COMPOSITIONS WITH SEL1-DERIVED PEPTIDES AND METHOD FOR THE TREATMENT / PREVENTION OF HIGH OXALATE LEVELS AND ASSOCIATED DISEASES

DE602019085985T2Active Publication Date: 2026-06-24UNIVERSITY OF CHICAGO

Patent Information

Authority / Receiving Office
DE · DE
Patent Type
Patents
Current Assignee / Owner
UNIVERSITY OF CHICAGO
Filing Date
2019-07-18
Publication Date
2026-06-24

AI Technical Summary

Technical Problem

Current treatments for hyperoxaluria and hyperoxalemia, which contribute to kidney stones and related complications, are inadequate, and there is a need for therapies that can effectively stimulate oxalate transport to reduce urinary oxalate levels.

Method used

Compositions comprising Sel1-derived peptides with SLR and/or TPR domains are administered to stimulate oxalate transport, potentially linked with other peptides or polypeptides, to treat or prevent conditions related to excess oxalate levels such as hyperoxaluria and hyperoxalemia.

Benefits of technology

The compositions significantly enhance oxalate transport, reducing urinary and plasma oxalate levels, thereby lowering the risk of kidney stones, nephrocalcinosis, and other oxalate-related diseases.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader
Need to check novelty before this filing date? Find Prior Art

Description

FIELD

[0001] Provided herein are compositions comprising Sel1-derived peptides for use in a method of stimulating oxalate transport. In particular, peptides comprise Sel-like repeat (SLR) domains and / or tetratricopeptide (TPR) domains and may be linked together or administered with other peptides or polypeptides to treat / prevent diseases / conditions related to excess oxalate levels, such as hyperoxaluria and / or hyperoxalemia.BACKGROUND

[0002] Nephrolithiasis, or the formation of mineral deposit blockages in the kidney (kidney stones (KS)), is the second most prevalent kidney disease in USA after hypertension, with a rising prevalence and complications including advanced chronic kidney disease (CKD) and end stage renal disease (ESRD). It remains a major source of patient discomfort and disability, lost working days, and health-care expenditure, with an annual economic cost approaching $10 billion. Hyperoxaluria (HO) is a major risk factor for KS, and 70-80% of KS are composed of calcium oxalate. Urinary oxalate is an important determinant of supersaturation, and the risk for stone formation is affected by small increases in urine oxalate. Oxalate is a metabolic end product that cannot be further metabolized and is highly toxic. The mammalian intestine plays a crucial role in oxalate homeostasis, by regulating the amount of absorbed dietary oxalate and providing an avenue for enteric oxalate excretion. Anion exchanger SLC26A6 (A6)-mediated intestinal oxalate secretion plays a critical role in preventing hyperoxaluria and calcium oxalate kidney stones (COKS). Inflammatory bowel disease patients have a significantly increased risk of KS due to the associated enteric hyperoxaluria. Obesity is a risk factor for KS and obese stone formers often have mild to moderate hyperoxaluria. Hyperoxaluria is also emerging as a major complication (developing in > 50% of patients) of bariatric surgery for obesity. With the rising prevalence of obesity and increased utilization of bariatric surgery, it is expected that the incidence of hyperoxaluria and related COKS (including the associated cost burden) will continue to increase at a significant rate. Primary hyperoxaluria (PH) is an inherited disease in which there is endogenous oxalate overproduction, which leads to recurrent KS and / or progressive nephrocalcinosis, ESRD, as well as significant hyperoxalemia, systemic oxalosis and premature death. Systemic deposition of calcium oxalate (oxalosis) leads to bone disease, cardiac arrhythmias, cardiomyopathy, skin ulcers, erythropoietin refractory anemia, and digital gangrene. The only treatment known to fully correct the underlying metabolic defect is liver transplantation or combined kidney-liver transplantation once ESRD develops. In addition, significant hyperoxalemia is also seen in ESRD. Cardiovascular diseases are the leading cause of morbidity and mortality in ESRD patients, and a recent report suggest that the ESRD-associated hyperoxalemia may contribute to this increased risk.

[0003] Kidney stones (KS) affect ~1 in 5 men and ~1 in 11 women, are costly (>$10B annually), and are associated with CKD and ESRD. High recurrence rates (50% in 5 years and up to 80% in 10 years), indicate that current interventions are inadequate and alternative therapies are needed. Most KS are composed of calcium oxalate and very small increases in urine oxalate concentration enhance the risk for stone formation. Lower urinary calcium oxalate (CaOx) supersaturation definitively reduces KS formation. Currently no FDA approved drugs reduce urinary oxalate excretion. The gut bacterium Oxalobacter formigens (Of) induces colonic oxalate secretion and reduces urinary oxalate excretion via a secretagogue. Given the difficulties with recolonization, Of alone is not therapeutically feasible and underscores the need to utilize the secretagogue that induces colonic oxalate secretion.

[0004] Uniprot Database accession code: C3X8T9 shows the genome sequencing of Oxalobacter formigenes strain OXCC13. WO2018 / 136779A2 relates to Oxalobacter formigenes-derived factors for the treatment / prevention of excess oxalate levels. US6200562B1 relates to a method for reducing absorption of dietary oxalate using enzymes and microbes. US2014 / 0030324A1 relates to compositions and methods for treating or preventing oxalate-related disease. WO2005 / 097176A2 relates to compositions and methods for increasing the rate of oxalate transport from a parenteral site to the intestinal lumen in an animal subject. EP3016669A0 (WO2015 / 002604A1) relates to secretagogues derived from Oxalobacter formigenes for use in the treatment of an oxalate related disease and / or oxalate related imbalance in a subject.SUMMARY

[0005] The invention provides a composition for use in a method of stimulating oxalate transport, wherein the composition is administered to a subject and wherein the composition comprises a Sell-derived peptide sequence with at least 60% sequence identity to one of SEQ ID NOs: 8-15, wherein the composition is not a product of nature and wherein the Sel1-derived peptide composition stimulates oxalate transport.

[0006] In particular, peptides comprise Sel-like repeat (SLR) domains and / or tetratricopeptide (TPR) domains and may be linked together or administered with other peptides or polypeptides to treat / prevent diseases / conditions related to excess oxalate levels, such as hyperoxaluria and / or hyperoxalemia.

[0007] In the invention, provided herein are compositions for use comprising a Sell-derived peptide sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, 100%, or ranges therebetween) sequence identity to one of SEQ ID NOs: 8-15, wherein the composition is not a product of nature. In some embodiments, the Sell-derived peptide sequence has less than 100% sequence identity to SEQ ID NOs: 8-15. In some embodiments, the Sell-derived peptide sequence is fused to a second peptide or polypeptide sequence. In some embodiments, the second peptide or polypeptide sequence is a carrier moiety, therapeutic moiety, detectable moiety, or Sell-derived peptide sequence. In some embodiments, the composition comprises 2 or more Sell-derived peptide sequences with at least 60% sequence identity to one of SEQ ID NOs: 8-15. In some embodiments, the Sell-derived peptide sequences are fused directly or indirectly to each other. In some embodiments, the Sel1-derived peptide sequences are not fused to each other. In some embodiments, (i) one or more of the amino acid residues in the peptide sequence(s) are D-enantiomers, (ii) the peptide sequence(s) comprise a one or more unnatural amino acids, (iii) the peptide sequence(s) comprise a one or more amino acid analogs, and / or (iv) the peptide sequence(s) comprise a one or more peptoid amino acids. In some embodiments, the peptide sequence(s) or an amino acid therein comprises a modification selected from the group consisting of phosphorylation, glycosylation, ubiquitination, S-nitrosylation, methylation, N-acetylation, lipidation, lipoylation, deimination, eliminylation, disulfide bridging, isoaspartate formation, racemization, glycation; carbamylation, carbonylation, isopeptide bond formation, sulfation, succinylation, S-sulfonylation, S-sulfinylation, S-sulfenylation, S-glutathionylation, pyroglutamate formation, propionylation, adenylylation, nucleotide addition, iodination, hydroxylation, malonylation, butyrylation, amidation, alkylation, acylation, biotinylation, carbamylation, oxidation, and pegylation. In some embodiments, the peptide sequence(s) exhibit enhanced stability relative to one of SEQ ID NOs: 5-46. In some embodiments, the peptide sequence(s) exhibit enhanced oxalate-transport stimulation relative to one of SEQ ID NOs: 5-46.

[0008] In some embodiments, provided herein are pharmaceutical compositions comprising a Sell-derived peptide composition described herein and a pharmaceutically-acceptable carrier. In some embodiments, the pharmaceutical composition further comprises one or more additional therapeutic agents. In some embodiments, the additional therapeutic agent is an oxalate degrading enzyme (e.g., oxalate oxidase, oxalate decarboxylase, oxalyl-CoA decarboxylase, formyl-CoA transferase, etc.).. In some embodiments, the additional therapeutic agent is an oxalate degrading organism (e.g., bacteria, etc.).

[0009] In some embodiments, administration comprises rectal administration, oral administration, and / or injection. In some embodiments, the subject suffers from or is at risk for hyperoxaluria and / or hyperoxalemia. In some embodiments, the subject's risk of the risk of calcium oxalate kidney stones, nephrocalcinosis, oxalate nephropathy, end stage renal disease, chronic kidney disease, and / or systemic oxalosis is lowered by the method.

[0010] In some embodiments, the compositions for use of the invention may be for use in methods of treating or preventing hyperoxaluria and / or hyperoxalemia. In some embodiments, treating or preventing hyperoxaluria and / or hyperoxalemia lowers the subject's risk of the risk of calcium oxalate kidney stones, nephrocalcinosis, oxalate nephropathy, end stage renal disease, and / or systemic oxalosis.BRIEF DESCRIPTION OF THE DRAWINGS

[0011] Figure 1. 301-derived peptides (individually or in combination) significantly stimulate 14< C-oxalate influx into human Caco2-BBE (C2) cells. Figure 2. Several 318-derived peptides significantly stimulate 14< C-oxalate influx into C2 cells. Figure 3. P8+9 peptides significantly stimulate (>2.4-fold) oxalate transport by C2 cells and similar to the conditioned medium (CM). Figure 4. P8+9 peptides significantly stimulate oxalate transport by C2 cells in a dose-dependent manner. Figure 5. P8+9 peptides significantly stimulated oxalate transport by an ileum (A) and sigmoid (B) Organoids. Figure 6. P7-10 peptides significantly stimulated oxalate transport by an ileum (A) and sigmoid (B) Organoids. Figure 7. P8 and P9 peptides sequences. Figure 8.318 Sell protein. SP = signal peptide. Boxes = SLR motifs and they represent P7-11 peptides. Figure 9. Compared with native P8 peptide, P8 with N-terminal acetylation (Ac), C-terminal amidation (Am), all glycines replaced with PEG6 significantly stimulate 14C-oxalate influx into Caco2-BBE cells. Replacing natural amino acids with D-amino acids (D-aa) produces a nonfunctional P8 peptide. Figure 10. Compared with native P9 peptide, P9 with N-terminal acetylation (Ac), C-terminal amidation (Am), all glycines replaced with PEG6 significantly stimulate 14C-oxalate influx into Caco2-BBE cells. Replacing natural amino acids with D-amino acids (D-aa) produces a nonfunctional P9 peptide. Figure 11. P8 with G15 replaced with D-alanine and P9 with G16 replaced with D-alanine significantly stimulate 14< C-oxalate influx into Caco2-BBE cells. Figure 12. P9 with N-terminal acetylation (Ac), C-terminal amidation (Am), and G16 replaced with D-alanine (D-Ala) significantly stimulate oxalate transport by a human distal colon organoid. Figure 13. P9 with N-terminal acetylation (Ac), C-terminal amidation (Am), and G16 replaced with D-alanine (D-Ala) significantly stimulate oxalate transport by a human sigmoid colon organoid. Figure 14. P8 and magnesium citrate produced enhancement of oxalate uptake over P8 peptide alone. Figure 15. P9 and magnesium citrate produced enhancement of oxalate uptake over P8 peptide alone. Figure 16. The addition of aluminum to P8 or P9 did not result in increased oxalate transport and oxalate transport induction was similar to untreated DEFINITIONS

[0012] Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of embodiments described herein, some preferred methods, compositions, devices, and materials are described herein. However, before the present materials and methods are described, it is to be understood that this invention is not limited to the particular molecules, compositions, methodologies or protocols herein described, as these may vary in accordance with routine experimentation and optimization. It is also to be understood that the terminology used in the description is for the purpose of describing the particular versions or embodiments only, and is not intended to limit the scope of the embodiments described herein.

[0013] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. However, in case of conflict, the present specification, including definitions, will control. Accordingly, in the context of the embodiments described herein, the following definitions apply.

