VvHDZ28 gene for improving drought tolerance of grapes and application of VvHDZ28 gene

Abstract

The invention discloses a VvHDZ28 gene for improving the drought tolerance of grapes. The sequence of a coding region of the gene is shown as SEQ ID No. 1; the amino acid sequence of the protein coded by the VvHDZ28 gene is as shown in SEQ ID No. 2. The invention also discloses an application of the VvHDZ28 gene in improving the drought resistance of grapes, and the VvHDZ28 gene is introduced into Arabidopsis thaliana and grape calluses by constructing a pCAMBIA2300-35s-3 * Flag-VvHDZ28 overexpression vector and adopting an agrobacterium tumefaciens-mediated genetic transformation method. The Cauvignon sauvignon VvHDZ28 gene provided by the invention can obviously improve the drought resistance of grapes, and the VvHDZ28 gene reduces the content of H2O2 and O2 <.-> in a transgenic plant by promoting the synthesis and accumulation of ABA, thereby achieving the biological function of improving the drought resistance of the transgenic plant.

Description

Technical Field

[0001] This invention belongs to the field of genetic engineering technology, specifically relating to improving the drought resistance of grapes. VvHDZ28 Genes, and also involve this VvHDZ28 Application of genes in improving the drought resistance of grapes. Background Technology

[0002] Drought, as a major limiting factor, leads to stomatal closure, decreased photosynthetic rate, impaired nutrient absorption, and excessive accumulation of reactive oxygen species (ROS) in plants, severely impacting plant growth and development and causing a significant drop in yield. To mitigate the adverse effects of drought, plants have evolved a series of highly complex mechanisms to cope and resist it, such as the sensing and transduction of stress signals, the regulation of ion and osmotic balance, and the activation of antioxidant defense systems. The plant hormone abscisic acid (ABA) plays a crucial role in this process. Drought promotes the rapid synthesis and accumulation of ABA, which then acts as a key signaling molecule for drought stress, initiating a series of downstream physiological and molecular responses to enhance plant drought resistance. These responses include ABA activating ion channels on the cell membrane to promote potassium metabolism. ＋ Ion efflux and H-ATPase inactivation lead to water loss and shrinkage of guard cells and stomata closure, thus preventing further water loss. ABA promotes the accumulation of osmotic regulators such as proline and organic acids, maintaining cell osmotic pressure under stress conditions. ABA can also fine-tune root structure and alter the content of root exudates to improve plant drought resistance.

[0003] Transcription factors (TFs) are a class of proteins that bind to specific DNA sequences in the promoter regions of target genes to regulate the expression of downstream target genes. Transcription factors play a crucial role in plant drought response regulatory networks. Several plant transcription factor families, such as AP2 / ERF, bZIP, MYB, bHLH, WRKY, and HD-ZIP, have been identified and demonstrated to play core regulatory roles in plant drought response networks.

[0004] HD-ZIP is a family of transcription factors unique to plants. Each member of this family contains a homologous domain (HD) and a downstream leucine zipper motif (LZ). Based on structural and functional characteristics, the HDZ family is divided into four main subfamilies (I-IV). Several genes in the HDZI subfamily participate in regulating plant tolerance to drought stress through both ABA-dependent and ABA-independent pathways. In the ABA-dependent pathway, HDZ transcription factors participate in stress responses by regulating ABA synthesis or crosstalking with ABA signaling. For example, apple HDZI transcription factors... MdHB-7 The drought resistance of transgenic apples is enhanced by promoting ABA accumulation, stomatal closure, and ROS scavenging. Maize HDZI transcription factor. ZmHB53Directly with ABA receptors ZmPYL4 By combining and upregulating its expression, the sensitivity and drought resistance of transgenic plants to ABA can be improved. However, not all HDZ genes regulating plant responses to drought stress require the involvement of ABA. For example, coffee HDZ I transcription factor... CaHB12 The mechanism by which transgenic plants acquire drought resistance is not related to the ABA-dependent pathway, but to other pathways such as the heat shock response.

