Immune cells with inactivated SUV39H1 and modified TCR

Abstract

The present disclosure relates to improved immune cells expressing an antigen-specific receptor, such as a CAR or TCR, in which SUV39H1 has been inactivated, optionally in combination with a disruption of the TRAC locus and / or a deletion of one or more ITAMs. The present disclosure also provides compositions comprising such cells, methods for producing such cells, and uses of such cells in adoptive cell therapy, e.g., in cancer or inflammatory diseases.

Description

[Technical field]

[0001] The present disclosure relates to the field of adoptive cell therapy. The present disclosure provides immune cells that express modified TCRs, have inactivated SUV39H1, and exhibit enhanced properties. [Background technology]

[0002] Introduction Adoptive T cell therapy (ATCT), which uses T cells armed with recombinant T cell receptor (TCR) and chimeric antigen receptor (CAR) technologies, is emerging as a powerful cancer treatment alternative (Lim WA & June CH. 2018. Cell 168(4):724-740). Efficient engraftment, long-term persistence, and reduced exhaustion of therapeutic T cells correlate with positive treatment outcomes. In addition, increased persistence of adoptively transferred cells appears to depend on acquisition of a central memory T cell (TCM) population (Powell DJ et al., Blood. 2005, 105(1):241-50; Huang J, Khong HT et al., J Immunother. 2005, 28:258-267).

[0003] A major obstacle to successful cell-based therapy of solid tumors is the exhaustion of activated T cells, which reduces their ability to proliferate and destroy target cells. PD-1 blockade can restore T cell function at an early stage, but this rescue may be incomplete or transient (Sen DR et al. 2016. Science 354(6316):1165-1169; Pauken KE et al. 2016. Science 354(6316):1160-1165). Furthermore, the immunosuppressive microenvironment in tumors mediates T cell exhaustion (Joyce JA, Fearon DT. 2015. Science 348(6230):74-80). [Prior art documents] [Patent documents]

[0004] [Patent Document 1] International Publication No. 2019 / 157454 Brochure [Patent Document 2] International Publication No. 2021 / 016174 Brochure [Patent Document 3] International Publication No. 2021 / 043804 Brochure [Patent Document 4] International Publication No. 2022 / 189620 Brochure [Patent Document 5] International Publication No. 2022 / 189626 Brochure [Patent Document 6] International Publication No. 2022189638 Brochure [Patent Document 7] International Publication No. 2017 / 062451 Brochure [Patent Document 8] International Publication No. 2017 / 180989 Brochure [Patent Document 9] International Publication No. 2014 / 055668 Brochure [Patent Document 10] International Publication No. 2018 / 132506 Brochure [Patent Document 11] International Publication No. 2019 / 133969 Brochure [Patent Document 12] International Publication No. 2018 / 067993 Brochure [Patent Document 13] International Publication No. 200014257 Brochure [Patent Document 14] International Publication No. 2013126726 Brochure [Patent Document 15] International Publication No. 2012 / 129514 Brochure [Patent Document 16] International Publication No. 2014031687 Brochure [Patent Document 17] International Publication No. 2013 / 166321 Brochure [Patent Document 18] International Publication No. 2013 / 071154 Brochure [Patent Document 19] International Publication No. 2013 / 123061 Brochure [Patent Document 20] U.S. Patent Application No. 2002131960 [Patent Document 21] U.S. Patent Application No. 2013287748 [Patent Document 22] US Patent Publication No. 20130149337 [Patent Document 23] U.S. Patent No. 6,451,995 [Patent Document 24] U.S. Patent No. 7,446,190 [Patent Document 25] U.S. Pat. No. 8,252,592 [Patent Document 26] U.S. Patent No. 8,339,645 [Patent Document 27] U.S. Pat. No. 8,398,282 [Patent Document 28] U.S. Pat. No. 7,446,179 [Patent Document 29] U.S. Patent No. 6,410,319 [Patent Document 30] U.S. Patent No. 7,070,995 [Patent Document 31] U.S. Patent No. 7,265,209 [Patent Document 32] U.S. Patent No. 7,354,762 [Patent Document 33] U.S. Pat. No. 7,446,191 [Patent Document 34] U.S. Pat. No. 8,324,353 [Patent Document 35] U.S. Pat. No. 8,479,118 [Patent Document 36] European Patent Application No. 2537416 [Patent Document 37] U.S. Patent Application No. 20020018783 [Patent Document 38] International Publication No. 2014055668 Brochure [Patent Document 39] U.S. Pat. No. 8,153,765 [Patent Document 40] U.S. Pat. No. 8,603,477 [Patent Document 41] U.S. Patent No. 8,008,450 [Patent Document 42] US Patent Publication No. 20120189622 [Patent Document 43] International Publication No. 2006099875 Brochure [Patent Document 44] International Publication No. 2009080829 Brochure [Patent Document 45] International Publication No. 2012092612 Brochure [Patent Document 46] US Patent Application Publication No. 2013 / 0316380 [Patent Document 47] International Publication No. 2010 / 000565 Brochure [Patent Document 48] International Publication No. 2021239965 Brochure [Patent Document 49] US Patent Application Publication No. 2018 / 0118849 [Patent Document 50] International Publication No. 2018 / 234367 Brochure [Patent Document 51] International Publication No. 2022 / 189639 Brochure [Patent Document 52] International Publication No. 2011009173 Brochure [Patent Document 53] International Publication No. 2012135854 Brochure [Patent Document 54] US Patent Publication No. 20140065708 [Patent Document 55] International application number PCT / US91 / 08442 [Patent Document 56] International application number PCT / US94 / 05601 [Patent Document 57] U.S. Patent No. 6,040,177 [Patent Document 58] U.S. Patent No. 5,219,740 [Patent Document 59] U.S. Patent No. 6,207,453 [Patent Document 60] U.S. Pat. No. 5,399,346 [Patent Document 61] International Publication No. 2021 / 183884 Brochure [Patent Document 62] International Publication No. 2002 / 012514 Brochure [Patent Document 63] International Publication No. 2014066435 Brochure [Patent Document 64] U.S. Pat. No. 8,697,359 [Patent Document 65] US Patent Application Publication No. 2014 / 0087426 [Patent Document 66] US Patent Application Publication No. 2012 / 0178169 [Patent Document 67] U.S. Pat. No. 5,356,802 [Patent Document 68] U.S. Patent No. 5,436,150 [Patent Document 69] U.S. Pat. No. 5,487,994 [Patent Document 70] US Patent Publication No. 20110301073 [Patent Document 71] US Patent Publication No. 2014 / 0120222 [Patent Document 72] US Patent Publication No. 2013 / 0315884 [Patent Document 73] U.S. Pat. No. 5,049,386 [Patent Document 74] U.S. Pat. No. 4,946,787 [Patent Document 75] U.S. Pat. No. 4,897,355 [Patent Document 76] International Publication No. 91 / 17424 Brochure [Patent Document 77] International Publication No. 91 / 16024 Brochure [Patent Document 78] US Patent Application Publication No. 2003 / 0170238 [Patent Document 79] U.S. Pat. No. 4,690,915 [Non-patent literature]

[0005] [Non-Patent Document 1] Lim WA & June CH, 2018. Cell volume 168 (issue 4): pages 724-740 [Non-Patent Document 2] Powell DJ et al., Blood. 2005, Vol. 105 (Issue 1): pp. 241-50. [Non-Patent Document 3] Huang J, Khong HT et al. J Immunother. 2005, 28:258-267 [Non-Patent Document 4] Sen DR et al., 2016. Science 354(6316):1165-1169 [Non-Patent Document 5] Pauken KE et al., 2016. Science 354(6316):1160-1165 [Non-Patent Document 6] Joyce JA, Fearon DT. 2015. Science Volume 348 (No. 6230) pp. 74-80 [Non-Patent Document 7] SMITH and WATERMAN (Ad. App. Math., vol. 2, p. 482, 1981)