[0014] As used herein and in the appended claims, the singular forms "a", "an" and "the" include plural reference unless the context clearly dictates otherwise. Thus, for example, reference to "a Sell-derived peptide" is a reference to one or more Sell-derived peptides and equivalents thereof known to those skilled in the art, and so forth.

[0015] As used herein, the term "comprise" and linguistic variations thereof denote the presence of recited feature(s), element(s), method step(s), etc. without the exclusion of the presence of additional feature(s), element(s), method step(s), etc. Conversely, the term "consisting of" and linguistic variations thereof, denotes the presence of recited feature(s), element(s), method step(s), etc. and excludes any unrecited feature(s), element(s), method step(s), etc., except for ordinarily-associated impurities. The phrase "consisting essentially of' denotes the recited feature(s), element(s), method step(s), etc. and any additional feature(s), element(s), method step(s), etc. that do not materially affect the basic nature of the composition, system, or method. Many embodiments herein are described using open "comprising" language. Such embodiments encompass multiple closed "consisting of" and / or "consisting essentially of" embodiments, which may alternatively be claimed or described using such language.

[0016] As used herein, the term "hyperoxaluria" refers to the excessive urinary excretion of oxalate by a subject (e.g., >25 mg / day).

[0017] As used herein, the term "hyperoxalemia" refers to excessive plasma levels of oxalate in a subject. Various studies report a normal range of oxalate in the plasma of 1 to 3 µmol per liter. Subjects with levels exceeding that range are considered to suffer from hyperoxalemia.

[0018] The term "amino acid" refers to natural amino acids, unnatural amino acids, and amino acid analogs, all in their D and L stereoisomers, unless otherwise indicated, if their structures allow such stereoisomeric forms.

[0019] Natural amino acids include alanine (Ala or A), arginine (Arg or R), asparagine (Asn or N), aspartic acid (Asp or D), cysteine (Cys or C), glutamine (Gln or Q), glutamic acid (Glu or E), glycine (Gly or G), histidine (His or H), isoleucine (Ile or I), leucine (Leu or L), Lysine (Lys or K), methionine (Met or M), phenylalanine (Phe or F), proline (Pro or P), serine (Ser or S), threonine (Thr or T), tryptophan (Trp or W), tyrosine (Tyr or Y) and valine (Val or V).

[0020] Unnatural amino acids include, but are not limited to, azetidinecarboxylic acid, 2-aminoadipic acid, 3-aminoadipic acid, beta-alanine, naphthylalanine ("naph"), aminopropionic acid, 2-aminobutyric acid, 4-aminobutyric acid, 6-aminocaproic acid, 2-aminoheptanoic acid, 2-aminoisobutyric acid, 3-aminoisbutyric acid, 2-aminopimelic acid, tertiary-butylglycine ("tBuG"), 2,4-diaminoisobutyric acid, desmosine, 2,2'-diaminopimelic acid, 2,3-diaminopropionic acid, N-ethylglycine, N-ethylasparagine, homoproline ("hPro" or "homoP"), hydroxylysine, allo-hydroxylysine, 3-hydroxyproline ("3Hyp"), 4-hydroxyproline ("4Hyp"), isodesmosine, allo-isoleucine, N-methylalanine ("MeAla" or "Nime"), N-alkylglycine ("NAG") including N-methylglycine, N-methylisoleucine, N-alkylpentylglycine ("NAPG") including N-methylpentylglycine. N-methylvaline, naphthylalanine, norvaline ("Norval"), norleucine ("Norleu"), octylglycine ("OctG"), ornithine ("Om"), pentylglycine ("pG" or "PGly"), pipecolic acid, thioproline ("ThioP" or "tPro"), homoLysine ("hLys"), and homoArginine ("hArg").

[0021] The term "amino acid analog" refers to a natural or unnatural amino acid where one or more of the C-terminal carboxy group, the N-terminal amino group and side-chain functional group has been chemically blocked, reversibly or irreversibly, or otherwise modified to another functional group. For example, aspartic acid-(beta-methyl ester) is an amino acid analog of aspartic acid; N-ethylglycine is an amino acid analog of glycine; or alanine carboxamide is an amino acid analog of alanine. Other amino acid analogs include methionine sulfoxide, methionine sulfone, S-(carboxymethyl)-cysteine, S-(carboxymethyl)-cysteine sulfoxide and S-(carboxymethyl)-cysteine sulfone.

[0022] As used herein, the term "peptide" refers a short polymer of amino acids linked together by peptide bonds. In contrast to other amino acid polymers (e.g., proteins, polypeptides, etc.), peptides are of about 50 amino acids or less in length. A peptide may comprise natural amino acids, non-natural amino acids, amino acid analogs, and / or modified amino acids. A peptide may be a subsequence of naturally occurring protein or a non-natural (synthetic) sequence.

[0023] As used herein, the term "mutant peptide" or "variant peptide" refers to a peptide having a distinct amino acid sequence from the most common variant occurring in nature, referred to as the "wild-type" sequence. A mutant peptide may be a subsequence of a mutant protein or polypeptide (e.g., a subsequence of a naturally-occurring protein that is not the most common sequence in nature) or may be a peptide that is not a subsequence of a naturally occurring protein or polypeptide. For example, a "mutant SLR peptide" (e.g., a "mutant Sel1 protein") may be a subsequence of a mutant version of SLR protein (e.g., Sell protein) or may be distinct sequence not found in naturally-occurring SLR proteins (e.g., Sel1 proteins).

[0024] As used herein, the term "mutant polypeptide" or "variant polypeptide" refers to a polypeptide having a distinct amino acid sequence from the "wild-type" sequence. A mutant polypeptide may be a naturally-occurring protein that is not the most common sequence in nature (or a polypeptide fragment thereof) or may be a polypeptide that is not a subsequence of a naturally occurring protein or polypeptide. For example, a "mutant SLR polypeptide" may be a naturally occurring SLR protein (e.g., Sell protein), a polypeptide fragment of a SLR protein (e.g., Sel1 protein), or may be distinct sequence not found in naturally-occurring SLR proteins (e.g., Sel1 proteins).

[0025] As used herein, the term "artificial peptide" or "artificial polypeptide" refers to a peptide or polypeptide having a distinct amino acid sequence from those found in natural peptides and / or proteins. An artificial protein is not a subsequence of a naturally occurring protein, either the wild-type (i.e., most abundant) or mutant versions thereof. For example, an artificial SLR peptide or polypeptide is not a subsequence of naturally occurring SLR protein (e.g., Sell protein). An artificial peptide or polypeptide may be produced or synthesized by any suitable method (e.g., recombinant expression, chemical synthesis, enzymatic synthesis, etc.).

[0026] The terms "peptide mimetic" or "peptidomimetic" refer to a peptide-like molecule that emulates a sequence derived from a protein or peptide. A peptide mimetic or peptidomimetic may contain amino acids and / or non-amino acid components. Examples of peptidomimtecs include chemically modified peptides, peptoids (side chains are appended to the nitrogen atom of the peptide backbone, rather than to the α-carbons), β-peptides (amino group bonded to the β carbon rather than the α carbon), etc.

[0027] As used herein, a "conservative" amino acid substitution refers to the substitution of an amino acid in a peptide or polypeptide with another amino acid having similar chemical properties, such as size or charge. For purposes of the present disclosure, each of the following eight groups contains amino acids that are conservative substitutions for one another: 1) Alanine (A) and Glycine (G); 2) Aspartic acid (D) and Glutamic acid (E); 3) Asparagine (N) and Glutamine (Q); 4) Arginine (R) and Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), and Valine (V); 6) Phenylalanine (F), Tyrosine (Y), and Tryptophan (W); 7) Serine (S) and Threonine (T); and 8) Cysteine (C) and Methionine (M).

[0028] Naturally occurring residues may be divided into classes based on common side chain properties, for example: polar positive (histidine (H), lysine (K), and arginine (R)); polar negative (aspartic acid (D), glutamic acid (E)); polar neutral (serine (S), threonine (T), asparagine (N), glutamine (Q)); non-polar aliphatic (alanine (A), valine (V), leucine (L), isoleucine (I), methionine (M)); non-polar aromatic (phenylalanine (F), tyrosine (Y), tryptophan (W)); proline and glycine; and cysteine. As used herein, a "semi-conservative" amino acid substitution refers to the substitution of an amino acid in a peptide or polypeptide with another amino acid within the same class.

[0029] In some embodiments, unless otherwise specified, a conservative or semi-conservative amino acid substitution may also encompass non-naturally occurring amino acid residues that have similar chemical properties to the natural residue. These non-natural residues are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include, but are not limited to, peptidomimetics and other reversed or inverted forms of amino acid moieties. Embodiments herein may, in some embodiments, be limited to natural amino acids, non-natural amino acids, and / or amino acid analogs. Non-conservative substitutions may involve the exchange of a member of one class for a member from another class.

[0030] As used herein, the term "sequence identity" refers to the degree to which two polymer sequences (e.g., peptide, polypeptide, nucleic acid, etc.) have the same sequential composition of monomer subunits. The term "sequence similarity" refers to the degree with which two polymer sequences (e.g., peptide, polypeptide, nucleic acid, etc.) differ only by conservative and / or semi-conservative amino acid substitutions. The "percent sequence identity" (or "percent sequence similarity") is calculated by: (1) comparing two optimally aligned sequences over a window of comparison (e.g., the length of the longer sequence, the length of the shorter sequence, a specified window, etc.), (2) determining the number of positions containing identical (or similar) monomers (e.g., same amino acids occurs in both sequences, similar amino acid occurs in both sequences) to yield the number of matched positions, (3) dividing the number of matched positions by the total number of positions in the comparison window (e.g., the length of the longer sequence, the length of the shorter sequence, a specified window), and (4) multiplying the result by 100 to yield the percent sequence identity or percent sequence similarity. For example, if peptides A and B are both 20 amino acids in length and have identical amino acids at all but 1 position, then peptide A and peptide B have 95% sequence identity. If the amino acids at the non-identical position shared the same biophysical characteristics (e.g., both were acidic), then peptide A and peptide B would have 100% sequence similarity. As another example, if peptide C is 20 amino acids in length and peptide D is 15 amino acids in length, and 14 out of 15 amino acids in peptide D are identical to those of a portion of peptide C, then peptides C and D have 70% sequence identity, but peptide D has 93.3% sequence identity to an optimal comparison window of peptide C. For the purpose of calculating "percent sequence identity" (or "percent sequence similarity") herein, any gaps in aligned sequences are treated as mismatches at that position.

[0031] As used herein, the term "subject" broadly refers to any animal, including but not limited to, human and non-human animals (e.g., dogs, cats, cows, horses, sheep, poultry, fish, crustaceans, etc.). As used herein, the term "patient" typically refers to a human subject that is being treated for a disease or condition.

[0032] As used herein, the term "effective amount" refers to the amount of a sufficient to effect beneficial or desired results. An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.

[0033] As used herein, the terms "administration" and "administering" refer to the act of giving a drug, prodrug, or other agent, or therapeutic treatment to a subject or in vivo, in vitro, or ex vivo cells, tissues, and organs. Exemplary routes of administration to the human body can be through space under the arachnoid membrane of the brain or spinal cord (intrathecal), the eyes (ophthalmic), mouth (oral), skin (topical or transdermal), nose (nasal), lungs (inhalant), oral mucosa (buccal), ear, rectal, vaginal, by injection (e.g., intravenously, subcutaneously, intratumorally, intraperitoneally, etc.) and the like.

[0034] As used herein, the terms "co-administration" and "co-administering" refer to the administration of at least two agent(s) or therapies to a subject. In some embodiments, the co-administration of two or more agents or therapies is concurrent. In other embodiments, a first agent / therapy is administered prior to a second agent / therapy. Those of skill in the art understand that the formulations and / or routes of administration of the various agents or therapies used may vary. The appropriate dosage for co-administration can be readily determined by one skilled in the art. In some embodiments, when agents or therapies are co-administered, the respective agents or therapies are administered at lower dosages than appropriate for their administration alone. Thus, co-administration is especially desirable in embodiments where the co-administration of the agents or therapies lowers the requisite dosage of a potentially harmful (e.g., toxic) agent(s), and / or when co-administration of two or more agents results in sensitization of a subject to beneficial effects of one of the agents via co-administration of the other agent.

[0035] As used herein, the term "treatment" means an approach to obtaining a beneficial or intended clinical result. The beneficial or intended clinical result may include alleviation of symptoms, a reduction in the severity of the disease, inhibiting an underlying cause of a disease or condition, steadying diseases in a non-advanced state, delaying the progress of a disease, and / or improvement or alleviation of disease conditions.