[0005] Grape( Vitis vinifera Grapes (L.) are one of the world's most important economic fruit trees, currently planted on 7.4 million hectares worldwide. However, rising temperatures and unstable rainfall patterns have led to frequent droughts, severely impacting grape yields and distribution. Therefore, identifying key genes regulating drought resistance in grapes and elucidating their functional mechanisms is crucial for breeding new drought-resistant grape varieties and ensuring the stable development of the industry. Summary of the Invention

[0006] The first objective of this invention is to provide a method to improve the drought resistance of grapes. VvHDZ28 This gene has a biological function that enhances the drought resistance of grapes.

[0007] The second object of the present invention is to provide the following: VvHDZ28 Application of genes in improving the drought resistance of grapes.

[0008] The technical solution adopted in this invention is to improve the drought resistance of grapes. VvHDZ28 The gene, the coding region sequence of which is shown in SEQ ID No. 1, and the amino acid sequence encoded by which the gene is shown in SEQ ID No. 2;

[0009] Another technical solution adopted in this invention is, VvHDZ28 To investigate the application of the gene in improving the drought resistance of grapes, an overexpression vector pCAMBIA2300-35s-3×Flag-VvHDZ28 was constructed and introduced into Arabidopsis thaliana and grape callus tissues via Agrobacterium-mediated genetic transformation.

[0010] The beneficial effects of this invention are: The 'Cabernet Sauvignon' grape of this invention VvHDZ28 Genes can significantly improve the drought resistance of grapes. VvHDZ28 The gene reduces H2O2 and O2 in transgenic plants by promoting the synthesis and accumulation of ABA. ·- The content of [specific ingredient] can enhance the biological function of improving the drought resistance of transgenic plants. Attached Figure Description

[0011] Figure 1The phenotypic figures are of wild-type (WT) and three transgenic Arabidopsis lines (#2, #6, #16) before drought treatment, 7 days after drought treatment, and 2 days after rehydration. Figure 2 This is a diagram showing the DNA identification results of WT and transgenic Arabidopsis thaliana lines; Figure 3 In WT and transgenic lines VvHDZ28 Relative gene expression level graph; Figure 4 This is a graph showing the survival rates of WT and transgenic lines after drought stress; Figure 5 This is a graph showing the WT and H2O2 content of transgenic lines measured after drought stress; Figure 6 The WT and O2 of the transgenic lines were measured after drought stress. - Content chart; Figure 7 Phenotypic diagrams of control and transgenic callus tissue treated with different concentrations of mannitol; Figure 8 It is in the callus tissue of genetically modified grapes VvHDZ28 Relative expression level graph; Figure 9 The images show the fresh weight of transgenic callus cultured for 15 days under different concentrations of mannitol. Figure 10 O2 in transgenic callus treated with 0 and 300 mM mannitol ·- Content chart; Figure 11 The graph shows the H2O2 content of transgenic callus treated with 0 and 300 mM mannitol. Figure 12 The graph shows the zeatin (ZT) content in transgenic callus treated with 0 and 300 mM mannitol. Figure 13 The graph shows the 6-benzylaminopurine (6-BA) content in transgenic callus treated with 0 and 300 mM mannitol. Figure 14 The graph shows the abscisic acid (ABA) content in transgenic callus treated with 0 and 300 mM mannitol. Figure 15 This is a graph showing the jasmonic acid (JA) content in transgenic callus treated with 0 and 300 mM mannitol; Figure 16 The graph shows the salicylic acid (SA) content in transgenic callus treated with 0 and 300 mM mannitol. Figure 17 This is a graph showing the zeatin nucleoside (ZR) content in transgenic callus treated with 0 and 300 mM mannitol; Figure 18 In transgenic callus treated with 0 and 300 mM mannitol VvABF1 Relative expression level plot; Figure 19 In transgenic callus treated with 0 and 300 mM mannitol VvABF2 Relative expression level plot; Figure 20 In transgenic callus treated with 0 and 300 mM mannitol VvNCED1 Relative expression level plot; Figure 21 In transgenic callus treated with 0 and 300 mM mannitol VvNCED2 Relative expression level plot; Figure 22 In transgenic callus treated with 0 and 300 mM mannitol VvNCED6 Relative expression level plot; Figure 23 Transgenic callus treated with 0 and 300 mM mannitol VvSnRK2 The relative expression level map. Detailed Implementation

[0012] The present invention will now be described in detail with reference to the accompanying drawings and specific embodiments.