Non-Patent Document 8

Non-Patent Document 9

Non-Patent Document 10

Non-Patent Document 11

Non-Patent Document 12

Non-Patent Document 13

Non-Patent Document 14

Non-Patent Document 15

Non-Patent Document 16

Non-Patent Document 17

Non-Patent Document 18

Non-licensed Document 30

Non-licensed Document 31

Non-licensed Document 32

Non-licensed Document 33

Non-licensed Document 34

Non-licensed Document 35

Non-licensed Document 36

Non-licensed Document 37

Non-licensed Document 38

Non-licensed Document 39

Non-licensed Document 40

Non - Patent Document 41

Non - Patent Document 42

Non - Patent Document 43

Non - Patent Document 44

Non - Patent Document 45

Non - Patent Document 46

Non - Patent Document 47

Non - Patent Document 57

Non - Patent Document 58

Non - Patent Document 59

Non - Patent Document 60

Non - Patent Document 61

Non - Patent Document 62

Non - Patent Document 63

Non - Patent Document 64

Non - Patent Document 65

Non - Patent Document 66

Non - Patent Document 67

Non - Patent Document 68

Non - Patent Document 69

Non - Patent Document 70

Non - Patent Document 71

Non - Patent Document 72

Non - Patent Document 73

Non - Patent Document 74

Non - Patent Document 75

Non - Patent Document 76

Non - Patent Document 77

Non - Patent Document 78

Non - Patent Document 79

Non - Patent Document 80

Non-Patent Document 81

Non-Patent Document 82

Non-Patent Document 83

Non-Patent Document 84

Non-Patent Document 85

Non-Patent Document 86

Non-Patent Document 87

Non-Patent Document 88

Non-Patent Document 89

Non-Patent Document 90

Non-Patent Document 91

Non-Patent Document 92

Non-Patent Document 93

Non-Patent Document 94

Non-Patent Document 95

Non-Patent Document 96

Non-Patent Document 97

Non-Patent Document 98

Non - Patent Document 130

Non - Patent Document 131

Non - Patent Document 132

Non - Patent Document 133

Non - Patent Document 134

Non - Patent Document 135

Non - Patent Document 136

Non - Patent Document 137

Non - Patent Document 138

Non - Patent Document 139

Non - Patent Document 140

[0006] There remains a need in the art for modified or engineered T cells with improved properties for adoptive cell therapy. [Means for solving the problem]

[0007] The present disclosure provides immune cells, particularly T cells or NK cells or their precursors, expressing one or more modified antigen-specific receptors and inactivated SUV39H1, as well as compositions, kits, and methods of manufacture and use related to such immune cells. The modified immune cells of the present disclosure express an antigen-specific receptor comprising a heterologous antigen-binding domain that specifically binds to a target antigen. The antigen-specific receptor may comprise an extracellular domain comprising an antigen-binding fragment or CDRs of an antibody, preferably all three CDRs of the heavy chain variable region (VH) and / or the light chain variable region (VL). The antigen-specific receptor may be a chimeric antigen receptor (CAR) or a heterologous TCR, such as a modified TCR.

[0008] The modified TCR may comprise (a) an antigen-binding fragment or extracellular domain of an antibody comprising the CDRs, preferably all three CDRs of the heavy chain variable region (VH) and / or the light chain variable region (VL), and (b) a native or variant constant region of an alpha, beta, gamma or delta chain. For example, the modified TCR may comprise one or more heterologous polypeptides, such as (a) an antibody VH, or a fragment or variant thereof having at least 90% sequence identity thereto, fused to TRAC (SEQ ID NO: 4) or a fragment or variant thereof having at least 90% sequence identity thereto, or fused to TRBC1 (SEQ ID NO: 5) or TRBC2 (SEQ ID NO: 6) or a fragment or variant thereof having at least 90% sequence identity thereto, and (b) an antibody VL, or a fragment or variant thereof having at least 90% sequence identity thereto, fused to TRAC (SEQ ID NO: 4) or a fragment or variant thereof having at least 90% sequence identity thereto, or fused to TRBC1 (SEQ ID NO: 5) or TRBC2 (SEQ ID NO: 6) or a fragment or variant thereof having at least 90% sequence identity thereto. See FIG. 1A. The modified TCR can associate with (and thereby activate) a CD3 zeta polypeptide, which may be a native or variant, e.g., a modified CD3 zeta polypeptide (SEQ ID NO: 7) in which one or two ITAM domains (e.g., ITAM2 and ITAM3) have been deleted. In some embodiments, the modified TCR may optionally further comprise a native or variant CD3 zeta polypeptide, e.g., a modified CD3 zeta polypeptide (SEQ ID NO: 7) in which one or two ITAM domains (e.g., ITAM2 and ITAM3) have been deleted. See Figure 1B.

[0009] Recombinant HLA-independent (or HLA-unrestricted) modified TCRs (referred to as "HI-TCRs") that bind to an antigen of interest in an HLA-independent manner are described in WO 2019 / 157454. Such HI-TCRs comprise an antigen-binding chain comprising: (a) a heterologous antigen-binding domain, e.g., an antigen-binding fragment of an immunoglobulin variable region, that binds to an antigen in an HLA-independent manner; and (b) a constant domain that can associate with (and thus activate) a CD3 zeta polypeptide. Preferably, the antigen-binding domain or a fragment thereof comprises: (i) a heavy chain variable region (VH) of an antibody and / or (ii) a light chain variable region (VL) of an antibody. The constant domain of the TCR is, for example, a natural or modified TRAC polypeptide (SEQ ID NO: 4 or a variant thereof) or a natural or modified TRBC polypeptide (SEQ ID NO: 5 or 6 or a variant thereof). The constant domain of the TCR is, for example, a natural TCR constant domain (alpha or beta) or a fragment thereof. Unlike chimeric antigen receptors, which typically contain their own intracellular signaling domains, HI-TCRs do not directly generate an activation signal; instead, the antigen binding chain associates with the CD3 zeta polypeptide (SEQ ID NO: 7) resulting in activation. Immune cells containing recombinant TCRs provide superior activity when the antigen has a low density on the cell surface, less than about 10,000 molecules per cell, e.g., less than about 5,000, 4,000, 3,000, 2,000, 1,000, 500, 250, or 100 molecules per cell.

[0010] The CD3 zeta polypeptide optionally comprises an intracellular domain of a costimulatory molecule or a fragment thereof. Alternatively, the antigen binding domain optionally comprises a costimulatory domain capable of stimulating an immunoresponsive cell upon binding of the antigen binding chain to an antigen. Exemplary costimulatory domains include stimulatory domains from CD28 (SEQ ID NO: 8-9), 4-1BB (CD137) (SEQ ID NO: 10-11), ICOS (SEQ ID NO: 12), CD27, OX40 (CD134) (SEQ ID NO: 13), DAP10, DAP12, 2B4, CD40, FCER1G, or GITR (AITR), or fragments or variants thereof. For T cells, CD28, CD27, 4-1BB (CD137), ICOS may be preferred. For NK cells, DAP10, DAP12, 2B4 may be preferred. Combinations of two costimulatory domains are contemplated, for example, CD28 and 4-1BB, or CD28 and OX40.

[0011] The aforementioned modified immune cells expressing an antigen-specific receptor, e.g., a modified TCR, preferably comprise one or more further properties as described herein: inactivation (e.g., mutation or inhibition) of the SUV39H1 gene and / or inactivation of one or two ITAM domains of the CD3 zeta intracellular signaling region of the antigen-specific receptor, and / or inactivation of one or both endogenous TCR chains (e.g., deletion or disruption of endogenous TCR alpha and / or TCR beta) and / or addition of a costimulatory receptor, or a combination of one, two, three or all of such properties.