[0036] As used herein, the term "pharmaceutical composition" refers to the combination of an active agent (e.g., Sel1-derived peptide) with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vitro, in vivo or ex vivo. The terms "pharmaceutically acceptable" or "pharmacologically acceptable," as used herein, refer to compositions that do not substantially produce adverse reactions, e.g., toxic, allergic, or immunological reactions, when administered to a subject.

[0037] As used herein, the term "pharmaceutically acceptable carrier" refers to any of the standard pharmaceutical carriers including, but not limited to, phosphate buffered saline solution, water, emulsions (e.g., such as an oil / water or water / oil emulsions), and various types of wetting agents, any and all solvents, dispersion media, coatings, sodium lauryl sulfate, isotonic and absorption delaying agents, disintegrants (e.g., potato starch or sodium starch glycolate), and the like. The compositions also can include stabilizers and preservatives. For examples of carriers, stabilizers and adjuvants, see, e.g., Martin, Remington's Pharmaceutical Sciences, 15th Ed., Mack Publ. Co., Easton, Pa. (1975).DETAILED DESCRIPTION

[0038] Provided herein are compositions comprising Sel1-derived peptides for use in a method of stimulating oxalate transport. In particular, peptides comprise Sel-like repeat (SLR) domains and / or tetratricopeptide (TPR) domains and may be linked together or administered with other peptides or polypeptides to treat / prevent diseases / conditions related to excess oxalate levels, such as hyperoxaluria and / or hyperoxalemia.

[0039] Most kidney stones (KS) are composed of calcium oxalate, and small increases in urine oxalate affect the stone risk. The mammalian intestine plays a crucial role in oxalate homeostasis. Intestinal oxalate secretion mediated by anion exchanger SLC26A6 (A6) plays a major role in limiting net intestinal absorption of ingested oxalate; thereby preventing hyperoxaluria and calcium oxalate kidney stones (COKS). Hyperoxaluria and a high incidence of KS are commonly seen in IBD patients. Hyperoxaluria is also emerging as a major complication of bariatric surgery for obesity. Primary hyperoxaluria (PH) is an inherited disease in which there is endogenous oxalate overproduction. Enhancing intestinal oxalate secretion is expected to lead to reduced urine and plasma oxalate levels. In addition to degrading intraluminal dietary oxalate, the probiotic bacterium Oxalobacter formigenes (Of) also interacts with colonic epithelium by inducing colonic oxalate secretion, leading to reduced urinary excretion. Significant difficulties exist in sustaining Of colonization in animals and humans in the absence of high exogenous oxalate.

[0040] Sell-like repeat (SLR) proteins (e.g. Sell, Hrd3, Chs4, Nif1, PodJ, ExoR, AlgK, HcpA, Hsp12, EnhC, LpnE, MotX, and MerG) are involved in signal transduction pathways. SLR proteins (e.g., Sel1 proteins) have repeat units (e.g., repeat peptides). Most repeats are 5 to 40 amino acids (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, or ranges therebetween), but longer repeat peptides (e.g., 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, or longer or ranges therebetween) are within the scope of the SLR proteins (e.g., Sel1 proteins) herein. In some embodiments, repeat units fold into two to four secondary structural elements. In some embodiments, SLR proteins (e.g., Sell proteins) serve as adaptor proteins for the assembly of membrane-bound macromolecular complexes. Several bacterial and eukaryotic SLR proteins (e.g. Sell & Hrd3) are activated upon cellular stress. In some embodiments, Of Sell proteins are activated when oxalate is low in the culture medium (e.g., as evidenced by the observation of a CM of higher (>2-fold) bioactivity under this condition). Bacterial LpnE, EnhC, HcpA, ExoR, and AlgK proteins mediate the interactions between bacterial and eukaryotic host cells. In some embodiments, the SLR motif establishes a link between signal transduction pathways from eukaryotes and bacteria. In some embodiments, an SLR protein (e.g., Sell proteins) comprises leader sequences. In some embodiments, SLR proteins (e.g., Sel1 proteins) without leader sequences, such as PodJ or leaderless analogs of natural SLR proteins (e.g., Sell proteins), are active in the periplasmic space. In some embodiments, bacterial SLR proteins (e.g., Sel1 proteins), such as HcpA, ExoR, EnhC and LpnE are responsible for the adaptation of bacteria to different eukaryotic hosts.

[0041] Provided herein are compositions for use of the invention (e.g., Sel1-derived peptides, fusions of multiple Sell-derived peptides, combinations of Sell-derived peptides, fusions of Sel1-derived peptides with other peptides / polypeptides, etc.) which stimulate the clearance of oxalate (e.g., activate oxalate transport) from a biological environment (e.g., blood, urine, etc.). In some embodiments, compositions significantly reduce oxalate concentrations (e.g., urine oxalate, blood oxalate, etc.) for example, by at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or ranges therebetween. In some embodiments, compositions herein stimulate oxalate transport, thereby reducing in vivo oxalate levels in the blood (e.g., plasma oxalate levels), urine, etc., through mechanisms such as, for example, PKA activation and increased activity of SLC26 family members (e.g., SLC26A6) or other transporter(s); although embodiments herein are not limited to any particular mechanism of action and an understanding of the mechanism of action is not necessary to practice such embodiments.

[0042] In some embodiments, compositions for use of the invention may be for use in methods to treat, prevent, reduce the likelihood, treat / prevent a side effect of one or more of: hyperoxalemia, hyperoxaluria, nephrolithiasis, chronic kidney disease, end stage renal disease, calcium oxalate kidney stones, nephrocalcinosis, oxalate nephropathy, primary hyperoxaluria (PH), enteric hyperoxaluria (seen for example in IBD, following small bowel surgery or bariatric surgery, obesity, and celiac disease) and systemic oxalosis. In some embodiments, the reduction in oxalate levels and / or activation of oxalate transport is activated by compositions described herein. In some embodiments, oxalate transport pathways are activated by the compositions described herein. In some embodiments, compositions for use of the invention are utilized in the treatment and / or prevention of hyperoxalemia, hyperoxaluria, and / or related diseases and conditions.

[0043] In some instances, described herein are pharmaceutical compositions, SLR peptides (e.g., Sell peptides), TPR peptides (and fusions thereof), fusions of two or more Sell-derived peptides (e.g., Sell peptides, Sell peptide analogs, etc.), fusions of Sell-derived peptides (e.g., Sell peptides, Sell peptide analogs, etc.) with other peptides / polypeptides, nucleic acids encoding the peptides, proteins and polypeptides herein, molecular complexes of the foregoing, etc. for the treatment or prevention of hyperoxalemia, hyperoxaluria, and / or related diseases and conditions. In some instances, described herein are peptides derived from (e.g., a fragment of, derived from a fragment of, etc.) SEQ ID NO: 2 or SEQ ID NO: 4. In some instances, peptides comprise at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, less than 100%, 100%, or ranges therebetween) sequence identity to a portion of SEQ ID NO: 2 or SEQ ID NO: 4. In some instances, peptides comprise at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, less than 100%, 100%, or ranges therebetween) sequence similarity to a portion of SEQ ID NO: 2 or SEQ ID NO: 4. In some instances, described herein are peptides derived from (e.g., a fragment of, derived from a fragment of, etc.) SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, or SEQ ID NO: 46. In the compositions for use of the invention, peptides comprise at least 60% (e.g., 65%, 70%, 75%, 80%, 85%, 90%, 95%, less than 100%, 100%, or ranges therebetween) sequence identity to SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. In some instances, peptides comprise at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, less than 100%, 100%, or ranges therebetween) sequence similarity to all or a portion of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, or SEQ ID NO: 46.

[0044] In some instances, described herein are fusions of two or more Sel1-derived peptides. In some instances, a fusion comprises a first peptide sequence derived from SEQ ID NOs: 1-46 linked directly or indirectly (via a linker or connector) to a second peptide sequence derived from SEQ ID NOs: 1-46. A fusion may additionally comprise one or more (e.g., 2, 3, 4, 5, 6, etc.) peptide sequence derived from SEQ ID NOs: 1-46 linked directly or indirectly.

[0045] In some instances, a peptide / polypeptide / fusion described herein is an artificial, not naturally-occurring, sequence. In some embodiments, a peptide / polypeptide / fusion described herein is prepared by methods known to those of ordinary skill in the art. For example, the peptide / polypeptide / fusion can be synthesized using solid phase polypeptide synthesis techniques (e.g. Fmoc or Boc chemistry). Alternatively, the peptide / polypeptide / fusion can be produced using recombinant DNA technology (e.g., using bacterial or eukaryotic expression systems). Further, a peptide / polypeptide / fusion may be expressed within a subject (e.g., following administration of an appropriate vector). Accordingly, to facilitate such methods, described herein are genetic vectors (e.g., plasmids, viral vectors (e.g. AAV), etc.) comprising a sequence encoding the peptide / polypeptide / fusion, as well as host cells comprising such vectors. Furthermore, described herein are the peptide / polypeptide / fusion produced via such methods.

[0046] In some instances, a peptide is described comprising or consisting of all or a portion of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, or SEQ ID NO: 46. In some instances, a peptide is described comprising at least 50% sequence identity to one of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, or SEQ ID NO: 46. (e.g. at least 60% sequence identity, at least 70% sequence identity, at least 80% sequence identity, at least 90% sequence identity, at least 95% sequence identity, etc.). In some instances, a peptide comprises at least one substitution (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or ranges therebetween (e.g., 1-10 substitutions)) from a Sell peptide sequence described herein (e.g., SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, or SEQ ID NO: 46.).

[0047] In some instances, a peptide / polypeptide is described that is a fusion of two or more of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, or SEQ ID NO: 46. In some instances, a peptide / polypeptide is described that is a fusion of one or more peptides derived from (e.g., fragments of, comprising substitutions relative to, etc.) SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, or SEQ ID NO: 46. In some instances, a fusion comprises a portion (or portions) having one or more substitutions (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more) compared to SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, or SEQ ID NO: 46.

[0048] In some instances, fusions may comprise two or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) of the peptides herein or variants thereof. In some instances, a fusion may comprise multiple (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) copies of a single Sell-derived peptide or variant thereof. In some instances, fusions comprise one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) of the peptides herein or variants thereof and one or more non-Sell-derived peptides or polypeptides. In some instances, a fusion may comprise a functional peptide or polypeptide segment. In some instances, the functional peptide or polypeptide segment comprises a signaling moiety, therapeutic moiety, localization moiety (e.g., cellular import signal, nuclear localization signal, etc.), detectable moiety (e.g., fluorescent moiety, contrast agent), or isolation / purification moiety (e.g., streptavidin, His 6 , etc.). Such fusions may be expressed from a recombinant DNA which encodes the Sel1-derived peptide(s) and the additional peptide / polypeptide or may be formed by chemical synthesis. For instance, the fusion may comprise a Sell-derived peptide(s) and an enzyme of interest, a luciferase, RNasin or RNase, and / or a channel protein (e.g., ion channel protein), a receptor, a membrane protein, a cytosolic protein, a nuclear protein, a structural protein, a phosphoprotein, a kinase, a signaling protein, a metabolic protein, a mitochondrial protein, a receptor associated protein, a fluorescent protein, an enzyme substrate, a transcription factor, selectable marker protein, nucleic acid binding protein, extracellular matrix protein, secreted protein, receptor ligand, serum protein, a protein with reactive cysteines, a transporter protein, a targeting sequence (e.g., a myristylation sequence), a mitochondrial localization sequence, or a nuclear localization sequence. The additional peptide / polypeptide may be fused to the N-terminus and / or the C-terminus of the Sel1-derived peptide(s). In one instance, the fusion protein comprises a first peptide / polypeptide at the N-terminus and another (different) peptide / polypeptide at the C-terminus of the Sell-derived peptide(s). Optionally, the elements in the fusion are separated by a connector sequence, e.g., preferably one having at least 2 amino acid residues, such as one having 13 and up to 40 or 50 amino acid residues. In some instances, the presence of a connector sequence in a fusion protein of the invention does not substantially alter the function of either element (e.g., Sell-derived peptide(s)) in the fusion relative to the function of each individual element, likely due to the connector sequence providing flexibility (autonomy) for each element in the fusion. In certain instances, the connector sequence is a sequence recognized by an enzyme or is photocleavable. For example, the connector sequence may include a protease recognition site.

[0049] In some instances, compositions are described containing two or more unlinked peptides / polypeptides / fusions comprising SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, and SEQ ID NO: 46. In some instances, a composition is described two or more peptides derived from (e.g., fragments of, comprising substitutions relative to, etc.) SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, and SEQ ID NO: 46. In some instances, a composition comprises two or more peptides comprising one or more substitutions (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more) compared to SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, and SEQ ID NO: 46.