[0013] This invention utilizes homologous cloning technology, based on Cabernet Sauvignon... VvHDZ28 CDS sequence-specific primers were designed, and the first strand of cDNA synthesized by reverse transcription of total RNA from leaves of the European grape variety 'Cabernet Sauvignon' was used as a template to amplify the... VvHDZ28 The open reading frame sequence is 954 bp in length, encoding 317 amino acids, with a predicted molecular weight of 39.94 kDa and a theoretical isoelectric point of 5.51.

[0014] This invention constructed an overexpression vector, pCAMBIA2300-35s-3×Flag-VvHDZ28, and introduced it into Arabidopsis thaliana and grape callus tissues via Agrobacterium-mediated genetic transformation. The transgenic Arabidopsis thaliana and grape callus tissues were investigated, and their drought resistance under drought treatment was compared with that of wild-type plants. Hormonal analysis was also performed.

[0015] Further analysis of its physiological regulatory mechanisms revealed that the expression levels of key ABA synthesis and signaling genes NCED3, ABF3, and ABI1 in VvHDZ28-OE callus tissue were significantly higher than those in the control. These results indicate that the ABA-dependent pathway plays an important role in enhancing the drought resistance of VvHDZ28 transgenic plants.

[0016] Example 1 To verify VvHDZ28The drought resistance function of the gene was investigated using the 35S::VvHDZ28-FLAG::pCAMBIA2300 overexpression construct. The construct was introduced into *Agrobacterium tumefaciens* GV3101 strain via a freeze-thaw method, and wild-type *Arabidopsis thaliana* was transformed using the inflorescence dip method, yielding seven independent transformants. Three overexpression lines (#2, #6, #16) were selected based on transcriptional levels for subsequent drought tolerance testing. Results showed that after two days of rehydration following drought stress, the survival rate of the overexpression lines was significantly higher than that of wild-type WT plants, exceeding the control by 280%, 280%, and 192.9%, respectively. Under drought conditions, physiological index analysis showed that the transgenic plants contained significantly higher levels of reactive oxygen species (ROS) (H2O2 and O2·p⁻¹). - The accumulation amount has decreased significantly.

[0017] To further validate the homology system in grapes VvHDZ28 To enhance drought resistance, an overexpression assay was constructed. VvHDZ28 (OE-VvHDZ28) and RNAi-mediated VvHDZ28 The silenced (RNAi-VvHDZ28) vector was used to genetically transform grape callus tissue with the corresponding empty vector. Drought stress was simulated using mannitol at concentrations of 100, 300, and 500 mM, and indicators were measured several weeks later. The results showed that under 300 and 500 mM mannitol stress, the fresh weight of OE-VvHDZ28 callus tissue was significantly higher than the control, with increases of 22.89% and 74.91%, respectively. Furthermore, with increasing mannitol concentration, the VvHDZ28-RNAi transgenic callus tissue exhibited browning. Regarding ROS accumulation, under 300 mM mannitol treatment, the concentrations of H2O2 and O2·2O3 in OE-VvHDZ28 callus tissue were significantly higher. - The content was significantly lower than WT1, decreasing by 20.77% and 17.27% compared to the control, respectively. H2O2 and O2· in VvHDZ28-RNAi callus - The content was significantly lower than WT1, and increased by 15.24% and 34.96% compared with the control, respectively.

[0018] In order to understand VvHDZ28 The drought response pathway was investigated by measuring and analyzing plant hormone levels in the transgenic callus tissues. The results showed that drought stress induced the accumulation of ABA and SA, while inhibiting the accumulation of ZR. Under 300 mM mannitol treatment, the ABA content in OE-VvHDZ28 increased by 7.71% compared to the control, while the ABA content in RNAi-VvHDZ28 decreased by 88.91%. Simultaneously, the ZR content in OE-VvHDZ28 decreased by 45.41% compared to the control, and the ZR content in RNAi-VvHDZ28 decreased by 36.38% compared to the control.