[0012] In one aspect, the SUV39H1 gene (SEQ ID NO: 15) of the modified immune cells is inactivated. In some embodiments, the modified immune cells may contain one or more mutations (insertion, substitution, deletion) that result in a deletion of the SUV39H1 protein or a non-functional SUV39H1 protein. In other embodiments, the modified immune cells are contacted with an agent that inhibits SUV39H1 activity by at least about 50%, preferably 60%, 70%, 80%, 90% or more, and cultured under such conditions of SUV39H1 inhibition for a period of time sufficient to produce an enhanced characteristic. The agent that inhibits SUV39H1 may be expressed by the cells or delivered to the cells by known transfection methods. Immune cells in which SUV39H1 is inactivated or inhibited exhibit enhanced central memory phenotypes, enhanced survival and persistence after adoptive transfer, and reduced exhaustion. In particular, such cells accumulate and are reprogrammed with increased efficiency into long-lived central memory cells. Such cells are more efficient at inducing tumor cell rejection and demonstrate increased efficacy of cancer treatment.

[0013] In another aspect, an antigen-specific receptor (e.g., a modified TCR) comprises a modified CD3 with a single active ITAM domain, optionally wherein the CD3 further comprises one or more, or two or more, costimulatory domains. For example, an antigen-specific receptor comprises a modified CD3 zeta intracellular signaling domain in which ITAM2 and ITAM3 are inactivated. In some embodiments, ITAM1 and ITAM2 are inactivated, or ITAM2 and ITAM3 are inactivated. In some embodiments, a modified CD3 zeta polypeptide of a modified TCR retains only ITAM1, and the remaining CD3 zeta domain is deleted (residues 90-164 of SEQ ID NO:7). See FIG. 1B. As another example, ITAM1 is replaced with the amino acid sequence of either ITAM2 or ITAM3, and the remaining CD3 zeta domain is deleted (residues 90-164 of SEQ ID NO:7).

[0014] In yet further aspects, at least one T cell receptor (TCR) constant region gene of the modified immune cell is modified by insertion of a nucleic acid sequence encoding an antigen-specific receptor or antigen-binding domain. The TCR constant region is a TCR alpha constant region (TRAC) and / or a TCR beta constant region (TRBC). According to this aspect, the insertion of the nucleic acid sequence can disrupt or eliminate the endogenous expression of the TCR, including the native TCR alpha chain and / or the native TCR beta chain. For example, the nucleic acid encoding the antigen-specific receptor can be heterologous to the immune cell and operably linked to an endogenous promoter of the T cell receptor such that its expression is under the control of the endogenous promoter. In some embodiments, the nucleic acid encoding the CAR is operably linked to an endogenous TRAC promoter. The insertion of the nucleic acid sequence can reduce endogenous TCR expression by at least about 75%, 80%, 85%, 90%, or 95%.

[0015] In a related aspect, the antigen-specific receptor is a modified TCR comprising a heterologous antigen-binding domain and a native TCR constant domain (alpha or beta) or a fragment thereof, and the antigen-specific receptor (modified TCR) is capable of activating a CD3 zeta polypeptide. In some embodiments, a nucleic acid encoding a heterologous antigen-binding domain may be inserted into the endogenous TRAC locus and / or TRBC locus of an immune cell. For example, a nucleic acid encoding an antigen-specific receptor may be heterologous to the immune cell and operably linked to an endogenous promoter of a T cell receptor such that its expression is under the control of the endogenous promoter. Insertion of the nucleic acid sequence may thereby disrupt or eliminate endogenous expression of a TCR comprising a native TCR alpha chain and / or a native TCR beta chain. Insertion of the nucleic acid sequence may reduce endogenous TCR expression by at least about 75%, 80%, 85%, 90% or 95%. According to this embodiment, a nucleic acid encoding an antigen binding domain may be inserted into the TRBC locus to produce a fusion polypeptide comprising the antigen binding domain or a fragment thereof and fused to a TCR beta constant region or a fragment thereof. Additionally or alternatively, an antigen binding domain (which may be the same as or different from the antigen binding domain fused to the TRBC locus) may be inserted into the TRAC locus to produce a fusion polypeptide comprising the same and fused to a TCR alpha constant region or a fragment thereof. In particular, a nucleic acid encoding an antibody heavy chain variable region (VH) or a fragment thereof may be inserted into the TRBC locus to produce a fusion polypeptide comprising the VH or a fragment thereof and fused to a TCR beta constant region or a fragment thereof. Additionally, a nucleic acid encoding an antibody light chain variable region (VL) or a fragment thereof may be inserted into the TRAC locus to produce a fusion polypeptide comprising the VL or a fragment thereof and fused to a TCR alpha constant region or a fragment thereof. Alternatively, the VH or a fragment thereof may be fused to a TCR alpha constant region or a fragment thereof, and the VL or a fragment thereof may be fused to a TCR beta constant region or a fragment thereof. In some embodiments, a single nucleic acid encoding a modified TCR beta chain and a modified TCR alpha chain is operably linked to an endogenous TRAC promoter. See Figure 2A.In some embodiments, the modified TCR beta chain and the TCR alpha chain are separated by a self-cleavable linker, such as peptide 2A.

[0016] In another aspect, the immune cells comprising the modified TCR also comprise a costimulatory receptor. In other aspects, the immune cells comprising the modified TCR do not comprise a costimulatory receptor, e.g., do not comprise a CD80 / 4-1BB chimeric receptor as described in WO2021 / 016174. Such costimulatory receptors include chimeric receptors comprising a costimulatory ligand fused to at least one or at least two costimulatory molecules. Costimulatory ligands include CD80, CD86, 41BBL, CD275, CD40L, OX40L, or any combination thereof. In some embodiments, the costimulatory ligand is CD80 or 4-1BBL. Examples of costimulatory molecules are CD28, 4-1BB, OX40, ICOS, DAP-10, CD27, CD40, NKG2D, CD2, or any combination thereof. In some embodiments, the costimulatory receptor comprises (a) the extracellular and transmembrane domains of CD86, 41BBL, CD275, CD40L, OX40L, PD-1, TIGIT, 2B4, or NRP1, or a fragment or variant thereof, and (b) an intracellular costimulatory molecule of CD28, 4-1BB, OX40, ICOS, CD27, CD40, or CD2, or a fragment or variant thereof. In some embodiments, the chimeric receptor comprises a first costimulatory molecule that is 4-1BB and a second costimulatory molecule that is CD28. A preferred chimeric receptor comprises a CD80 costimulatory ligand (SEQ ID NO: 14) and a 4-1BB costimulatory molecule (SEQ ID NO: 10). Costimulatory receptors are described in WO2021 / 016174.

[0017] The engineered immune cells disclosed herein may comprise a combination of two or more of the foregoing aspects.

[0018] For example, the engineered immune cell is an immune cell in which (a) the SUV39H1 gene has been inactivated or inhibited, and (b) the antigen-specific receptor is an engineered TCRαβ comprising a heterologous antigen-binding domain and at least one native TCR constant domain or fragment thereof, the TCRαβ being capable of activating a CD3 zeta polypeptide. As another example, the engineered immune cell further comprises (c) a CD3 zeta intracellular signaling domain comprising a single active ITAM domain, e.g., in which ITAM2 and ITAM3 have been inactivated, and / or (d) a costimulatory receptor, e.g., a CD80 extracellular domain (SEQ ID NO: 14), linked to a 4-1BB intracellular costimulatory domain (SEQ ID NO: 10).

[0019] As another example, the modified immune cell is an immune cell in which (a) the SUV39H1 gene has been inactivated, and (b) expresses a chimeric antigen receptor (CAR) comprising (i) an extracellular antigen binding domain, (ii) a transmembrane domain, (iii) optionally one or more costimulatory domains, and (iv) an intracellular signaling domain comprising a modified CD3 zeta intracellular signaling domain comprising a single active ITAM domain, e.g., where ITAM2 and ITAM3 have been inactivated.

[0020] In any of the aspects or embodiments herein, the antigen-binding domain comprises 10 -7 M or less, or 10 -8 M or less, or 10 -9 It can bind to the target antigen with a binding affinity Kd of less than M (the smaller the number, the higher the affinity).