[0050] In some embodiments, the peptides / polypeptides / fusions described herein are further modified (e.g., substitution, deletion, or addition of standard amino acids; chemical modification; etc.). Modifications that are understood in the field include N-terminal modification, C-terminal modification (which protects the peptide from proteolytic degradation), alkylation of amide groups, hydrocarbon "stapling" (e.g., to stabilize conformations). In some embodiments, the peptides / polypeptides described herein may be modified by conservative residue substitutions, for example, of the charged residues (K to R, R to K, D to E and E to D). Modifications of the terminal carboxy group include, without limitation, the amide, lower alkyl amide, constrained alkyls (e.g. branched, cyclic, fused, adamantyl) alkyl, dialkyl amide, and lower alkyl ester modifications. Lower alkyl is C1-C4 alkyl. Furthermore, one or more side groups, or terminal groups, may be protected by protective groups known to the ordinarily-skilled peptide chemist. The α-carbon of an amino acid may be mono- or dimethylated.

[0051] In some embodiments, peptides (or fusions thereof) may comprise: (i) one or more of the amino acid residues in the peptide are D-enantiomers, (ii) an N-terminally acetyl group, (iii) a deamidated C-terminal group, (iv) one or more unnatural amino acids, (v) one or more amino acid analogs, and / or (vi) one or more peptoid amino acids. In some embodiments, the peptide (or fusions thereof) or an amino acid therein comprises a modification selected from the group consisting of phosphorylation, glycosylation, ubiquitination, S-nitrosylation, methylation, N-acetylation, lipidation, lipoylation, deimination, eliminylation, disulfide bridging, isoaspartate formation, racemization, glycation; carbamylation, carbonylation, isopeptide bond formation, sulfation, succinylation, S-sulfonylation, S-sulfinylation, S-sulfenylation, S-glutathionylation, pyroglutamate formation, propionylation, adenylylation, nucleotide addition, iodination, hydroxylation, malonylation, butyrylation, amidation, C-terminal amidation, de-amidation, alkylation, acylation, biotinylation, carbamylation, oxidation, and pegylation. In some embodiments, the peptide exhibits enhanced stability relative to one of SEQ ID NOs: 5-46. In some embodiments, the peptide exhibits enhanced oxalate transport stimulation activity relative to one of SEQ ID NOs: 5-46.

[0052] In some embodiments, any embodiments described herein may comprise mimetics corresponding to Sell-derived peptide and / or variants thereof, with various modifications that are understood in the field. In some embodiments, residues in the peptide sequences described herein may be substituted with amino acids having similar characteristics (e.g., hydrophobic to hydrophobic, neutral to neutral, etc.) or having other desired characteristics (e.g., more acidic, more hydrophobic, less bulky, more bulky, etc.). In some embodiments, non-natural amino acids (or naturally-occurring amino acids other than the standard 20 amino acids) are substituted in order to achieve desired properties.

[0053] In some embodiments, residues having a side chain that is positively charged under physiological conditions, or residues where a positively-charged side chain is desired, are substituted with a residue including, but not limited to: lysine, homolysine, δ-hydroxylysine, homoarginine, 2,4-diaminobutyric acid, 3-homoarginine, D-arginine, arginal (-COOH in arginine is replaced by -CHO), 2-amino-3-guanidinopropionic acid, nitroarginine (N(G)-nitroarginine), nitrosoarginine (N(G)-nitrosoarginine), methylarginine (N-methyl-arginine), ε-N-methyllysine, allo-hydroxylysine, 2,3-diaminopropionic acid, 2,2'-diaminopimelic acid, ornithine, sym-dimethylarginine, asym-dimethylarginine, 2,6-diaminohexinic acid, p-aminobenzoic acid and 3-aminotyrosine and, histidine, 1-methylhistidine, and 3-methylhistidine.

[0054] A neutral residue is a residue having a side chain that is uncharged under physiological conditions. A polar residue preferably has at least one polar group in the side chain. In some embodiments, polar groups are selected from hydroxyl, sulfhydryl, amine, amide and ester groups or other groups which permit the formation of hydrogen bridges.

[0055] In some embodiments, residues having a side chain that is neutral / polar under physiological conditions, or residues where a neutral side chain is desired, are substituted with a residue including, but not limited to: asparagine, cysteine, glutamine, serine, threonine, tyrosine, citrulline, N-methylserine, homoserine, allo-threonine and 3,5-dinitro-tyrosine, and β-homoserine.

[0056] Residues having a non-polar, hydrophobic side chain are residues that are uncharged under physiological conditions, preferably with a hydropathy index above 0, particularly above 3. In some embodiments, non-polar, hydrophobic side chains are selected from alkyl, alkylene, alkoxy, alkenoxy, alkylsulfanyl and alkenylsulfanyl residues having from 1 to 10, preferably from 2 to 6, carbon atoms, or aryl residues having from 5 to 12 carbon atoms. In some embodiments, residues having a non-polar, hydrophobic side chain are, or residues where a non-polar, hydrophobic side chain is desired, are substituted with a residue including, but not limited to: leucine, isoleucine, valine, methionine, alanine, phenylalanine, N-methylleucine, tert-butylglycine, octylglycine, cyclohexylalanine, β-alanine, 1-aminocyclohexylcarboxylic acid, N-methylisoleucine, norleucine, norvaline, and N-methylvaline.

[0057] In some instances, peptide and polypeptides are isolated and / or purified (or substantially isolated and / or substantially purified). Accordingly, in such instances, peptides and / or polypeptides are provided in substantially isolated form. In some instances, peptides and / or polypeptides are isolated from other peptides and / or polypeptides as a result of solid phase peptide synthesis, for example. Alternatively, peptides and / or polypeptides can be substantially isolated from other proteins after cell lysis from recombinant production. Standard methods of protein purification (e.g., HPLC) can be employed to substantially purify peptides and / or polypeptides. Described herein is a preparation of peptides and / or polypeptides in a number of formulations, depending on the desired use. For example, where the polypeptide is substantially isolated (or even nearly completely isolated from other proteins), it can be formulated in a suitable medium solution for storage (e.g., under refrigerated conditions or under frozen conditions). Such preparations may contain protective agents, such as buffers, preservatives, cryprotectants (e.g., sugars such as trehalose), etc. The form of such preparations can be solutions, gels, etc. In some embodiments, peptides and / or polypeptides are prepared in lyophilized form. Moreover, such preparations can include other desired agents, such as small molecules or other peptides, polypeptides or proteins. Indeed, such a preparation comprising a mixture of different embodiments of the peptides and / or polypeptides described here may be provided.

[0058] In some instances, described herein are peptidomimetic versions of the peptide sequences described herein or variants thereof. In some instances, a peptidomimetic is characterized by an entity that retains the polarity (or non-polarity, hydrophobicity, etc.), three-dimensional size, and functionality (bioactivity) of its peptide equivalent but wherein all or a portion of the peptide bonds have been replaced (e.g., by more stable linkages). In some instances, 'stable' refers to being more resistant to chemical degradation or enzymatic degradation by hydrolytic enzymes. In some instances, the bond which replaces the amide bond (e.g., amide bond surrogate) conserves some properties of the amide bond (e.g., conformation, steric bulk, electrostatic character, capacity for hydrogen bonding, etc.). Cyclization (head-to-tail, head / tail-to-side-chain, and / or side-chain-to-side-chain) enhances peptide stability and permeability by introducing conformation constraint, thereby reducing peptide flexibility, and a cyclic enkephalin analog is highly resistant to enzymatic degradation. Chapter 14 of "Drug Design and Development", Krogsgaard, Larsen, Liljefors and Madsen (Eds) 1996, Horwood Acad. Publishers provides a general discussion of techniques for the design and synthesis of peptidomimetics. Suitable amide bond surrogates include, but are not limited to: N-alkylation (Schmidt, R. et al., Int. J. Peptide Protein Res., 1995, 46,47), retro-inverse amide (Chorev, M. and Goodman, M., Acc. Chem. Res, 1993, 26, 266), thioamide (Sherman D. B. and Spatola, A. F. J. Am. Chem. Soc., 1990, 112, 433), thioester, phosphonate, ketomethylene (Hoffman, R. V. and Kim, H. O. J. Org. Chem., 1995, 60, 5107;), hydroxymethylene, fluorovinyl (Allmendinger, T. et al., Tetrahydron Lett., 1990, 31, 7297), vinyl, methyleneamino (Sasaki, Y and Abe, J. Chem. Pharm. Bull. 1997 45, 13), methylenethio (Spatola, A. F., Methods Neurosci, 1993, 13, 19), alkane (Lavielle, S. et. al., Int. J.Peptide Protein Res., 1993, 42, 270) and sulfonamido (Luisi, G. et al. Tetrahedron Lett. 1993, 34, 2391).

[0059] As well as replacement of amide bonds, peptidomimetics may involve the replacement of larger structural moieties with di- or tripeptidomimetic structures and in this case, mimetic moieties involving the peptide bond, such as azole-derived mimetics may be used as dipeptide replacements. Suitable peptidomimetics include reduced peptides where the amide bond has been reduced to a methylene amine by treatment with a reducing agent (e.g. borane or a hydride reagent such as lithium aluminum-hydride); such a reduction has the added advantage of increasing the overall cationicity of the molecule.

[0060] Other peptidomimetics include peptoids formed, for example, by the stepwise synthesis of amide-functionalised polyglycines. Some peptidomimetic backbones will be readily available from their peptide precursors, such as peptides which have been permethylated, suitable methods are described by Ostresh, J. M. et al. in Proc. Natl. Acad. Sci. USA (1994) 91, 11138-11142.

[0061] In some instances, described herein are pharmaceutical compositions comprising of one or more Sel1-derived peptides or fusions or variants thereof and a pharmaceutically acceptable carrier. Any carrier which can supply an active peptide or polypeptide (e.g., without destroying the peptide or polypeptide within the carrier) is a suitable carrier, and such carriers are well known in the art. In some instances, compositions are formulated for administration by any suitable route, including but not limited to, orally (e.g., such as in the form of tablets, capsules, granules or powders), sublingually, bucally, parenterally (such as by subcutaneous, intravenous, intramuscular, intradermal, or intracisternal injection or infusion (e.g., as sterile injectable aqueous or non-aqueous solutions or suspensions, etc.)), nasally (including administration to the nasal membranes, such as by inhalation spray), topically (such as in the form of a cream or ointment), transdermally (such as by transdermal patch), rectally (such as in the form of suppositories), etc.

[0062] In some embodiments, provided herein are compositions for use of the invention, wherein the compositions are for use in methods for treating patients suffering from (or at risk of) hyperoxaluria, hyperoxalemia, and / or in need of treatment (or preventative therapy). In some embodiments, a pharmaceutical composition comprising at least one Sel1-derived peptide described herein (or fusions or variants thereof) is delivered to such a patient in an amount and at a location sufficient to treat the condition. In some embodiments, pharmaceutical compositions can be delivered to the patient systemically or locally, and it will be within the ordinary skill of the medical professional treating such patient to ascertain the most appropriate delivery route, time course, and dosage for treatment. It will be appreciated that application methods of treating a patient most preferably substantially alleviates or even eliminates such symptoms; however, as with many medical treatments, application of the inventive method is deemed successful if, during, following, or otherwise as a result of the inventive method, the symptoms of the disease or disorder in the patient subside to an ascertainable degree.

[0063] A pharmaceutical composition may be administered in the form which is formulated with a pharmaceutically acceptable carrier and optional excipients, adjuvants, etc. in accordance with good pharmaceutical practice. The Sel1-derived peptide (or fusions or variants thereof) pharmaceutical composition may be in the form of a solid, semi-solid or liquid dosage form: such as powder, solution, elixir, syrup, suspension, cream, drops, paste and spray. As those skilled in the art would recognize, depending on the chosen route of administration (e.g. pill, injection, etc.), the composition form is determined. In general, it is preferred to use a unit dosage form in order to achieve an easy and accurate administration of the active pharmaceutical peptide or polypeptide. In general, the therapeutically effective pharmaceutical compound is present in such a dosage form at a concentration level ranging from about 0.5% to about 99% by weight of the total composition, e.g., in an amount sufficient to provide the desired unit dose. In some embodiments, the pharmaceutical composition may be administered in single or multiple doses. The particular route of administration and the dosage regimen will be determined by one of skill in keeping with the condition of the individual to be treated and said individual's response to the treatment. In some embodiments, Sel1-derived peptide described herein (or fusions or variants thereof) pharmaceutical composition is provided in a unit dosage form for administration to a subject, comprising one or more nontoxic pharmaceutically acceptable carriers, adjuvants or vehicles. The amount of the active ingredient that may be combined with such materials to produce a single dosage form will vary depending upon various factors, as indicated above. A variety of materials can be used as carriers, adjuvants and vehicles in the composition of the invention, as available in the pharmaceutical art. Injectable preparations, such as oleaginous solutions, suspensions or emulsions, may be formulated as known in the art, using suitable dispersing or wetting agents and suspending agents, as needed. The sterile injectable preparation may employ a nontoxic parenterally acceptable diluent or solvent such as sterile nonpyrogenic water or 1,3-butanediol. Among the other acceptable vehicles and solvents that may be employed are 5% dextrose injection, Ringer's injection and isotonic sodium chloride injection (as described in the USP / NF). In addition, sterile, fixed oils may be conventionally employed as solvents or suspending media. For this purpose, any bland fixed oil may be used, including synthetic mono-, di- or triglycerides. Fatty acids such as oleic acid can also be used in the preparation of injectable compositions.