[0019] To further explore VvHDZ28 To investigate the regulation of ABA synthesis, qRT-PCR was used to detect the expression of ABA signaling-related genes in the aforementioned transgenic callus tissue. The results showed that in the OE-VvHDZ28 transgenic callus tissue... ABF2 , NCED6 and SnRK2 Gene expression levels were significantly increased; the relative expression levels treated with 300 mM mannitol were increased by 52.34%, 34.85%, and 43.66% compared to the control, respectively. Similarly, in RNAi-VvHDZ28 transgenic callus tissue... ABF2 , NCED6 and SnRK2 Gene expression levels were significantly reduced; the relative expression levels under 300 mM mannitol treatment were reduced by 40.29%, 62.17%, and 52.45% compared to the control, respectively.

[0020] Example 2 'Cabernet Sauvignon' grapes VvHDZ28 The coding region sequence and the specific steps for experimental verification of its ability to improve drought resistance are as follows: A. In the preliminary research and analysis, 31 genome-wide genes were identified through a genome-wide search. VvHDZ Genes. These gene systems are named based on their chromosomal location. VvHDZ1 to VvHDZ31 They are divided into four distinct subfamilies (I–IV) according to the established Arabidopsis classification system. (Regarding grapes...) VvHDZ Cis-acting elements in gene promoters and grapes under drought stress VvHDZ Analyze gene expression patterns and screen for... VvHDZ28 Genes have potential importance in grape drought stress adaptation. Based on this, a gene was amplified from 'Cabernet Sauvignon' using PCR. VvHDZ28 The full-length cDNA of the gene is shown in SEQ ID No. 1; the amino acid sequence encoded by the gene is shown in SEQ ID No. 2. B. See also Figures 1-6 In order to verify VvHDZ28 The drought resistance function of the gene was investigated using the 35S::VvHDZ28-FLAG::pCAMBIA2300 overexpression construct. The construct was introduced into Agrobacterium tumefaciens GV3101 strain via a freeze-thaw method, and wild-type Arabidopsis thaliana was transformed using the inflorescence dip method, yielding seven independent transformants. Three overexpression lines (#2, #6, #16) were selected based on transcriptional levels for subsequent drought tolerance testing. The results showed that two days after rehydration following drought stress, the survival rate of the overexpression lines was significantly higher than that of wild-type WT plants, exceeding the control by 280%, 280%, and 192.9%, respectively. Figure 4Further physiological analysis following drought stress revealed that transgenic plants contained reactive oxygen species (H2O2 and O2·). - The accumulation of H2O2 decreased significantly, with the content in #2, #6, and #16 decreasing to 65.85%, 67.65%, and 77.16% of the total WT, respectively. Figure 5 O2· - The content decreased to 47.11%, 53.92%, and 54.62% of the WT, respectively. Figure 6 These results validated the overexpression VvHDZ28 It can improve the drought resistance of transgenic Arabidopsis thaliana.

[0021] See Figures 7-11 To further verify in the grape homology system VvHDZ28 To enhance drought resistance, an overexpression assay was constructed. VvHDZ28 (OE-VvHDZ28) and RNAi-mediated VvHDZ28 The RNAi-VvHDZ28 vector was used to genetically transform grape callus tissue. Mannitol at concentrations of 100 mM, 300 mM, and 500 mM was used to simulate drought stress, and indicators were measured several weeks later. The results showed that under 300 mM and 500 mM mannitol stress, the fresh weight of OE-VvHDZ28 callus tissue was significantly higher than the control, with increases of 22.89% and 74.91%, respectively. Figure 9 Furthermore, with increasing mannitol concentration, the VvHDZ28-RNAi transgenic callus tissue exhibited browning (…). Figure 7 Regarding the accumulation of reactive oxygen species (ROS), under 300 mM mannitol treatment, H2O2 and O2·2O3 in OE-VvHDZ28 callus tissue increased significantly. - The content was significantly lower than WT1, decreasing by 20.77% and 17.27% respectively compared to the control. Figure 10 , Figure 11 H2O2 and O2· in VvHDZ28-RNAi callus - The content was significantly lower than WT1, but increased by 15.24% and 34.96% compared to the control, respectively. These results indicate that overexpression... VvHDZ28 It can significantly enhance growth capacity under drought conditions and alleviate oxidative damage caused by drought stress, while silencing this gene makes callus tissue more sensitive to drought, further confirming that... VvHDZ28 Positively regulates drought tolerance in grapes.