[0021] In any of the aspects described herein, the engineered immune cell may be a T cell, a CD4+ T cell, a CD8+ T cell, a CD4+ and CD8+ T cell, a NK cell, a Treg cell, a Tm cell, a memory stem cell (TSCM), a TCM cell, a TEM cell, a T cell progenitor cell, a NK cell progenitor cell, a pluripotent stem cell, an induced pluripotent stem cell (iPSC), a hematopoietic stem cell (HSC), an adipose-derived stem cell (ADSC), or a pluripotent stem cell of myeloid or lymphoid lineage.

[0022] In any of the aspects described herein, the antigen-specific receptor is a CAR that includes: (a) an extracellular antigen-binding domain; (b) a transmembrane domain, (c) optionally one or more costimulatory domains, and (d) an intracellular signaling domain. The extracellular antigen-binding domain may be an scFv, optionally an scFv that specifically binds to a target antigen as disclosed herein.

[0023] In any of the aspects described herein, the antigen binding domain may bind to any of the following antigens: ADGRE2, alpha fetoprotein (AFP), BCMA, carcinoembryonic antigen (CEA), CAIX, CCR1, cyclin such as cyclin A1 (CCNA1) or cyclin (D1), CEA, CE7, CD7, CD8, CD10, CD19, CD20, CD22, CD23, CD24, CD30, CD70, CLL1, CD33, CD34, CD38, CD41, CD44, CD44V6, CD49f, CD56, CD74, CD99, CD123, CD133, CD138, CS-1, claudin 18.2, c-Met, cytochrome P450 1 B1 (CYP1 B), EGF1R, EGFR, EGFR-VIII, EGP-2, EGP-4, EGP-40, EpCAM, EPHa2, ephrin B2, ERBB, Erb-B2, Erb-B3, Erb-B4, estrogen receptor, FBP, FcRH5, fetal acetylcholine receptor, folate receptor-a, GD2, GD3, GP100, gplOO, HMW-MAA, HER2 / neu, hepatitis B surface antigen, human telomerase reverse transcriptase (hTERT), IL-22R-alpha, IL-13R-alpha2, kappa-light chain, KDR, Lewis Binds to one or more of: Y, L1-cell adhesion molecule, LILRB2, LILRB4, LI-CAM, livin, MAGE-A1, MAGE-A3, MART-1, mesothelin, mouse double minute 2 homolog (MDM2), mucin 16 (MUC16), MUC1, NKCS1, NKG2D ligand, NY-ESO-1, oncofetal antigen (h5T4), orphan tyrosine kinase receptor (ROR1), p53, pHER95, p95HER2, PRAME, progesterone receptor, prostate specific membrane antigen (PSMA), prostate specific antigen, proteinase 3 (PR1), PSCA, survivin, tag-72, tEGFR, tyrosinase, VEGF-R2, Wilms tumor gene 1 (WT-1).In some embodiments, the antigen may be any of the tumor neo-antigenic peptides disclosed in any one of WO2021 / 043804, WO2022 / 189620, WO2022 / 189626, and WO2022189638, which are incorporated by reference in their entireties. The antigen may alternatively be an antigen associated with an infectious disease, an autoimmune disease, or an inflammatory disease.

[0024] In any of these embodiments, the antigen-specific receptor may be a bispecific antigen-specific receptor that binds both (a) a first antigen (e.g., a cancer antigen) and (b) a T cell activation antigen, e.g., CD3.

[0025] In any of these embodiments, the immune cells further secrete a non-membrane bound (soluble) bispecific antibody that binds both a target and a T cell activation antigen, such as CD3 epsilon or the constant chain (alpha or beta) of the TCR, e.g., a BiTE (Bispecific T cell engager soluble antibody).

[0026] In any of these embodiments, the immune cell may further comprise a second antigen-specific receptor, optionally a modified TCR or CAR, that specifically binds to a second antigen. For example, the immune cell may comprise two TCRs: a first TCR that binds to the first antigen and a second TCR that binds to the second antigen, or a TCR that binds to the first antigen and a CAR that binds to the second antigen.

[0027] In any of these embodiments, inactivation of SUV39H1 reduces SUV39H1 gene expression of SUV39H1 protein activity by at least about 50%, 60%, 70%, 75%, 80%, 85%, 90%, or 95%.

[0028] In any of these embodiments, the immune cells may be autologous or allogeneic. In any of these embodiments, the immune cells are modified to reduce immunogenicity, e.g., the HLA-A locus is inactivated and / or the beta-2-microglobulin is inactivated. In some embodiments, HLA class I expression is reduced by at least about 75%, 80%, 85%, 90%, or 95%.

[0029] In another aspect, the disclosure also provides methods of forming the modified immune cells (e.g., T cells, NK cells, or progenitor cells thereof) of the disclosure, and vectors for forming the modified immune cells. Such methods include introducing into an immune cell (including progenitor cell) a nucleic acid (e.g., a vector) encoding one or more components of a modified TCR described herein, such as (a) a modified TCR beta chain comprising a VH or a fragment or variant thereof, (b) a modified TCR alpha chain comprising a VL or a fragment or variant thereof, and optionally (c) a modified CD4 zeta chain having at least two ITAMs deleted, or any alternative embodiment described herein, by homologous recombination. Such methods also include introducing into an immune cell (including progenitor cell) a nucleic acid encoding a costimulatory receptor described herein. Such methods may further include inactivating the SUV39H1 gene by any of the methods disclosed herein, for example, by introducing a mutation in or knocking out most or all of the gene, or by contacting the cell with a SUV39H1 inhibitor that reduces SUV39H1 gene expression or SUV39H1 protein activity.

[0030] The disclosure also provides, in another aspect, a sterile pharmaceutical composition comprising any of the aforementioned modified immune cells. The disclosure also provides a kit comprising any of the aforementioned modified immune cells and a delivery device or container.

[0031] The present disclosure further provides a method for using the modified immune cells or pharmaceutical compositions or kits described above to treat a patient suffering from or at risk of an antigen-associated disease, optionally cancer, by administering a therapeutically effective amount of the immune cells or pharmaceutical compositions to the patient. In some embodiments, the immune cells are T cells or NK cells, and a dose of less than about 5×107 cells, optionally about 105 to about 107 cells, is administered to the patient. The method may further include administering a second therapeutic agent to the patient, optionally one or more cancer chemotherapeutic agents, cytotoxic agents, hormones, antiangiogenic agents, radiolabeled compounds, immunotherapy, surgery, cryotherapy, and / or radiation therapy. The second therapeutic agent may be an immune checkpoint modulator. Examples of immune checkpoint modulators include antibodies that specifically bind to PD1, PDL1, CTLA4, LAG3, BTLA, OX2R, TIM-3, TIGIT, LAIR-1, PGE2 receptor, EP2 / 4 adenosine receptor, or A2AR, or inhibitors thereof. [Brief description of the drawings]