[0064] In various embodiments, the peptides disclosed herein are derivatized by conjugation to one or more polymers or small molecule substituents.

[0065] In certain of these embodiments, the Sel1-derived peptides described herein (or fusions or variants thereof) are derivatized by coupling to polyethylene glycol (PEG). Coupling may be performed using known processes. See, Int. J. Hematology, 68:1 (1998); Bioconjugate Chem., 6:150 (1995); and Crit. Rev. Therap. Drug Carrier Sys., 9:249 (1992). Those skilled in the art, therefore, will be able to utilize such well-known techniques for linking one or more polyethylene glycol polymers to the peptides and polypeptides described herein. Suitable polyethylene glycol polymers typically are commercially available or may be made by techniques well known to those skilled in the art. The polyethylene glycol polymers preferably have molecular weights between 500 and 20,000 and may be branched or straight chain polymers.

[0066] The attachment of a PEG to a peptide or polypeptide described herein can be accomplished by coupling to amino, carboxyl or thiol groups. These groups will typically be the N- and C-termini and on the side chains of such naturally occurring amino acids as lysine, aspartic acid, glutamic acid and cysteine. Since the peptides and polypeptides of the present disclosure can be prepared by solid phase peptide chemistry techniques, a variety of moieties containing diamino and dicarboxylic groups with orthogonal protecting groups can be introduced for conjugation to PEG.

[0067] The present disclosure also provides for conjugation of the Sell-derived peptides described herein (or fusions or variants thereof) to one or more polymers other than polyethylene glycol.

[0068] In some embodiments, the Sel1-derived peptides described herein (or fusions or variants thereof) are derivatized by conjugation or linkage to, or attachment of, polyamino acids (e.g., poly-his, poly-arg, poly-lys, etc.) and / or fatty acid chains of various lengths to the N- or C-terminus or amino acid residue side chains. In certain embodiments, the peptides and polypeptides described herein are derivatized by the addition of polyamide chains, particularly polyamide chains of precise lengths, as described in U.S. Pat. No. 6,552,167. In yet other embodiments, the peptides and polypeptides are modified by the addition of alkylPEG moieties as described in U.S. Pat. Nos. 5,359,030 and 5,681,811.

[0069] In select embodiments, the Sel1-derived peptides described herein (or fusions or variants thereof) are derivatized by conjugation to polymers that include albumin and gelatin. See, Gombotz and Pettit, Bioconjugate Chem., 6:332-351, 1995.

[0070] In further embodiments, the Sel1-derived peptides described herein (or fusions or variants thereof) are conjugated or fused to immunoglobulins or immunoglobulin fragments, such as antibody Fc regions.

[0071] In some instances, the pharmaceutical compositions described herein (e.g., comprising the Sell-derived peptides described herein (or fusions or variants thereof) find use in the treatment and / or prevention of hyperoxaluria, hyperoxalemia, and related conditions. In some embodiments, the compositions are administered to a subject. In certain embodiments, the patient is an adult. In other embodiments, the patient is a child.

[0072] In various embodiments, the Sel1-derived peptides described herein (or fusions or variants thereof) are administered in an amount, on a schedule, and for a duration sufficient to decrease triglyceride levels by at least 5%, 10%, 15%, 20% or 25% or more as compared to levels just prior to initiation of treatment. In some embodiments, the Sell-derived peptides described herein (or fusions or variants thereof) are administered in an amount, on a dosage schedule, and for a duration sufficient to decrease oxalate levels (e.g., in urine, in plasma) by at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or 50%. In particular embodiments, the Sel1-derived peptides described herein (or fusions or variants thereof) are administered in an amount, on a schedule, and for a time sufficient to decrease oxalate levels (e.g., in urine, in plasma) by at least 55%, 60%, 65%, even at least about 70% or more.

[0073] In certain embodiments, the Sel1-derived peptides described herein (or fusions or variants thereof) are administered in an amount, expressed as a daily equivalent dose regardless of dosing frequency, of 50 micrograms ("mcg") per day, 60 mcg per day, 70 mcg per day, 75 mcg per day, 100 mcg per day, 150 mcg per day, 200 mcg per day, or 250 mcg per day. In some embodiments, the Sel1-derived peptides described herein (or fusions or variants thereof) are administered in an amount of 500 mcg per day, 750 mcg per day, or 1 milligram ("mg") per day. In yet further embodiments, the Sell-derived peptides described herein (or fusions or variants thereof) are administered in an amount, expressed as a daily equivalent dose regardless of dosing frequency, of 1 - 10 mg per day, including 1 mg per day, 1.5 mg per day, 1.75 mg per day, 2 mg per day, 2.5 mg per day, 3 mg per day, 3.5 mg per day, 4 mg per day, 4.5 mg per day, 5 mg per day, 5.5 mg per day, 6 mg per day, 6.5 mg per day, 7 mg per day, 7.5 mg per day, 8 mg per day, 8.5 mg per day, 9 mg per day, 9.5 mg per day, or 10 mg per day.

[0074] In various embodiments, the Sel1-derived peptides described herein (or fusions or variants thereof) are administered on a monthly, biweekly, weekly, daily ("QD"), or twice a day ("BID") dosage schedule. In other embodiments, the peptide / polypeptide is administered. In typical embodiments, the peptide / polypeptide is administered for at least 3 months, at least 6 months, at least 12 months, or more. In some embodiments, Sel1-derived peptides described herein (or fusions or variants thereof) are administered for at least 18 months, 2 years, 3 years, or more.EXPERIMENTAL

[0075] Of-derived factors are secreted in its culture conditioned medium (CM) that significantly stimulate (>2.8-fold) oxalate transport by human intestinal Caco2-BBE (C2) cells through PKA activation and stimulation of the oxalate transporters SLC26A6 (A6) and SLC26A2 (A2). In vivo, rectal administration of Of CM reduced urinary oxalate excretion > 32.5% in hyperoxaluric mice, and stimulated colonic oxalate secretion >42%, reflecting the therapeutic impact of these factors. Multiple Sel1 proteins are involved in protein-protein interactions and signal transduction pathways as the major Of-derived factors. These Sell proteins closely recapitulate the effects of the Of-derived factors and similarly stimulate (1.4-2.4-fold) oxalate transport by C2 cells via PKA and the A2 / A6 transporters. 35-amino acid peptides (P7-10) within a Sell protein are identified which significantly stimulate (1.5-fold individually and >2.4-fold by P8+9) oxalate transport by C2 cells. P8+9 peptides also significantly stimulated oxalate transport by human sigmoid colon (1.8-fold), distal colon (1.7-fold), and ileum (2-fold) organoids (ex vivo intestinal epithelia models fully mimicking the in vivo physiological responses), indicating that P8+9 peptides will stimulate oxalate transport in human colonic and ileal epithelia in vivo. Therefore, the identification and characterization of the active motifs responsible for colonic oxalate transport provides an effective drug for reducing plasma and urine oxalate levels.

[0076] Sell (sel: suppressor-enhancer of lin) proteins are identified as the major Of-derived secreted factors. Sell proteins are in the family of solenoid proteins, distinguishable from general globular proteins by the presence of intra-molecular sequence similarities (repeats) that lead to their modular architectures (Ref. 25). A cross-genome analysis of repeats revealed an α / α-repeat consisting of 36 to 44 amino acids called Sell-like repeat (SLR). SLR proteins (e.g. Sell, Hrd3, etc.) are involved in protein-protein interactions and signal transduction pathways (Ref. 25) and the latter is important since CM stimulates oxalate transport through PKA activation. SLR proteins serve as adaptor proteins for the assembly of membrane-bound macromolecular complexes (Ref. 25), which might include oxalate transporters (e.g. A6) and other regulatory proteins. Several bacterial and eukaryotic SLR proteins (e.g. Sell) are activated upon cellular stress (Ref. 25), which of significant interest since Of Sel1 proteins might be activated when oxalate is limited given the observation of >2-fold higher stimulatory effects from the CM under this condition (Ref. 4). The Of genome has 44 Sell genes, which are significantly over-represented and reflects the importance of Sel1 proteins for Of. The dependence of Of on oxalate for viability might explain why it has 44 Sell proteins, and it is possible that Of utilizes Sel1 proteins to derive oxalate from blood by inducing colonic secretion, as observed with CM, to sustain its survival when dietary oxalate is limited. Supporting this notion, SLR proteins mediate the interactions between bacterial and eukaryotic host cells and establishes a link between signal transduction pathways from eukaryotes and bacteria. Most of the 44 Sel1 proteins have signal peptides and therefore are secreted proteins. SLR proteins are involved in the ER-associated protein degradation (ERAD) and may also be responsible for the adaptation of bacteria to different eukaryotic hosts.

[0077] Experiments conducted during development of embodiments herein demonstrated that certain Sell proteins (e.g., 301, 310, 318, and 321) are capable of significantly stimulating oxalate transport by cells (See, PCT / US18 / 14494). Sel1 proteins 301 and 318 have been demonstrated to be the most potent stimulators of oxalate transport in human Caco2-BBE (C2) cells, and are predicted to have six (P1-P6; Table 1) and five (P7-P11; Table 2) SLR domains (each 30-35 amino acids in length and called peptides here), respectively. Table 1. Predicted 301 SLR domains P1ADAQNRLGIAYRYGTGVRKNPALSVKWLEKAAKQGSEQ ID NO: 5P2QYNLGVAYYYGRGIKKDFSEAVSWYKKSAESEQ ID NO: 6P3AYHNLGTAYYDGIGVDKNPHEAVRWWKKAAELGSEQ ID NO: 7P4QSQYNLGIAYEEGWGAEKNPENAVFWYRKAAEQGHSEQ ID NO: 8P5ARAQFNLGKTFYIGAGINKNTDKAVYWFIKAANQGSEQ ID NO: 9P6ESQNNLGALYNDGNGVDRDYQEAVFWYRKSALQGDSEQ ID NO: 10 Table 2. Predicted 318 SLR domains P7EAQYNMGYHYAEGKGVPRDQGKAVFWYEKAAAAGDSEQ ID NO: 11P8DAQYMLGAMSVEGIGLPKDSQVALTWLSKAAAQGDSEQ ID NO: 12P9AKAQYGLGII,YAKGQGVAPDQEKALII,YRMAATQGSEQ ID NO: 13 P10ATAEYAVGLAYAYGRGTAQNDVKAADWFEAAAQQGSEQ ID NO: 14P11EAQRRWALMLASGRGVAKNEGEALKWFKKAAVAGDSEQ ID NO: 15

