATCCGACAGACTACGTAGAGTGGCATTGTGGTAATCAATG GGCAAATGCTAACTTAATCGGATTTGAAGTGTGTGAGTCGTATCCTGGTAGAATCTCGGACAAATTATTCTTAGAAA ATGAAGAAGCGACATTGAAAGTAGCTGCGGATGTGATGAAGTCGTACGGATTACCAGTTAATCGCAACACTGTACGT CTGCATAACGAATTCTTCGGAACTTCTTGTCCACATCGTTCGTGGGACTTGCATGTTGGCAAAGGTGAGCCTTACAC AACTACTAATATTAATAAAATGAAAGACTACTTCATCAAACGCATCAAACATTATTATGACGGTGGAAAGCTAGAAG TAAGCAAAGCAGCAACTATCAAACAATCTGACGTTAAGCAAGAAGTTAAAGGCAAGAAGCAAAACAAATTGTGAAA GCAACAGATTGGAAACAGAATAAAGATGGCATTGGTATAAAGCTGAACATGCTTCGTTCACAGTGACAGCACCAGA GGGAATTATCACAAGATACAAAGGTCCTTGGACTGGTCACCCACAAGCTGGTGTATTACAAAAAGGTCAAACGATTA AATATGATGAGGTTCAAAAATTTGACGGTCATGTTTGGGTATCGTGGGAAACGTTTGAGGGCGAAACTGTATACATG CCGGTACGCACATGGGACGCTAAAACTGGTAAAGTTGGTAAGTTGTGGGGCGAAATTAAATAA SEQ ID NO: 4 6×His N-terminal tag MRGSHHHHHHGS
Claims
1. An anhydrous composition, particularly a cosmetic composition, comprising: (i) at least one endolysin derived from Staphylococcus aureus phage; and (ii) Mannitol, The endolysin comprises a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO:
2.
2. The composition according to claim 1, wherein the endosomalin comprises a protein sequence consisting of a reference amino acid sequence SEQ ID NO:
1.
3. The composition according to any one of claims 1 and 2, wherein the endolysin derived from Staphylococcus aureus phage is present in an amount ranging from 0.01% to 0.6% by weight relative to the total weight of the composition, particularly from 0.05% to 0.5% by weight relative to the total weight of the composition, and even more particularly from 0.1% to 0.3% by weight relative to the total weight of the composition.
4. The composition according to any one of claims 1 to 3, wherein the mannitol is present in an amount ranging from 30% to 90% by weight relative to the total weight of the composition, particularly from 40% to 80% by weight relative to the total weight of the composition, and even more particularly from 45% to 75% by weight relative to the total weight of the composition.
5. The composition according to any one of claims 1 to 4, wherein the composition is in the form of a lyophilized product.
6. A composition, particularly a cosmetic composition, comprising at least one anhydrous composition as defined in any one of claims 1 to 5 in a physiologically acceptable medium.
7. The anhydrous composition according to any one of claims 1 to 5 or the composition according to claim 6 for the prevention and / or treatment of skin conditions associated with Staphylococcus aureus colonization in individuals in need, and particularly for cosmetic use, especially for the prevention and / or treatment of acne and / or eczema in individuals in need.
8. The cosmetic use according to claim 7, wherein the composition is suitable for topical application.
9. A non-therapeutic cosmetic method for caring for keratin materials, particularly skin, especially acne-prone skin, said method comprising topically applying to these keratin materials an anhydrous composition according to any one of claims 1 to 5 or a composition according to claim 6.
10. A method for stabilizing endolysin derived from Staphylococcus aureus phage, particularly a method for drying endolysin derived from Staphylococcus aureus phage, the method comprising contacting the endolysin with mannitol, The endolysin comprises a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2, and in particular, the endolysin comprises a protein sequence consisting of reference amino acid sequence SEQ ID NO:
1.
11. The method according to claim 10, wherein (i) the endosomalin and (ii) the mannitol are mixed in an aqueous liquid and then freeze-dried.
12. The use of mannitol for stabilization, particularly drying, of endosomalin derived from Staphylococcus aureus phage, said endosomalin comprising a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from reference amino acid sequences SEQ ID NO: 1 and SEQ ID NO: 2, and in particular, said endosomalin comprising a protein sequence consisting of reference amino acid sequence SEQ ID NO:
1.
13. A kit for formulating cosmetic products, the kit comprising at least: (i) the anhydrous composition as defined in any one of claims 1 to 5; as well as (ii) A cosmetic composition containing an aqueous gel or emulsion; The anhydrous composition (i) and the cosmetic composition (ii) are each in a separate compartment, which are spatially separated.
14. A cosmetic composition comprising at least one anhydrous composition as defined in any one of claims 1 to 5, dispersed in an oil.
Citation Information
Patent Citations
Without rub off topical composition containing a fluorosilicon compound
EP0847752A1
Use of fatty alcohol based compositions for preparing emulsions, method of preparing emulsions and emulsions so obtained
WO1992006778A1
Alkylglycoside-containing concentrate and uses thereof
WO1995013863A1
Composition based on alkylpolyglycosides and fatty alcohols, and uses thereof
WO1998047610A1
Hydrocarbon mixtures and use thereof
WO2008155059A2