[0032] [Figure 1] 1A and 1B are schematic diagrams showing modified TCRs of the present disclosure. [Diagram 2] Figure 2A is a schematic diagram of the cassettes introduced into immune cells to produce the engineered immune cells described herein, and Figure 2B is a schematic diagram of the expressed TCR and costimulatory receptors. [Diagram 3]FIG. 3 illustrates that transduced T cells show LNGFR (for gRV-66HIT) / CD80 (for gRV-66HIT booster) expression and bind human MSLN-Fc fusion protein. (A) Representative LNGFR / CD80-PE, huMSLN Fc fusion protein-FITC flow plots of scr / scr, SUV KO / Scr, SUV KO / TRAC KO T lymphocytes (donor 1) 5 days after transduction with gRV-66HIT and gRV-66HIT booster (CD80) Galv9 viral supernatant. Untransduced T cells (UT) were used as control. Plots shown in the figure were pre-gated by FSC-A / SSC-A>Singlets>Live cells>CD4+CD8+. (B) Bar graphs show the mean ± SD of % of LNGFR / CD80+ MSLN+ cells from two different donors. [Figure 4] FIG. 4 illustrates that transduced T cells show CD3 reconstitution including surface binding to recombinant mesothelin. (A) Representative CD3-Pacific Blue, huMSLN Fc fusion protein-FITC flow plots of scr / scr, SUV KO / Scr, SUV KO / TRAC KO T lymphocytes (donor 1) 5 days after transduction with Galv9 gRV-66HIT and gRV-66HIT booster (CD80) viral supernatants. Untransduced T cells (UT) were used as control. Plots shown in the figure were pre-gated as FSC-A / SSC-A>Singlets>Live cells>CD4+CD8+. (B) Bar graphs show the mean ± SD of % of CD3med+MSLN+ cells from two different donors. [Diagram 5]Figure 5 illustrates efficient knockdown of SUV39H1 by electroporation using SUV39H1 guide RNA. (A) Representative western blots for SUV39H1 and GAPDH in scrambled vs. SUV39H1 knockdown samples of non-transduced, gRV-66HIT and gRV-66HIT booster T cells from donor 1. (B) Bar graph showing the mean ± SD of SUV39H1 expression from two different donors. GAPDH was used as a loading control. [Figure 6] FIG. 6 illustrates that SUV39H1-deficient gRV-66HIT cells exhibit increased cytotoxicity (at low E:T ratios) on OVCAR-3 tumor cells, comparable to activity observed with gRV-66HIT booster (CD80) cells. Luciferase-expressing OVCAR-3 cells were co-cultured with gRV-66HIT or gRV-66HIT booster (scr / TRAC KO or SUV KO / TRAC KO) T cells at the indicated E:T ratios for 48 hours, and cytolysis was measured using a luminescence-based Bright-Glo™ luciferase assay. Untransduced (UT) T cells (scr / TRAC KO or SUV KO / TRAC KO) were used as controls. Line graphs showing the mean ± SD of % cytotoxicity from two different donors in duplicate. P values ​​were calculated by two-way ANOVA test. ***p<0.0002, ****p<0.0001. [Figure 7]FIG. 7 illustrates that SUV39H1-depleted gRV-66HIT cells show increased T cell expansion, persistence, memory and targeted killing capacity upon repeated antigen exposure with the NOMO-1 target system. Scrambled and SUV KO gRV-66HIT cells were co-cultured with the NOMO-1 target system at 1:2 E:T (1e5 HIT T cells and 2e5 target cells, day 0) in 24-well G-REX plates and flow cytometry was performed every 4 days subsequently to estimate HIT T cell and target cell numbers. Target cells were reintroduced after analysis to maintain the 1:2 E:T. Bar graphs showing (A) total gRV-66HIT cells and (B) total target cells at days 3, 7 and 10. Donor cells: 110046475. (C) % of CD45RO+ CD27+ and (D) % of CD45RO+ CCR7+ transduced HIT T cells. (E) Line plot showing the CD8 / CD4 ratio of transduced HiT cells. [Figure 8] FIG. 8 illustrates that SUV39H1 inactivated gRV-66HIT booster (CD80 booster) cells show increased T cell expansion, persistence, memory and targeted killing capacity upon repeated antigen exposure with the NOMO-1 target system. Scrambled and SUV KO gRV-66HIT booster cells were co-cultured with the NOMO-1 target system at 1:2 E:T (1e5 HIT T cells and 2e5 target cells, day 0) in 24-well G-REX plates and flow cytometry was performed every 4 days subsequently to estimate HIT T cell and target cell numbers. Target cells were reintroduced after analysis to maintain the 1:2 E:T. Bar graphs showing (A) total gRV-66HIT booster cells and (B) total target cells at days 3, 7 and 10. Donor 3. (C) Line plots showing the % of CD45RO+ CD27+ and (D) % of CD45RO+ CCR7+ transduced HIT T cells. (E) CD8 / CD4 ratio of transduced HiT booster (CD80) cells. [Figure 9]FIG. 9 illustrates that SUV39H1 inactivated gRV-66HIT booster (CD80) cells show increased T cell expansion, persistence, memory and targeted killing capacity upon repeated antigen exposure with the NOMO-1 target system. Scrambled and SUV KO gRV-66HIT booster cells were co-cultured with the NOMO-1 target system at 1:2 E:T (1e5 HIT T cells and 2e5 target cells, day 0) in 24-well G-REX plates and flow cytometry was performed every 4 days subsequently to estimate HIT T cell and target cell numbers. Target cells were reintroduced after analysis to maintain 1:2 E:T. Bar graphs showing (A) total gRV-66HIT booster cells at days 8, 19, 22, 26 and (B) total target cells at days 8, 19, 22, 26 and 36. Donor 3. (C) Line plots showing the % of CD45RO+ CD27+ and (D) % of CD45RO+ CCR7+ transduced HIT T cells. (E) CD8 / CD4 ratio of transduced HiT booster cells. [Figure 10] FIG. 10 illustrates that SUV39H1-depleted gRV-66HIT and gRV-66HIT booster (CD80) cells demonstrate increased T cell expansion, persistence, and memory upon repeated antigen exposure using the NOMO-1 targeting system. Scrambled and SUV KO gRV-66HIT and SUV KO gRV-66HIT booster cells were co-cultured with NOMO-1 target line at 1:2 E:T (1e5 HIT T cells and 2e5 target cells) in 24-well G-REX plates on day 0 and flow cytometry was performed every 4th day to estimate HIT T cell and target cell numbers. Target cells were re-introduced after analysis to maintain 1:2 E:T. Bar graphs showing (A) total gRV-66HIT cells and (B) total gRV-66HIT booster T cells on days 7, 28, 34 and 42. Line plots showing % of CD45RO+ CCR7+ transduced (C) gRV-66 HIT and (D) gRV-66HIT booster T cells on days 0, 7, 28, 34 and 42. Donor cells: 888689798. [Figure 11]Figure 11 is a schematic diagram of gammaretroviral (gRV) HIT constructs exemplified herein. Construct A contains the transduction marker LNGFR. Construct B contains the booster molecule. [Figure 12] FIG. 12 shows a Western blot of SUV39H1 to determine SUV-KO in a representative sample of FMC63-HiT+booster and mJ591-HiT+booster (CD80_4-1BB) engineered T cells. (A) Protein quantification of samples against a standard curve. All samples shown in the figure were within range and loaded equally. (B) Ponceau staining of the membrane after the Western blot step. (C) Western blot confirms knockout of the SUV39H1 band at 48 kDa (lower band, highlighted with black box). The upper non-specific band was confirmed to be unchanged in the KO of SUV39H1, comparing WT to the KO sample. There are two ladder lanes on the left and one ladder lane on the right. Data represents N=2 donors, error bars are SEM. [Figure 13] Figure 13 shows representative dot plots of successful transduction of T cells with gRV HiT constructs and successful TRAC-KO based on reduction in CD3 expression. (A) Dot plots show gRV-FMC63-HiT (left) and gRV-FMC63-HiT+ booster cells when transduced with their respective viruses based on either LNGFR or booster expression. (B) Successful TRAC-KO can be observed by reduction in CD3 compared to expression markers (reduction in CD3+ population as in Figure 4). Data represent N=2 donors and error bars are SEM. [Figure 14]Figure 14: Representative dot plots showing specific binding of recombinant CD19 protein to FMC63-HiT T cells. (A) TRACKO / scrambled (SCR) and (B) TRACKO / SUVKO samples were incubated with recombinant avi-tagged CD19 protein and stained with streptavidin-A647. Both gRV-FMC63-HiT (middle) and gRV-FMC63-HiT+booster (right) show similar binding to recombinant CD19 protein with their respective combination of expression markers (LNGFR and booster); negative control (left) was stained with streptavidin-A647 only, without recombinant protein. C) Percentage of CD19 interacting cells. Data represent N=2 donors, error bars are SEM. [Figure 15] Figure 15 shows representative dot plots of successful transduction of T cells with gRV HiT constructs and successful TRAC-KO based on reduction in CD3 expression. (A) Dot plots show gRV-mJ591-HiT (left) and gRV-mJ591-HiT+ booster cells when transduced with their respective viruses based on either LNGFR or booster expression. (B) Successful TRAC-KO can be observed by reduction in CD3 compared to expression markers (reduction in CD3+ population as in Figure 4). Data represent N=2 donors and error bars are SEM. [Figure 16] Figure 16 shows representative dot plots showing specific binding of recombinant PSMA protein to mJ591-HiT T cells. (A) TRACKO / scrambled (SCR) and (B) TRACKO / SUVKO samples were incubated with recombinant avi-tagged PSMA protein and stained with streptavidin-A647. Negative control (left) was stained