[0078] Sell proteins 310, 301 (from the human strain OXCC13), 317, 319, 321, 304, and 322 also contain predicted SLR domains (Tables 3-9). Table 3. Predicted 310 SLR domains P12ALAQSNLGVLYASGRGVESSPKRALEWYKKAAVQGNSEQ ID NO: 16P13SQAQFSLGNMYEDGSGVEKNLAVAAAWYQKSAEQGNSEQ ID NO: 17P14AEAQTNLGVLYSYGLGVDKDLSKAFYWYSEQ ID NO: 18P15ESQDRLGLMLTNGVGVKQDYKQAYSWFRKAARQGSEQ ID NO: 19P16AESQNNLGVLYARGLGVEKDYKQAVAWYRKASEQ ID NO: 20P17QAQFNLGTMYLQGHGVKQDVKQARHWFTKAAAQSEQ ID NO: 21 Table 4. Predicted 301 (human strain OXCC13) SLR domains P1HAQAQHNLGVTYYEGEGIKKDYAKAVYWWKKAAEQGSEQ ID NO: 22P2HPQSQYNLGIAYEEGWGAEKNPENAVFWYRKAAEQGHSEQ ID NO: 23P3HEAQAYIGMIYFKGKYVAKNEKKGFYWLKKAAEKDSSEQ ID NO: 24 Table 5. Predicted 317 SLR domains ALYGLGVMATNGLGMPRNDEKALVWFREGAAKGSEQ ID NO: 25EAQFGLGAMYDLSRGVRQDMTLAIDWYEKSARAGSEQ ID NO: 26 Table 6. Predicted 319 SLR domains QLYLGLMYGHGKGVPRDLNKSLFWVEKAADRGSEQ ID NO: 27AQYLMGMAYLEGKSVPQDLPVAAAWFYKAAMQGNSEQ ID NO: 28ADAQLRLGYMYARGIGVPVDKPKAVAWLEKAASAGNSEQ ID NO: 29 Table 7. Predicted 321 SLR domains GSMLSQGKGVEKDPKKGLEWFVQAGQDGDSEQ ID NO: 30SEAQQMMGFLYGEGWGAKRDPVKAEYWFDKAAASGDSEQ ID NO: 31 Table 8. Predicted 304 SLR domains QAEHEMGSLYLMGIGVAQSNVMAVAWYRKAAIQGSEQ ID NO: 32APSQTAMGYAYEEGAGVPQDADLARYWFDKAAAQGNSEQ ID NO: 33 Table 9. Predicted 322 SLR domains AQAGLGWMYAAGRGVNKDETLSFSWYERAAVAGSEQ ID NO: 34AQYMLGRYYEKGIGVAKDRVLAKEWYEKAAAQGNSEQ ID NO: 35

[0079] Also identified herein are tetratricopeptide repeat (TPR) sequences. A TPR is a structural motif comprising a degenerate 34 amino acid sequence. The TPR sequences identified herein (Table 10) and variants and mimetics thereof find use as described herein (e.g., in place of SLR peptides, with SLR peptides, etc.). Table 10. Predicted TPR sequences TRP1SEQ ID NO: 36TRP2SEQ ID NO: 37TRP3SEQ ID NO: 38

[0080] Experiments were conducted during development of embodiments herein to determine whether individual Sel1 301 SLR peptides and / or combinations of multiple Sel1 301 SLR peptides are capable of stimulating oxalate influx into human Caco2-BBE (C2) cells. Significant stimulation of 14< C-oxalate influx into human C2 cells was observed (Figure 1).

[0081] Sel1 318 is the only Sel1 protein identified by mass spectroscopic analysis of the human Oxalobacter formigenes (Of) strain OXCC13 genome using a stringent search (Maxquant: 20ppm, with additional filtering at 1% FDR); several Sell proteins are identified by a less stringent search. Sel1 318 is separated by 3 genes from 5 other Sel1 genes located together in a potential operon (304 / 319-322); Sell 318 is also a few genes away from Sell 317 and Sell 310, which are located near each other. Collectively, these observations indicate that Sell 318 a key Sell protein for Of. Several Sell 318-derived peptides individually stimulate 14< C-oxalate influx into Caco2-BBE cells (Figure 2).

[0082] 301 (54 kDa) and 318 (52 kDa) Sell proteins have several SLR motifs (30-35 amino acids [aa] in length; called here peptides 1-6 [P1-6 for 301] and 7-11 [P7-11 for 318]; Fig. 8 ); it is contemplated that one or more of these domains mediate the observed stimulation, given their importance in protein-protein interactions and signal transduction pathways. To test this hypothesis, P1-6 and P7-11 peptides from the human Of strain OXCC13 were chemically synthetized by Genscript (NJ, USA). P4 (1.5-fold) and P4-6 (1.8-fold) significantly stimulated oxalate transport by C2 cells (fig. 1), while P1-3, 5 & 6 had no effects. Individually, P7-10 significantly stimulated (~1.5-fold) oxalate transport by C2 cells (Fig. 2). The combination of P8+9 stimulated oxalate transport >2.4-fold by C2 cells, similar to the CM (Fig. 3), in a dose-dependent manner (Fig. 4) and more than any other combination. Of interest is that 318 (P7-11) is the only Sel1 protein identified when the Mass-Spec data was analyzed against OXCC13 genome when a highly stringent search was used. 318 gene is near 7 other Sel1 genes (319-323, located together in a potential operon, and 310 / 317), collectively making 318 a key Sell protein for Of. P8+9-induced stimulation is better than the 318-induced stimulation potentially due to the batch to batch variability observed with recombinant 318 generated in E. coli. In addition to SLR motifs, 318 is also predicted to have 2 TPR (tetratricopeptide repeat; 34 aa) motifs, and studies are in progress to evaluate their effects on oxalate transport given their important roles in protein-protein interactions and signaling pathways. Having identified these small peptides, the potential for therapeutic development increases since from a drug development prospective it is highly desirable to work with small peptides rather than large proteins.

[0083] Two of the most potent stimulators of oxalate influx were tested together, and it was demonstrated that P8+9 peptides significantly stimulate (>2.4-fold) oxalate transport by C2 cells to a level about similar to the Oxalobacter-derived culture conditioned medium (CM: >2.6-fold) (Figure 3). The P8+9 peptides significantly stimulate oxalate transport by C2 cells in a dose-dependent manner, indicating a receptor-ligand-type interaction (Figure 4). Several other P7-P11 peptide combinations (including all of them together) stimulate oxalate transport by C2 cells to a level less than observed with P8+9 in preliminary studies.

[0084] Although the transformed C2 cells resemble the native epithelium, they don't fully recapitulate the in vivo physiological responses. Primary stem-cell derived intestinal organoids (Orgs) were recently established as an ex vivo model of the intestinal epithelium, and they mimic the full spectrum of physiological responses in vivo. Therefore, experiments were conducted during development of embodiments herein to confirm theC2 findings in colonic organoids. P7-10 peptides significantly stimulate (1.8-fold) oxalate transport by human sigmoid colon organoid and human ileum organoid (Figure 6); thereby confirming the results determined in C2 cells. Additionally, experiments conducted during development of embodiments herein demonstrate that P8+9 peptides significantly stimulated oxalate transport by an ileum (Figure 5A; ~2-fold),sigmoid colon (Figure 5B; ~1.8-fold), and distal colon (~1.7-fold; not shown) organoids.

[0085] The intestine plays a major role in oxalate homeostasis, responsible for dietary oxalate absorption and gastrointestinal oxalate secretion / excretion. Animals and humans studies show that Of metabolizes dietary oxalate leading to reduced intestinal absorption and urinary oxalate excretion (Refs. 8, 30). Of is an anaerobic colonic bacterium which utilizes oxalate as its exclusive energy source (Ref. 17). In addition to degrading dietary oxalate, Of, for its own potential survival benefit, also interacts with the colonic epithelium to induce colonic oxalate secretion via a secretagogue, leading to reduced urinary oxalate excretion (Ref. 15). Of colonization of a mouse model for PH type I was associated with 50% reduction in serum and urinary oxalate levels due to induction of colonic oxalate secretion (Ref. 18). However, PH1 mice lost colonization within 18 days when switched from a high oxalate / low calcium diet (1.5% oxalate / 0.5% calcium) to regular mouse chow (0.25% oxalate / 1% calcium) (Ref. 18). In addition, sustaining Of colonization in rats required a 3% dietary oxalate and colonized rats lost Of colonization within 5 days of dietary oxalate removal. Of colonized rats on high oxalate diets demonstrated greater urinary oxalate levels than that of non-colonized rats on a low oxalate diet and colonization was not maintained without reducing dietary calcium intake. Furthermore, studies in PH patients & PH1 mice raise the possibility that the intraluminal environment in PH is not supportive of sustained Of colonization (Refs. 18-19). These limitations have resulted in the failure of several phase I-III trials using Of to lower urine or plasma oxalate levels in PH patients. Therefore, an appropriate strategy is to use Of-derived factors that can be directly administered to stimulate intestinal oxalate secretion to lower urine and plasma oxalate levels.

[0086] Toward this end, Of culture conditioned medium (CM) was prepared as recently reported (Ref. 4) and human intestinal Caco2-BBE (C2) cells were used to evaluate the effects of Of CM on intestinal oxalate transport. Apical oxalate uptake by C2 cells was measured by imposing an outward Cl gradient by removing extracellular Cl [Cli > Clo] (Refs. 3, 4, 14) and measuring DIDS (anion exchange inhibitor)-sensitive influx of 14C-oxalate in exchange for intracellular Cl [i.e. apical Cl-oxalate exchange activity, ≥ 49% of which is mediated by the oxalate transporter SLC26A6 (A6) in C2 cells (4, 12) )]. A6 is the critical transport mechanism for exchanging intracellular oxalate for mucosal Cl during the process of transepithelial intestinal oxalate secretion, but its activity was measured by the more convenient assay of cellular oxalate uptake since it can transport oxalate in either direction (Ref. 22) Of note is that A6 null mice have a critical defect in intestinal oxalate secretion resulting in enhanced net absorption of dietary oxalate, hyperoxalemia, hyperoxaluria, and a high incidence of COKS (Refs. 13, 21).

[0087] Of-derived factors, such as the peptides described herein, stimulate oxalate transport in vitro: Preincubation of C2 cells with Of CM (1:50 dilution x 24 h) stimulated oxalate transport >2.8-fold compared to untreated cells (UT) or cells treated with Of growth medium without bacteria included (OM) (UT = 3.1±0.2; OM = 2.9±0.3; CM = 9.1±0.9 pmoles / cm2 / min) (Ref. 4). CM from Lactobacillus acidophilus did not impact oxalate transport, indicating specificity (Ref. 4). Pretreatment of the CM with heat, pepsin, or trypsin completely abolished its stimulatory effects, indicating that the secreted factor(s) is / are likely to be proteins and / or peptides (Ref. 4). Selective ultrafiltration revealed that the secreted factors have molecular weights mostly between 10-30 kDa (Ref. 4). Pretreatment with the PKA inhibitor H89 completely blocked CM-induced oxalate transport, indicating that it is mediated by PKA activation (4). CM-induced stimulation is DIDS-sensitive and knockdown studies showed that stimulation is largely mediated by A6 (Ref. 4), as well as A2. Lowering oxalate concentration in the culture medium from 5 g / L to 1 g / L led to a CM with >2-fold higher stimulatory effect (Ref. 4), while increasing oxalate to 25 g / L led to a CM with 50% reduced activity, indicating that the secretion of these factors is inducible. CM-induced transport is due to >2-fold increase in Vmax (i.e. enhanced transport capacity) and >3.4-fold reduction in Km [i.e. increased affinity for oxalate] of the involved transporter(s) (Ref. 4). CM did not affect A6 surface protein expression (Ref. 4), and given the reduced Km (greater A6 affinity for oxalate), the observed stimulation is due to CM-induced increase in the intrinsic activity of the preexisting A6 membrane transporters.

[0088] To recapitulate the findings in vivo, primary stem-cell derived intestinal organoids (Org) were used which have been established as an ex vivo model of the intestinal epithelium with a full spectrum of physiological responses found in vivo (Ref. 35). A human sigmoid colonic Org (from a healthy individual) was grown and maintained as previously reported (Ref. 34). Org cells were plated onto collagen-coated transwell filters and formed monolayers. Monolayer confluency and differentiation was confirmed by transepithelial electrical resistance measurements (Ref. 34). Org cells demonstrated transport of oxalate measured as influx of 14< C-oxalate in exchange for intracellular Cl. The influx of 14< C-oxalate is DIDS-sensitive (inhibited by ~70% with 100 µM DIDS), indicating that it is anion exchange mediated oxalate transport. An ileum Org was developed which demonstrates DIDS-sensitive (inhibited by ~80% with 500 µM DIDS) oxalate transport. Importantly, P8+9 (100 µg / ml x 24 h) significantly stimulated oxalate transport by the ileum Org (2-fold; Fig. 5A) and the sigmoid Org (1.8-fold; Fig. 5B). These results show that P8+9 stimulates oxalate transport by human Org as observed in C2 cells, suggesting that these peptides are very likely to work in humans in vivo.Peptides Modifications to enhance their in vivo stabilities