[0022] C. See also Figures 12-17 Plant hormones play an important role in drought response, and understanding their role is crucial. VvHDZ28The drought response pathway was investigated, and plant hormone levels in the transgenic callus tissue were measured and analyzed. The results showed that drought stress induced the accumulation of ABA and SA, while inhibiting ZR accumulation. Under 300 mM mannitol treatment, the ABA content in OE-VvHDZ28 increased by 7.71% compared to the control, while the ABA content in RNAi-VvHDZ28 decreased by 88.91% compared to the control. Figure 14 Meanwhile, the ZR content in OE-VvHDZ28 decreased by 45.41% compared to the control, while the ZR content in RNAi-VvHDZ28 increased by 36.38% compared to the control. Figure 17 This indicates that... VvHDZ28 It can induce the synthesis and accumulation of ABA in grape callus.

[0023] See Figures 18-23 In order to further explore VvHDZ28 To investigate the regulation of ABA synthesis, the inventors used qRT-PCR to detect the expression of ABA signaling-related genes in the aforementioned transgenic callus tissue. The results showed that in the OE-VvHDZ28 transgenic callus tissue... ABF2 , NCED6 , SnRK2 Gene expression levels were significantly increased; the relative expression levels under 300 mM mannitol treatment were 52.34% higher than those under control. Figure 19 ), 34.85% Figure 22 ) and 43.66% ( Figure 23 Similarly, in RNAi-VvHDZ28 transgenic callus tissue... ABF2 , NCED6 and SnRK2 Gene expression levels were significantly reduced; the relative expression levels treated with 300 mM mannitol were 40.29% lower than the control. Figure 19 ), 62.17% Figure 22 ) and 52.45% Figure 23 This indicates that... VvHDZ28 Through positive regulation ABF2 , NCED6 and SnRK2 Gene expression promotes the synthesis and accumulation of ABA, thereby conferring strong tolerance to drought stress in grape homology systems.

[0024] Example 3: VvHDZ28 Drought resistance analysis of transgenic Arabidopsis thaliana To verify VvHDZ28The drought resistance function of the gene was investigated using the 35S::VvHDZ28-FLAG::pCAMBIA2300 overexpression construct. The construct was introduced into Agrobacterium tumefaciens GV3101 strain via a freeze-thaw method, and wild-type Arabidopsis thaliana was transformed using the inflorescence dip method, yielding a total of 7 independent transformants. Three overexpression lines (#2, #6, #16) were selected based on transcriptional levels for subsequent drought tolerance assays. The results showed that, two days after rehydration following drought stress, the survival rate of the overexpression lines was significantly higher than that of wild-type WT plants, exceeding the control by 280%, 280%, and 192.9%, respectively. Figure 4 Further physiological analysis following drought stress revealed that transgenic plants contained reactive oxygen species (H2O2 and O2·). - The accumulation of H2O2 decreased significantly, with the content in #2, #6, and #16 decreasing to 65.85%, 67.65%, and 77.16% of the total WT, respectively. Figure 5 O2· - The content decreased to 47.11%, 53.92%, and 54.62% of the WT, respectively. Figure 6 These results validated the overexpression VvHDZ28 It can improve the drought resistance of transgenic Arabidopsis thaliana.