with streptavidin-A647 only, without recombinant protein. C) Percentage of PSMA-interacting cells. Data represent N=2 donors, error bars are SEM. [Figure 17]Figure 17 is a graph showing increased killing of SUV-KO HiT samples compared to scrambled (SCR) controls in a kinetic kill assay. TRAC-KO-scrambled and TRAC-KO-SUV-KO or gRV-FMC63-HiT+ booster cells were co-cultured with GFP+LNCaP-19 target system at 1:20 E:T in 96-well plates and placed in InCucyte for 7 days for GFP detection. Non-transduced T cells were used as negative control. Representative graphs from two independent experiments and samples are shown. Error bars are SD. [Figure 18] Figure 18 is a graph showing increased killing of SUV-KO HiT samples compared to scrambled (SCR) controls in a kinetic killing assay. TRAC-KO-scrambled and TRAC-KO-SUV-KO (A) gRV-mJ591-HiT or (B) gRV-mJ591-HiT+ booster cells were co-cultured with GFP+ LNCaP-19 target system at an E:T ratio of 1:20 in 96-well plates and placed in InCucyte for 7 days for GFP detection. Non-transduced T cells were used as negative control. Representative graphs from two independent experiments and samples are shown / error bars are SD. [Figure 19] FIG. 19 is a graph illustrating that SUV-KO cells show increased killing compared to the scrambled (SCR) control after the second stimulation in a kinetic killing assay. TRAC-KO-scrambled and TRAC-KO-SUV-KO gRV-FMC63-HiT cells that had already received the first antigen stimulation were filtered using a 20uM filter and FACS analyzed to determine the % of HiT+ cells. These gRV-FMC63-HiT+ booster cells were co-cultured with GFP+ LNCap-19 target cells at two different E:T ratios: (A) 1:5 and (B) 1:10 in 96-well plates and placed in InCucyte for 7 days for GFP detection. "Target cells only" were used as a negative control for these experiments. Representative graphs from two independent experiments and samples are shown. Error bars are SD. [Figure 20] Figure 20A is a graph showing that TRAC-KO-SUV-KO gRV FMC63-HiT+ booster samples had increased expansion compared to the scrambled (SCR) control. TRAC-KO-scrambled and TRAC-KO-SUV-KO gRV-FMC63-HiT+ booster cells were co-cultured with GFP+ LNCap-19 target cells at the indicated E:T ratios in 96-well plates and placed in InCucyte for 7 days for GFP detection. After 7 days, the co-cultures were subjected to FACS analysis for cell counting. Data represent N=2 donors, error bars are SEM. Figure 20B shows that HiT+ booster SUV KO cells had increased expansion compared to the scrambled (SCR) control after the second stimulation. TRAC-KO-scrambled and TRAC-KO-SUV-KO gRV-FMC63-HTi+ booster cells were co-cultured with GFP+LNCap-19 target line at the indicated E:T ratios in 96-well plates and placed in InCucyte for 7 days for GFP detection. After 7 days, the co-cultures were subjected to FACS analysis for cell counting. Data represent N=2 donors and error bars are SEM. [Figure 21]Figure 21 is a graph showing that SUV-KO gRV HiT cells exhibited enhanced memory-related profile, reduced effector-like profile and reduced exhaustion marker phenotype compared to scrambled (SCR) controls after production. (A) Phenotype of gRV TRAC-KO and scrambled / SUV-KO FMC63-HiT+ booster and (B) gRV mJ591-HiT+ booster T cells 15 days after initial T cell activation. Cells were analyzed for surface marker expression with the following gating strategy: (A) and (B) lymphocyte+singlet+alive+CD4+ / -CD8+ / -Booster+CD45RO+. CCR7 and CD27 expression were analyzed as appropriate to confirm stemness and degradation. CM: central memory, Ttm: transitional memory, and EM: effector memory. (C) and (D) lymphocyte+singlet+alive+CD4+ / -CD8+ / -Booster+ for CD57 and TIM3, respectively. Data represent N=2 donors, error bars are SEM. [Figure 22]FIG. 22 is a graph showing that SUV-KO gRV HiT cells exhibited enhanced memory-related profile, reduced effector-like profile and reduced exhaustion marker phenotype compared to scrambled (SCR) controls after the first round of antigen stimulation. (A) gRV TRAC-KO and scrambled / SUV-KO FMC63-HiT+ boosters and (B) gRV mJ591-HiT+ boosters were co-cultured with GFP+ LNCaP-19 target system at various E:T. Analysis of surface marker expression on lymphocyte+singlet+alive+CD4+ / -CD8+ / -Booster+CD45RO+ 7 days after plating using the following gating strategy: (A) and (B). CCR7 and CD27 expression were analyzed to confirm stemness and degradation as appropriate. CM: central memory, Ttm: transitional memory, and EM: effector memory. (C) and (D) lymphocyte+singlet+alive+CD4+ / -CD8+ / -Booster+ for CD57 and TIM3, respectively. Data represent N=2 donors, error bars are SEM. [Diagram 23]FIG. 23 is a graph showing that SUV-KO gRV HiT cells exhibited enhanced memory-related profile, reduced effector-like profile and reduced exhaustion marker phenotype compared to scrambled (SCR) control after 2nd round of antigen stimulation. TRAC-KO-scrambled and TRAC-KO-SUV-KO gRV-HiT+ booster cells that had already received 1st round of antigen stimulation were filtered using 20 μM filters and FACS analyzed to determine the % of HiT+ cells. These gRV-HiT+ booster cells were co-cultured with GFP+ LNCap-19 target line at E:T ratio of 1:5 (1.5e3 HIT T cells and 7.5e3 target cells) in 96-well plates and placed in InCucyte for 7 days for GFP detection. (A) and (C) graphs show gRV FMC63-HiT+ booster cells, and (B) and (D) graphs show gRV mJ591-HiT+ booster cells. The following gating strategy was used: (A) and (B) Analysis of surface marker expression on lymphocyte+singlet+alive+CD4+ / -CD8+ / -Booster+CD45RO+ 7 days after plating. CCR7 and CD27 expression were analyzed as appropriate to confirm stemness and resolution. CM: central memory, Ttm: transitional memory, and EM: effector memory. (C) and (D) Lymphocyte+singlet+alive+CD4+ / -CD8+ / -Booster+ for CD57 and TIM3, respectively. Data represent N=2 donors, error bars are SEM. [Figure 24] Figure 24 is a schematic diagram of TRAC-HIT cell generation. AAV with homology arms is knocked into the TRAC locus following Crisp / Cas9-mediated double-strand break. DNA repair machinery integrates the expression cassette of the HIT construct and places it under the control of the endogenous promoter. The method is multiplexed with an additional Cas9 RNP to facilitate SUV39H1 gene editing. [Diagram 25]Figure 25A illustrates HIT reconstitution with an increase in the CD3+TCRab+ population in HIT-AAV-treated cells. Figure 25B illustrates the reduction in the level of SUV39H1 protein in SUV39H1 gRNA-treated cells (SUVKO) compared to scrambled gRNA-treated cells (SCR) as measured by Western blot. Figure 25C is a graph showing the reduction in the level of H3K9me3 in SUV39H1 gRNA-treated cells (SUVKO) compared to scrambled gRNA-treated cells (SCR) as measured by flow cytometry. [Figure 26] Figure 26A shows the expression of 19-HIT by flow cytometry using biotinylated soluble CD19 molecules. Figure 26B shows a schematic of the in vitro experimental design. TRAC-19-HIT T cells were co-cultured with NALM6 cells with WT levels of CD19 at various ratios for 10 days. On day 10, TRAC-19-HIT cell phenotype was analyzed by flow cytometry. Figure 26C shows flow cytometric analysis of CD27 and CD45RO expression in TRAC-19-HIT cells. The percentage of CD27+ cells is shown. [Figure 27] Figure 27A is a schematic of the in vivo experimental design. NALM6 cells with WT levels of CD19 were injected into NSG mice on day 0. Then, either full (SCR) or (SUVKO) TRAC-19-HIT cells were injected on day 3. Figure 27B is a graph showing tumor growth monitored by bioluminescence imaging (mean radiance, photons / sec / cm2). C) Percent survival of TRAC-19-HIT treated mice. [Figure 28] Figure 28A is a schematic of the in vivo experimental design. NALM6 cells with low levels of CD19 were injected into NSG mice on day 0. Either sufficient (SCR) or (SUVKO) TRAC-19-HIT cells were injected on day 3. B) Tumor growth monitored by bioluminescence imaging (mean radiance, photons / sec / cm2). [Figure 29]FIG. 29 illustrates an example of a SFG (gamma retrovirus) HIT construct directed against a mesothelin tumor antigen and comprising a VH fragment fused to a TRBC2 sequence and a VL fragment fused to a TRAC sequence. A booster sequence (CCR) can be further recombinantly expressed. The booster sequence may be provided in a separate construct (expression cassette) or in the same construct, as illustrated in FIG. 29. In some embodiments, the booster (CCR) sequence is a CD80_4-1BB chimeric receptor, as illustrated in SEQ ID NO: 33. [Diagram 30] FIG. 1 illustrates an example of a SFG (gammaretrovirus) HIT construct directed against the mesothelin tumor antigen and comprising a VH fragment fused to a TRBC2 sequence and a VL fragment fused to a TRAC sequence. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0033] definition As used herein, the singular forms "a," "an," and "the" are intended to include the plural forms as well, unless the context clearly indicates otherwise.