[0089] Given P4-10 peptides susceptibilities to proteolytic degradation, the lead peptides are optimized to improve peptide druggability through structural modification approaches that reduce proteolysis and thus enhance stability. Proteolytic enzymes like aminopeptidases and carboxypeptidases break down peptide sequences from the N- and C-termini, and therefore N- (acetylation) and / or C- (amidation) terminal modifications can improve peptide stability (Ref. 36). Of note is that the N-terminal acetylated forms of GLP1 7-34 and somatostatin analogs were shown to be much more stable than the native peptides (Ref. 36). In addition, substitution of natural L-amino acids with non-natural D-amino is known to reduce the substrate recognition and binding affinity of proteolytic enzymes and enhances peptide stability (Ref. 36). An example is the drug- octreotide, in which replacing L-amino acids with D-amino acids prolonged the human in vivo half-life from a few minutes to 1.5 h (Ref. 36). Moreover, cyclization (head-to-tail, head / tail-to-side-chain, and / or side-chain-to-side-chain) enhances peptide stability and permeability by introducing conformation constraint, thereby reducing peptide flexibility, and a cyclic enkephalin analog is highly resistant to enzymatic degradation (Ref. 36). Furthermore, modification of natural amino acids improves peptide stability by introducing steric hindrance or disrupting enzyme recognition. An example is buserelin, in which one Gly is replaced with a t-butyl-D-Ser and another Gly is replaced with ethylamide, leading to prolonged half-life in humans compared to a very short half-life (minutes) in the unmodified GRH (Ref. 36). P4-11 peptides are subjected to all of the above described modifications. The Gly residues in each peptide are substituted with PEG6, which is much better than PEG4 for peptide stabilization. In addition, both N-acetylation and C-amidation in the same peptide as well as applying N-acetylation or C-amidation in conjunction with amino acid substitution are made. Moreover, peptides that are cationic show fast degradation due to their arginine (R) and lysine (K) contents and therefore, the R residues in the peptides of this invention may be replaced with the arginine homologue Agp to enhance their stabilities (Ref. 36). Replacing all R with Agp in peptide Sub3 led to a dramatic increase in its stability (Ref. 37).Identification of P8 and P9 functional subdomains

[0090] The 318 homology-based structure has a long helical structure composed of many alpha helix hairpins. 318 is predicted to have 5 SLR motifs (P7-11; Fig. 8), and each SLR motif is composed of 2 alpha helices (underlined aa for P8 and P9; Fig. 7), separated by a loop (bolded aa; Fig. 7). G14 & 16 in the loop are conserved in all P1-11 peptides and they are likely important for the structure. Y96, A122, Q125, and G126 in P8 and Y243, A269, Q272, and G273 in P9 are close to each other and potentially form the binding sites. Similar sequences are also found in P4 (from 301), P7, and P10. Of remarkable interest is that only P4 and P7-10 individually stimulated oxalate transport (~1.5-fold) by C2 cells. P1-3, 5, 6, and 11 don't have similar sequences, especially Y, and they don't stimulate oxalate transport by C2 cells. Conserved P8 & P9 aa are shown in blue (Fig. 7). Detailed analysis of the P8 and 9 structures indicates that the only regions that can be potentially deleted without affecting their functions will be the 4 aa (boxed) from each helix. Deleting > 4 aa would likely disrupt the helix function. Therefore, AMSV / QVAL and ILYA / QEKA will be deleted from P8 and P9, respectively, to identify the smallest P8 and P9 subdomains that stimulate oxalate transport similar to the full-length peptides. The truncated peptides (P8: RDAQYMLGEGIGLPKDSTWLSKAAAQGD; P9: AKAQYGLGKGQGVAPDLILYRMAATQG) will be chemically synthesized by Genscript, 1-4 mg which is sufficient for the studies, and >95% purity. If the truncated P8 and P9 similarly stimulate oxalate transport by C2 cells as the full-length peptides, this will confirm successful shortening of each peptide by 8 aa. Additional modifications include deleting the first and last aa in each loop (E / S in P8 and K / D in P9) and the effects of the truncated P8 and 9 will be similarly assessed. If the truncated P8 and P9 similarly stimulate oxalate transport by C2 cells as the full-length peptides, this will confirm successful shortening of each peptide by 10 aa.

[0091] The SLR consensus sequence highlights conserved alanine (A) and glycine (G) residues at positions 3, 8, 14, 24, 32, 39, 40 and 43. The G residues at positions 14, 24, and 43 facilitate sharp turns in the loop regions and small residues at positions 3, 8, 32, 39, and 40 allow tight packing of α-helices. Both P8 and P9 have A at positions 3, 24, & 32 (A94 / 241, A115 / 262, and A123 / 270, respectively) and G at positions 8 & 14 (G99 / 246 and G105 / 252). In addition, Y96, A122, Q125, and G126 in P8 and Y243, A269, Q272, and G273 in P9 form the potential binding sites. It is contemplated that one or more of these conserved aa (individually or in combination), especially those form the potential binding site, is / are crucial for the observed stimulation by facilitating the binding to a receptor and / or other interacting proteins. To define the critical aa in the identified subdomains, the above described conserved aa is substituted as follows. Y96 / 243 will be substituted with phenylalanine (F), while the specified A, Q, & G will be substituted with tyrosine (Y). The individual substitutions are Y96 / 243, A122 / 269, Q125 / 272, G126 / G273, A94 / 241, A115 / 262, A123 / 270G8, G99 / 246, and G105 / 252 or combinations thereof. Further deletion combinations include 3 aa (AMS / QVA or MSV / VAL and ILY / QEK or LYA / EKA), 2 aa (AM / QV, MS / VA, or SV / AL and IL / QE, LY / EK, or YA / KA), or single aa deletions (e.g. A / Q or V / L). Complete abolishment or reduction of subdomain-mediated stimulation of oxalate transport by C2 cells denote critical residues needed to activity.

[0092] P8+9 are designed to have N-terminal or C-terminal biotin tags used to pull down complexes. Biotinylated P4-6 peptides with N-terminal biotin tags stimulated oxalate transport by C2 cells similar to the untagged P4-6 peptides, indicating that the biotin tags are unlikely to affect P8+9 activities.In vivo efficacy testing of peptides.

[0093] Having effectively optimized the characterized P8+9 subdomains, the optimized subdomains are tested to determine whether the peptides retain their biological activities in vivo and significantly reduce urine and plasma oxalate levels in hyperoxaluric and hyperoxalemic mice. The CM significantly reduced (>32.5%) urinary oxalate excretion in PH1 mice (Ref. 4), and therefore these mice are used to evaluate the therapeutic potential of the optimized peptides and peptides subdomains. PH1 mice using one sex (males; 3 doses; n = 5 / dose; Control mice receive a vehicle) receive optimized subdomains SD8 and SD9 in pilot dose ranging (3 different doses for each of SD8, SD9, and SD8+9 for up to 4 weeks). The doses found to work well (leading to the highest reduction in urine and plasma oxalate levels) are further tested in both sexes. To this end, PH1 mice (12-20 weeks old; n = 14 / sex / treatment group) are placed individually in metabolic cages and urine & feces are collected on days 0, 7, 14, 21, & 28. Blood samples are collected on days 0, 14, and 28. Following baseline urine, blood, and fecal samples collection, the mice receive SD8+9 (if found to give the highest reduction in urine and plasma oxalate levels in the pilot studies described above) rectally as enemas (100 µl twice daily x 28 days) using the optimal doses developed in the pilot studies. Control mice receive vehicle (the buffer in which the subdomains are dissolved). The urine and blood samples are acidified with 4N HCL and stored at -80 °C. Urine, plasma, and fecal oxalate levels are measured enzymatically using oxalate oxidase, employing sodium nitrite (Ref. 32) to prevent interference by ascorbic acid.

[0094] Observing normalization or significantly reduced urine and plasma oxalate levels in SD8+9-treated PH1 mice compared with vehicle-treated ones reflect in vivo retention of SD8+9 biological activities and the significant therapeutic potential of these peptides. As a result of enhanced colonic oxalate secretion, fecal oxalate levels are higher in the SD8+9-treated mice. In addition to reducing urinary oxalate excretion in PH and without being bound by theory, SD8+9 effectively lowers urinary oxalate excretion in EH, which is seen in association with many conditions, including IBD, obesity, and post-bariatric surgery. This is very important since showing that SD8+9 can significantly reduce urine oxalate levels in both PH and EH prove that SD8+9 are effective in all forms of hyperoxalurias and thus have a wider clinical applicability. To this end, SD8+9 is administered rectally to SAPM1 / YitFc (SAM) and ob / ob (ob) mice (8-12 weeks old; n = 14 / sex / treatment group). SAM is a mouse model with remarkable similarities to human Crohn's disease that the inventors developed as a good model for the IBD-associated hyperoxaluria. SAM mice have 2-fold hyperoxaluria compared to controls, as well as significantly reduced A6 ileal mRNA (>87%) and total protein (>60%) levels. ob is an obesity model developed as a good model for the obesity-associated hyperoxaluria (>3.2-fold hyperoxaluria compared to controls) (Ref. 32). Of note is that the doses found to work in PH1 mice are expected to work in SAM mice (similar body weights), but unlikely to work in the obese ob mice (having at least twice the body weights of PH1 mice). Therefore, a dose ranging study will be done in ob mice. SAM and ob mice are similarly treated with SD8+9 and the data are analyzed as described above with the PH1 mice.

[0095] Having shown that SD8+9 significantly reduce plasma and urine oxalate levels in PH1 as well as urine oxalate levels in the ob and SAM mice, experiments are conducted to demonstrate that the observed reduction in urine and plasma oxalate levels is due to SD8+9-induced enhanced colonic oxalate secretion. Toward this end, cecal, proximal, and distal colonic tissues from SD8+9 - and vehicle-treated PH1, ob, and SAM mice are isolated and mounted in Ussing chambers at the end of treatment. Two unidirectional [mucosa to serosa = JMS (absorptive flux), and serosa to mucosa = JSM (secretory flux)] are assessed and the magnitude and direction of the net flux (Jnet) across conductance-matched tissues are determined by calculating the difference between the two measured unidirectional fluxes as previously reported (Ref. 4). Compared to vehicle-treated mice, if net basal cecal oxalate flux is converted from absorption to secretion, or significantly higher net basal secretory flux is observed in the proximal and / or the distal colon of SD8+9-treated mice [due to significantly increased secretory flux and / or reduced absorptive flux(es)], then such findings strongly support the idea that SD8+9 reduce serum and urine oxalate levels in PH1 mice and urine oxalate levels in ob and SAM mice by enhancing colonic oxalate secretion. Collectively, such findings provide a molecular basis for therapeutic application of SD8+9 for prevention and / or treatment of hyperoxaluria, hyperoxalemia, and related COKS.

[0096] Experiments were conducted during development of embodiments herein to determine the effects of various peptide modifications (Table 11) including N-terminal acetylation, C-terminal amidation, replacing glycines with PEG, and replacing L-amino acids with D-amino acids on stimulation of oxalate transport. Results are depicted in Figure 9-13.

[0097] The results in figures 9-13 show that P8 and P9 peptides with N-terminal acetylation and C-terminal amidation significantly stimulated oxalate transport by C2 cells to a level similar to native P8 and P9 peptides. In addition, P8 and P9 peptides with all Glycines replaced with PEG6 also similarly stimulated oxalate transport by C2 cells compared with native P8 and P9 peptides. Moreover, replacing G15 in P8 and G16 in P9 with D-alanine also similarly stimulated oxalate transport by C2 cells compared with native P8 and P9 peptides. Collectively, these results indicate that all of the above described structural modifications did not impact the functional activities of P8 and P9 peptides. P8 and P9 peptides having all natural L-amino acids replaced by D-amino acids were nonfunctional. Table 11. Modified 318 SLR domain peptides P8-AcAc-DAQYMLGAMSVEGIGLPKDSQVALTWLSKAAAQGDSEQ ID NO: 39P8-DaaDAQYMLGAMSVEGI(d-alanine)LPKDSQVALTWLSKAAAQGDSEQ ID NO: 40P8-AmDAQYMLGAMSVEGIGLPKDSQVALTWLSKAAAQGD-AmSEQ ID NO: 41P8-PegSEQ ID NO: 42P9-AcAc-AKAQYGLGILYAKGQGVAPDQEKALILYRMAATQGSEQ ID NO: 43P9-DaaAKAQYGLGILYAKGQ(d-alanine)VAPDQEKALILYRMAATQGSEQ ID NO: 44P9-AmAKAQYGLGILYAKGQGVAPDQEKALILYRMAATQG-AmSEQ ID NO: 45P9-PegSEQ ID NO: 46 Oxalate transport enhanced by addition of select trace elements

[0098] The inventors sought to identify trace elements to better stimulate oxalate transport by facilitating the binding of P8 and / or P9 to a cell surface receptor. The inventors analyzed combinations of P8 and P9 alone or with aluminum, zinc, or magnesium by measuring C14 oxalate transport in C2 cells. Peptides P8 and P9 were premixed with magnesium citrate prior to administration to human Caco2-BBE cells. The addition of magnesium citrate induced a 1.9-fold increase in oxalate transport (Fig. 14 and 15) compared to peptide alone. Zinc citrate was observed to have similar stimulatory effects but not from zinc chloride or zinc sulfate. The addition of aluminum to P8 or P9 did not result in increased oxalate transport and oxalate transport induction was similar to untreated (Fig. 16).REFERENCES