[0025] Example 4: VvHDZ28 Analysis of drought resistance in transgenic callus To further validate the homology system in grapes VvHDZ28 To enhance drought resistance, an overexpression assay was constructed. VvHDZ28 (OE-VvHDZ28) and RNAi-mediated VvHDZ28 The RNAi-VvHDZ28 vector was used to genetically transform grape callus tissue. Mannitol at concentrations of 100, 300, and 500 mM was used to simulate drought stress, and indicators were measured several weeks later. The results showed that under 300 mM and 500 mM mannitol stress, the fresh weight of OE-VvHDZ28 callus tissue was significantly higher than the control, with increases of 22.89% and 74.91%, respectively. Figure 9 Furthermore, with increasing mannitol concentration, the VvHDZ28-RNAi transgenic callus tissue exhibited browning (…). Figure 7 Regarding the accumulation of reactive oxygen species (ROS), under 300 mM mannitol treatment, H2O2 and O2·2O3 in OE-VvHDZ28 callus tissue increased significantly. - The content was significantly lower than WT1, decreasing by 20.77% and 17.27% respectively compared to the control. Figure 10 , Figure 11 H2O2 and O2· in VvHDZ28-RNAi callus -The content was significantly lower than WT1, and increased by 15.24% and 34.96% respectively compared with the control. Figure 10 , Figure 11 These results indicate overexpression VvHDZ28 It can significantly enhance growth capacity under drought conditions and alleviate oxidative damage caused by drought stress, while silencing this gene makes callus tissue more sensitive to drought, further confirming that... VvHDZ28 Positively regulates drought tolerance in grapes.

[0026] Example 5: VvHDZ28 Analysis of plant hormone levels in transgenic callus tissue Plant hormones play an important role in drought response, and understanding their role is crucial. VvHDZ28 The drought response pathway was investigated, and plant hormone levels in the transgenic callus tissue were measured and analyzed. The results showed that drought stress induced the accumulation of ABA and SA, while inhibiting ZR accumulation. Under 300 mM mannitol treatment, the ABA content in OE-VvHDZ28 increased by 7.71% compared to the control, while the ABA content in RNAi-VvHDZ28 decreased by 88.91% compared to the control. Figure 14 Meanwhile, the ZR content in OE-VvHDZ28 decreased by 45.41% compared to the control, while the ZR content in RNAi-VvHDZ28 increased by 36.38% compared to the control. Figure 17 This indicates that... VvHDZ28 It can induce the synthesis and accumulation of ABA in grape callus.

[0027] Example 6: VvHDZ28 Transcriptional level analysis of key genes for ABA synthesis in transgenic callus To further explore VvHDZ28 To investigate the regulation of ABA synthesis, qRT-PCR was used to detect the expression of ABA signaling-related genes in the aforementioned transgenic callus tissue. The results showed that in the OE-VvHDZ28 transgenic callus tissue... ABF2 , NCED6 , SnRK2 Gene expression levels were significantly increased; the relative expression levels under 300 mM mannitol treatment were 52.34% higher than those under control. Figure 19 ), 34.85% Figure 22 ) and 43.66% ( Figure 23 Similarly, in RNAi-VvHDZ28 transgenic callus tissue... ABF2 , NCED6 and SnRK2 Gene expression levels were significantly reduced; the relative expression levels treated with 300 mM mannitol were reduced by 40.29%, 62.17%, and 52.45% compared to the control, respectively. This indicates... VvHDZ28 By positively regulating key genes in the ABA synthesis signaling pathway ABF2 , NCED6 and SnRK2 The expression of ABA promotes its synthesis and accumulation, thereby conferring strong tolerance to drought stress in the grape homology system.

[0028] This invention identified an HDZ family gene that is closely related to drought resistance in grapes. VvHDZ28 Furthermore, through genetic transformation of Arabidopsis thaliana and grape callus, the results confirmed that this gene has a positive regulatory effect on grape drought resistance, and also partially regulates the grape's response to drought stress through an ABA-dependent pathway. This discovery reveals that members of the HDZ transcription factor family have a dual function in plant stress response and hormone regulation, providing new candidate genes and theoretical basis for the genetic improvement of grape drought resistance.