[0034] Similarly, as used herein, "and / or" refers to and includes any and all possible combinations of one or more of the associated listed items, as well as the lack of combinations when interpreted as alternatives ("or").

[0035] As used herein, the term "about," when referring to a measurable value, such as, for example, an amount of a polypeptide, dosage, time, temperature, enzyme activity or other biological activity, etc., is meant to encompass variations of ±10%, ±5%, ±1%, ±0.5% or even ±0.1% of the specified value.

[0036] The term "antigen recognition receptor," as used herein, refers to a receptor that can activate an immune or immunoresponsive cell (e.g., a T cell) in response to its binding to an antigen. Non-limiting examples of antigen recognition receptors include natural or endogenous T cell receptors ("TCRs") and chimeric antigen receptors ("CARs").

[0037] The term "antibody" herein is used in the broadest sense and includes intact antibodies, chimeric, human or humanized antibodies, as well as polyclonal and monoclonal antibodies, including fragment antigen-binding (Fab) fragments, F(ab')2 fragments, Fab' fragments, Fv fragments, recombinant IgG (rIgG) fragments, single chain antibody fragments including variable heavy (VH) regions capable of specifically binding to an antigen, single chain variable fragments (scFv), and single domain antibody (e.g., sdAb, sdFv, nanobody) fragments. The term encompasses recombinant and / or other modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multispecific antibodies, e.g., bispecific antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv, tandem tri-scFv, etc. Unless otherwise specified, the term "antibody" should be understood to encompass functional antibody fragments thereof. The term also encompasses intact or full length antibodies, including antibodies of any class or subclass, including IgG and its subclasses IgG1, IgG2, IgG3, IgG4, IgM, IgE, IgA, and IgD, in some embodiments, an antibody comprises a heavy chain variable region and a light chain variable region.

[0038] "Antibody fragment" refers to a molecule other than an intact antibody that contains a portion of an intact antibody that binds to the antigen to which the intact antibody binds. Examples of antibody fragments include, but are not limited to, Fv, Fab, Fab', Fab'-SH, F(ab')2, diabodies, linear antibodies, variable heavy (VH) regions, VHH antibodies, single chain antibody molecules such as scFv, and single domain antibodies (including VH and VL single antibodies), as well as multispecific antibodies formed from antibody fragments. In certain embodiments, the antibody is a single chain antibody fragment comprising the variable heavy and / or variable light regions, such as scFv.

[0039] A "single domain antibody" is an antibody fragment that comprises all or part of the heavy chain variable domain or all or part of the light chain variable domain of an antibody. In certain embodiments, a single domain antibody is a human single domain antibody.

[0040] "Inactivation" or "disruption" of a gene refers to a change in a genomic DNA sequence that causes a reduction or loss of gene expression or causes the expression of a non-functional gene product. Exemplary methods include gene silencing, knockdown, knockout, and / or gene disruption techniques, such as gene editing, for example, by truncation and / or induction of homologous recombination. Examples of such gene disruptions are insertions, frameshift and missense mutations, deletions, knock-ins, and knock-outs of genes or parts of genes, including deletion of the entire gene. Such disruptions may occur in coding regions, for example, in one or more exons, such as by inserting a stop codon, resulting in the inability to produce a full-length product, a functional product, or any product. Such disruptions may also occur by disrupting promoters or enhancers or other regions that affect transcriptional activation, such that transcription of the gene is prevented. Gene disruptions include gene targeting, including targeted gene inactivation by homologous recombination.

[0041] "Inhibition" or "suppression" of a gene refers to a decrease in activity and / or gene expression by at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 99%, or more, compared to the uninhibited or suppressed wild-type activity or expression level. Inhibition of gene expression results in the absence of substantial detectable activity or functional gene product in a cell.

[0042] "Non-functional" refers to a protein that has reduced activity or lacks detectable activity.

[0043] "Dominant negative" refers to a mutation that produces a defective gene that prevents or adversely affects the function of the wild-type product in the same cell. The defective gene retains its ability to interact with the same elements as the wild-type product, but some functional aspects are blocked.

[0044] "Express" or "expression" means that a gene sequence is transcribed and optionally translated. If the gene expresses a non-coding RNA, expression typically results in the production of the RNA after transcription and, optionally, splicing. If the gene is a coding sequence, expression typically results in the production of a polypeptide after transcription and translation.

[0045] "Expression control sequence" refers to a nucleotide sequence that influences transcription, RNA processing, RNA stability or translation of an associated nucleotide sequence. Examples include, but are not limited to, promoters, enhancers, introns, translation leader sequences, polyadenylation signal sequences, transcription initiation and transcription and / or translation termination regions (i.e., termination regions). "Fragment" refers to a portion of a referenced sequence (polynucleotide or polypeptide) having a length of at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% of the full length sequence.

[0046] By "exogenous" is meant a nucleic acid molecule (e.g., a cDNA, DNA or RNA molecule) or polypeptide that is not present endogenously in the cell or is not present at sufficient levels to achieve the functional effect obtained when overexpressed. The term "exogenous" thus encompasses any recombinant nucleic acid molecule or polypeptide expressed in a cell, such as foreign, heterologous and overexpressed nucleic acid molecules and polypeptides. By "exogenous" nucleic acid is meant a nucleic acid that is not present in a native wild-type cell; for example, an exogenous nucleic acid may differ from its endogenous counterpart by sequence, by position / location, or both. For clarity, an exogenous nucleic acid may have the same or a different sequence compared to its native endogenous counterpart; it may be introduced by genetic engineering into the cell itself or into its progenitor cell, and may be optionally linked to alternative control sequences, such as non-native promoters or secretion sequences.