[0099] 1. Alexander RT, Hemmelgarn BR, Wiebe N, Bello A, Morgan C, Samuel S, Klarenbach SW, Curhan GC, Tonelli M, and for the Alberta Kidney Disease N. Kidney stones and kidney function loss: a cohort study. Bmj 345: e5287, 2012. 2. Allison MJ, Dawson KA, Mayberry WR, and Foss JG. Oxalobacter formigenes gen. nov., sp. nov.: oxalate-degrading anaerobes that inhabit the gastrointestinal tract. Archives of microbiology 141: 1-7, 1985. 3. Amin R, Sharma S, Ratakonda S, and Hassan HA. Extracellular Nucleotides Inhibit Oxalate Transport by Human Intestinal Caco2-BBE Cells Through PKC-delta Activation. American journal of physiology Cell physiology, 2013. 4. Arvans, D., Jung, Y., Antonopoulos, D., Koval, J., Granja, I., Bashir, M., Karrar, E., Roy-Chowdhury, J., Musch, M., Asplin, J., Chang, E., and Hassan, H.A. Oxalobacer formigenes-derived Bioactive Factors Stimulate Oxalate Transport by Intestinal Epithelial Cells. 2017. Journal of the American Society of Nephrology (JASN). 28: 876-887. 5. Borthakur A, Gill RK, Tyagi S, Koutsouris A, Alrefai WA, Hecht GA, Ramaswamy K, and Dudeja PK. The probiotic Lactobacillus acidophilus stimulates chloride / hydroxyl exchange activity in human intestinal epithelial cells. The Journal of nutrition 138: 1355-1359, 2008. 6. Caudarella R, Rizzoli E, Pironi L, Malavolta N, Martelli G, Poggioli G, Gozzetti G, and Miglioli M. Renal stone formation in patients with inflammatory bowel disease. Scanning microscopy 7: 371-379; discussion 379-380, 1993. 7. Coe FL, Evan A, and Worcester E. Kidney stone disease. The Journal of clinical investigation 115: 2598-2608, 2005. 8. Daniel SL, Hartman PA, and Allison MJ. Microbial degradation of oxalate in the gastrointestinal tracts of rats. Appl Environ Microbiol 53: 1793-1797, 1987. 9. Danpure CJ and Jennings PR. Peroxisomal alanine:glyoxylate aminotransferase deficiency in primary hyperoxaluria type I. FEBS letters 201: 20-24, 1986. 10. Dawson PA, Russell CS, Lee S, McLeay SC, van Dongen JM, Cowley DM, Clarke LA, and Markovich D. Urolithiasis and hepatotoxicity are linked to the anion transporter Sat1 in mice. The Journal of clinical investigation 120: 706-712, 2010. 11. Eisner BH, Porten SP, Bechis SK, and Stoller ML. Diabetic kidney stone formers excrete more oxalate and have lower urine pH than nondiabetic stone formers. The Journal of urology 183: 2244-2248, 2010. 12. Freel RW, Morozumi M, and Hatch M. Parsing apical oxalate exchange in Caco-2BBe1 monolayers: siRNAknockdown of SLC26A6 reveals the role and properties of PAT-1. American journal of physiology 297: G918-929, 2009. 13. Freel RW, Hatch M, Green M, and Soleimani M. Ileal oxalate absorption and urinary oxalate excretion are enhanced in Slc26a6 null mice. American journal of physiology Gastrointestinal and liver physiology 290: G719-728, 2006. 14. Hassan HA, Cheng M, and Aronson PS. Cholinergic signaling inhibits oxalate transport by human intestinal T84 cells. American journal of physiology Cell physiology 302: C46-58, 2012. 15.Hatch M, Cornelius J, Allison M, Sidhu H, Peck A, and Freel RW. Oxalobacter sp. reduces urinary oxalate excretion by promoting enteric oxalate secretion. Kidney international 69: 691-698, 2006. 16. Hatch M and Freel RW. A human strain of Oxalobacter (HC-1) promotes enteric oxalate secretion in the small intestine of mice and reduces urinary oxalate excretion. Urolithiasis, 2013. 17. Hatch M and Freel RW. Intestinal transport of an obdurate anion: oxalate. Urological research 33: 1-16, 2005. 18. Hatch M, Gjymishka A, Salido EC, Allison MJ, and Freel RW. Enteric oxalate elimination is induced and oxalate is normalized in a mouse model of primary hyperoxaluria following intestinal colonization with Oxalobacter. American journal of physiology Gastrointestinal and liver physiology 300: G461-469, 2011. 19. Hoppe B, Beck B, Gatter N, von Unruh G, Tischer A, Hesse A, Laube N, Kaul P, and Sidhu H. Oxalobacter formigenes: a potential tool for the treatment of primary hyperoxaluria type 1. Kidney international 70: 1305-1311, 2006. 20. Hoppe B, von Unruh G, Laube N, Hesse A, and Sidhu H. Oxalate degrading bacteria: new treatment option for patients with primary and secondary hyperoxaluria? Urological research 33: 372-375, 2005. 21. Jiang Z, Asplin JR, Evan AP, Rajendran VM, Velazquez H, Nottoli TP, Binder HJ, and Aronson PS. Calcium oxalate urolithiasis in mice lacking anion transporter Slc26a6. Nature genetics 38: 474-478, 2006. 22. Jiang Z, Grichtchenko, II, Boron WF, and Aronson PS. Specificity of anion exchange mediated by mouse Slc26a6. The Journal of biological chemistry 277: 33963-33967, 2002. 23. Langmead B, Trapnell C, Pop M, and Salzberg SL. Ultrafast and memory-efficient alignment of short DNA sequences to the human genome. Genome biology 10: R25, 2009. 24. Love MI, Huber W, and Anders S. Moderated estimation of fold change and dispersion for RNA-seq data with DESeq2. Genome biology 15: 550, 2014. 25. Mittl PR and Schneider-Brachert W. Sell-like repeat proteins in signal transduction. Cellular signalling 19: 20-31, 2007. 26. Nelson WK, Houghton SG, Milliner DS, Lieske JC, and Sarr MG. Enteric hyperoxaluria, nephrolithiasis, and oxalate nephropathy: potentially serious and unappreciated complications of Roux-en-Y gastric bypass. Surg Obes Relat Dis 1: 481-485, 2005. 27. Pardi DS, Tremaine WJ, Sandbom WJ, and McCarthy JT. Renal and urologic complications of inflammatory bowel disease. Am J Gastroenterol 93: 504-514, 1998. 28. Robertson WG and Peacock M. The cause of idiopathic calcium stone disease: hypercalciuria or hyperoxaluria? Nephron 26: 105-110, 1980. 29. Salido EC, Li XM, Lu Y, Wang X, Santana A, Roy-Chowdhury N, Torres A, Shapiro LJ, and Roy-Chowdhury J. Alanine-glyoxylate aminotransferase-deficient mice, a model for primary hyperoxaluria that responds to adenoviral gene transfer. Proceedings of the National Academy of Sciences of the United States of America 103: 18249-18254, 2006. 30. Sidhu H, Schmidt ME, Comelius JG, Thamilselvan S, Khan SR, Hesse A, and Peck AB. Direct correlation between hyperoxaluria / oxalate stone disease and the absence of the gastrointestinal tract-dwelling bacterium Oxalobacter formigenes: possible prevention by gut recolonization or enzyme replacement therapy. Journal of the American Society of Nephrology : JASN 10 Suppl 14: S334-340, 1999. 31. Tao Y, Drabik KA, Waypa TS, Musch MW, Alverdy JC, Schneewind O, Chang EB, and Petrof EO. Soluble factors from Lactobacillus GG activate MAPKs and induce cytoprotective heat shock proteins in intestinal epithelial cells. American journal of physiology 290: C1018-1030, 2006. 32. Amin R, Asplin J, Jung D, Bashir M, Alshaikh A, Ratakonda S, Sharma S, Jeon S, Granja I, Matern D, and Hassan H. Reduced active transcellular intestinal oxalate secretion contributes to the pathogenesis of obesity-associated hyperoxaluria. Kidney international 93: 1098-1107, 2018. 33. Kasidas GP and Rose GA. Continuous-flow assay for urinary oxalate using immobilised oxalate oxidase. Annals of clinical biochemistry 22 (Pt 4): 412-419, 1985. 34. In J, Foulke-Abel J, Zachos NC, Hansen AM, Kaper JB, Bernstein HD, Halushka M, Blutt S, Estes MK, Donowitz M, and Kovbasnjuk O. Enterohemorrhagic Escherichia coli reduce mucus and intermicrovillar bridges in human stem cell-derived colonoids. Cellular and molecular gastroenterology and hepatology 2: 48-62 e43, 2016. 35. Zachos NC, Kovbasnjuk O, Foulke-Abel J, In J, Blutt SE, de Jonge HR, Estes MK, and Donowitz M. Human Enteroids / Colonoids and Intestinal Organoids Functionally Recapitulate Normal Intestinal Physiology and Pathophysiology. The Journal of biological chemistry 291: 3759-3766, 2016. 36. Di L. Strategic approaches to optimizing peptide ADME properties. The AAPS journal 17: 134-143, 2015. 37. Knappe D, Henklein P, Hoffmann R, and Hilpert K. Easy strategy to protect antimicrobial peptides from fast degradation in serum. Antimicrobial agents and chemotherapy 54: 4003-4005, 2010. SEQUENCES

[0100] Sel1 301 Sel1 318

Claims

1. A composition for use in a method of stimulating oxalate transport, wherein the composition is administered to a subject and wherein the composition comprises a Sel1-derived peptide sequence with at least 60% sequence identity to one of SEQ ID NOs: 8-15, wherein the composition is not a product of nature and wherein the Sel1-derived peptide stimulates oxalate transport.

2. The composition for use of claim 1, wherein the Sel1-derived peptide sequence has less than 100% sequence identity to SEQ ID NOs: 8-15.

3. The composition for use of claim 1, wherein the Sel1-derived peptide sequence is fused to a second peptide or polypeptide sequence.

4. The composition for use of claim 3, wherein the second peptide or polypeptide sequence is a carrier moiety, therapeutic moiety, or detectable moiety.

5. The composition for use of claim 1, wherein the composition comprises 2 or more Sel1-derived peptide sequences with at least 60% sequence identity to one of SEQ ID NOs: 8-15.

6. The composition for use of claim 4 or claim 5, wherein the Sel1-derived peptide sequences are fused directly or indirectly to each other.

7. The composition for use of claim 4 or claim 5, wherein the Sel1-derived peptide sequences are not fused to each other.

8. The composition for use of one of claims 1-7, wherein: (i) one or more of the amino acid residues in the peptide sequence(s) are D-enantiomers, (ii) the peptide sequence(s) comprise one or more unnatural amino acids, (iii) the peptide sequence(s) comprise one or more amino acid analogs, and / or (iv) the peptide sequence(s) comprise one or more peptoid amino acids.

9. The composition for use of one of claims 1-8, wherein the peptide sequence(s) or an amino acid therein comprises a modification selected from the group consisting of phosphorylation, glycosylation, ubiquitination, S-nitrosylation, methylation, N-acetylation, C-terminal amidation, cyclization, substitution of natural L-amino acids with non-natural D-amino acids, lipidation, lipoylation, deimination, eliminylation, disulfide bridging, isoaspartate formation, racemization, glycation; carbamylation, carbonylation, isopeptide bond formation, sulfation, succinylation, S-sulfonylation, S-sulfinylation, S-sulfenylation, S-glutathionylation, pyroglutamate formation, propionylation, adenylylation, nucleotide addition, iodination, hydroxylation, malonylation, butyrylation, amidation, alkylation, acylation, biotinylation, carbamylation, oxidation, pegylation, and any other applicable peptide modification.

10. The composition for use of one of claims 1-9, wherein the peptide sequence(s) exhibit enhanced: (a) stability relative to one of SEQ ID NOs: 8-15; and / or (b) oxalate-transport stimulation relative to one of SEQ ID NOs: 8-15.

11. The composition for use of one of claims 1-10, wherein the composition is a pharmaceutical composition comprising a composition according to one of claims 1-10 and a pharmaceutically-acceptable carrier.

12. The composition for use of claim 11, further comprising one or more additional therapeutic agents.

13. The composition for use of one of claims 1-12, wherein administration comprises rectal administration, oral administration, and / or injection.

14. The composition for use of one of claims 1-13, wherein: (a) the subject suffers from or is at risk of hyperoxaluria and / or hyperoxalemia; or (b) the subject's risk of calcium oxalate kidney stones, nephrocalcinosis, oxalate nephropathy, end stage renal disease, chronic kidney disease, and / or systemic oxalosis is lowered by the method.