[0029] sequence list <110> Northwest A&F University <120> Improving the drought resistance of grapes VvHDZ28 Genes and their applications <160> 2 <170> Editseq DNASTAR 7.1.0.44 <210> 1 <211> 954 <212> DNA <213> Malus domestica <400> 1 ATGGCGAGTGGGAGGGTCAATCTCGCAGCGATGCTTCAGAACCAAAGGGTCCCTTGTTCT60 TCTCAGCCTCTTGATGCTCTCTTCCTTTCTGCCTCTTCTCCTTCTTTTCTTGGTTCGAGA120 TCCATGTTGAGCTTTGAAGATGTTCGTGCGGGAAAGAGACCCGATAATCCCTTCTTCTGC180 CAGTTTTGATCATGATGAAAATGGAGACGAGGACTTGGATGAGTATTTCCACCACCCGAA240 AAGAAAAGGCGACTTACAGCCGACCAAGTCCAGTTTCTCGAGAGGAATTTTGAGGTGGAG300 AACAAGCTTGAACCAGAAAGGAAAGTCCAGCTTGGCAAAGGACCTTGGCTTACAGCCTCGG360 CAAGTTGCCATATGGTTTCAGAACCGCAGAGCGCGGTGGAAGACCAAACAGCTGGAGAAG420 GACTTTGGCGCCTTGCAAGCTAGCTATAACAGCCTTAAGGCTGAGTATGAAAACCTCCTA480 AAGGAGAAGGATGAACTAAAAACTGAGGTTATTCTCCTCACAGACAAACTGCTCGTCAAA540 GAGAAGGAGAGGGGAAACTTGGAGGTGTCTAATACTGACACCCTATCCCAAGAACTGCCT600 CAAGTGGTGGTTGCTGATTCGGTTTCTGAGGGTGAAGTATCCAAAGTCTCCATTAGTGGTC660 TGCAAACAGGAAGATCTTAGTTCAAAAAAAGCGATGTATTGATTCAGACAGTCCACAT720 TATGCCGATGGGGGCCATTCCGCTCTTCCAGAGCCGGGCGATTCTTCTTATGTTTTTGAA780 GCTGACCAATCAGACGTGTCACAGGATGAA GAAGATAACTTCAGCAAAAGCCTGTTGCCT840 CCATCATACATCTTTCCAAAGCTTGAAGATGTTGATTACC CCGACCCTCCCACAAATCCT900 TGTAGTTTTGGATTCCCGGTTGAAGATCATGCCTTTTGGTCCTGGTCCTATTGA954 <210> 2 <211> 317 <212> PRT <213> Malus domestica <400> 2 MASGRVNLAAMLQNQRVPCSSQPLDALFLSASSPSFLGSRSMLSFEDVRAGKRPDNPFFC60 QFDHDENGDEDLDEYFHQPEKKRRLTADQVQFLERNFEVENKLEPERKVQLAKDLGLQPR120 QVAIWFQNRRARWKTKQLEKDFGALQASYNSLKAEYENLLKEKDELKTEVILLTDKLLVK180 EKERGNLEVSNTDTLSQELPQVVVADSVSEGEVSKVSLVVCKQEDLSSTKSDVFDSDSPH240 YADGGHSALPEPGDSSYVFEADQSDVSQDEEDNFSKSLLPPSYIFPKLEDVDYPDPPTNP300 CSFGFPVEDHAFWSWSY317

Claims

1. Improve the drought resistance of grapes VvHDZ28 Genes, characterized by, The VvHDZ28 The coding region sequence of the gene is shown as SEQ ID No.

1.

2. The method of claim 1, wherein the at least one gene is selected from the group consisting of: VvHDZ28 a protein encoded by a gene, characterized in that, The amino acid sequence of the protein is shown in SEQ ID No.

2.

3. As described in claim 1 VvHDZ28 Application of genes in improving the drought resistance of grapes.

4. The application as described in claim 3, characterized in that, By constructing pCAMBIA2300-35s-3×Flag- VvHDZ28 The overexpression vector was introduced into Arabidopsis and grape callus tissues via Agrobacterium-mediated genetic transformation.

Images