[0047] "Heterologous" refers to a polynucleotide or polypeptide that contains sequences that are not found in the same relationship to each other in nature. For example, a heterologous sequence may be derived from another species, or from the same species or organism, but modified from either its original form in the cell or the form in which it was originally expressed. Thus, a heterologous polynucleotide contains a nucleotide sequence that is derived from and inserted into the same naturally occurring, original cell type, but that is non-naturally occurring, e.g., in a different copy number and / or under the control of different regulatory sequences than found in nature, and / or in a different location (flanked by different nucleotide sequences) than it was originally located.

[0048] "Nucleic acid", "nucleotide sequence" and "polynucleotide" are used interchangeably and include both RNA and DNA, including cDNA, genomic DNA, mRNA, synthetic (e.g., chemically synthesized) DNA or RNA, and chimeras of RNA and DNA. The terms polynucleotide, nucleotide sequence or nucleic acid refer to a chain of nucleotides regardless of the length of the chain. A nucleic acid may be double-stranded or single-stranded. If single-stranded, the nucleic acid may be the sense or antisense strand. Nucleic acids may be synthesized using oligonucleotide analogs or derivatives (e.g., modified backbones, sugars or bases). Such oligonucleotides can be used, for example, to prepare nucleic acids with altered base-pairing abilities or increased resistance to nucleases. The disclosure further provides nucleic acids that are complements (either full complements or partial complements) of the nucleic acids, nucleotide sequences or polynucleotides described herein. For example, modified bases (modified nucleobases), such as inosine, 5-methylcytosine, 6-methyladenine, hypoxanthine, etc., may be used for antisense, dsRNA and ribozyme pairing. For example, polynucleotides containing C-5 propylene analogs of uridine and cytidine have been shown to bind RNA with high affinity and are potent antisense inhibitors of gene expression. Other modifications, such as modifications to the phosphodiester backbone or 2'-hydroxyl on the ribose sugar group of RNA, may also be made.

[0049] "Operably linked" means that an element such as an expression control sequence is positioned to perform its normal function on a nucleotide sequence of interest. For example, a promoter operably linked to a nucleotide sequence of interest can affect the expression of the nucleotide sequence of interest. Expression control sequences do not need to be contiguous with the nucleotide sequence of interest, so long as they function to direct its expression.

[0050] "Percent identity" between two sequences refers to the percentage of bases or amino acids that are identical between the two sequences to be compared, obtained by the best alignment of the sequences, and this percentage is purely statistical, and the differences between these two sequences are randomly distributed across the two sequences. A base is considered to be complementary if it hybridizes under normal conditions; for example, a modified nucleobase may be aligned in a similar manner to the base of the hybridization pattern that it mimics. As used herein, "best alignment" or "optimal alignment" refers to the alignment with the highest determined identity percentage (see below). Sequence comparison between two nucleic acid sequences (also referred to herein as nucleotide sequences or nucleobase sequences) is usually achieved by comparing such sequences that have been aligned before according to best alignment; this comparison is performed on a comparison segment to identify and compare local regions of similarity.The best sequence alignment for carrying out the comparison can be done manually, by using the global homology algorithm developed by SMITH and WATERMAN (Ad. App. Math., vol. 2, p. 482, 1981), by using the local homology algorithm developed by NEDDLEMAN and WUNSCH (J. Mol. Biol, vol. 48, p. 443, 1970), by using the similarity method developed by PEARSON and LIPMAN (Proc. Natl. Acad. Sci. USA, vol. 85, p. 2444, 1988), by using computer software using such algorithms (GAP, BESTFIT, BLAST P, BLAST N, FASTA, TFASTA, Wisconsin Genetics software Package, Genetics Computer Group, 575 Science Dr., Madison, Wisconsin, USA), by using the MUSCLE multiple alignment algorithm (Edgar, Robert C, Nucleic Acids This can be achieved by using the BLAST software (Bioscience, 1999, vol. 32, p. 1792, 2004). To obtain the best local alignment, preferably, BLAST software can be used. The identity percentage between two sequences is determined by comparing the two sequences that are optimally aligned, and the sequence may contain additions or deletions relative to the reference sequence to obtain the optimal alignment between the two sequences. The identity percentage is calculated by determining the number of positions that are identical between the two sequences, dividing this number by the total number of positions compared, and multiplying the result by 100 to obtain the identity percentage between the two sequences.

[0051] By "immunoresponsive cell" is meant a cell that functions in the immune response, or a precursor or progeny thereof.

[0052] "Treatment" or "treating" as used herein is defined as the application or administration of a cell or a composition comprising a cell according to the present disclosure to a patient in need thereof for the purpose of curing, ameliorating, alleviating, relieving, altering, curing, ameliorating, improving, or affecting a disease, such as cancer, or any symptoms of a disease (e.g., cancer). In particular, the term "treat" or "treatment" refers to reducing or alleviating at least one adverse clinical symptom associated with a disease, such as cancer, such as pain, swelling, low blood counts, etc. The term "treat" or "treatment" with respect to cancer treatment also refers to slowing or reversing the progression of neoplastic deregulated cell proliferation, i.e., shrinking an existing tumor and / or halting tumor growth. The term "treat" or "treatment" also refers to inducing apoptosis in a subject's cancer or tumor cells.

[0053] "Variant" refers to a mutant having mutations (deletions, substitutions or insertions) over its entire length or at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 112, 114, 116, 117, 118, 119, 220, 230, 240, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 304, 305, 308, 309, 306, 30 It refers to a sequence (polynucleotide or polypeptide) that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference sequence over a region of 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000 or 1100 nucleotides or amino acids. With respect to polynucleotide sequences, variants also encompass polynucleotides that hybridize to a reference sequence or its complement under stringent conditions.

[0054] By "modulate" is meant a positive or negative change. Exemplary modulation includes a change of about 1%, about 2%, about 5%, about 10%, about 25%, about 50%, about 75% or about 100%.

[0055] By "increase" is meant a change of at least about 5%. The change may be about 5%, about 10%, about 25%, about 30%, about 50%, about 75%, about 100% or more.

[0056] By "reduce" is meant to change negatively by at least about 5%. The change may be about 5%, about 10%, about 25%, about 30%, about 50%, about 75% or even about 100%.

[0057] By "effective amount" is meant an amount sufficient to obtain a therapeutic effect. In certain embodiments, "effective amount" means an amount sufficient to halt, slow or inhibit the continued proliferation, growth or metastasis (e.g., invasion or migration) of a neoplasm.

[0058] By "isolated cell" is meant a cell that has been separated from molecules and / or cellular components that naturally accompany the cell.

[0059] The terms "isolated," "purified," or "biologically pure" refer to material that is free to varying degrees from components that normally accompany it when found in its native state. "Isolated" describes a degree of separation from the original source or surrounding environment. "Purified" describes a degree of separation that is greater than isolation. A "purified" or "biologically pure" protein is sufficiently free from other materials such that any impurities do not substantially affect the biological properties of the protein or produce other deleterious results. That is, a nucleic acid or peptide is purified when it is substantially free of cellular material, viral material, or culture medium if produced by recombinant DNA technology, or chemical precursors or other chemicals if chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, such as polyacrylamide gel electrophoresis or high performance liquid chromatography. The term "purified" can describe a nucleic acid or protein that results in essentially one band in an electrophoretic gel. For proteins that may be subject to modifications, such as phosphorylation or glycosylation, the different modifications can result in different isolated proteins that can be separated and purified.

[0060] As used herein, the term "antigen-binding domain" refers to a domain capable of specifically binding to a particular antigenic determinant or set of antigenic determinants present on a cell.

[0061] "Linker," as used herein, is intended to mean a functional group (e.g., a chemical or polypeptide) that covalently links two or more polypeptides or nucleic acids such that they are tethered together. As used herein, "peptide linker" refers to one or more amino acids used to couple two proteins together (e.g., coupling a VH domain and a VL domain). In certain embodiments, the linker comprises the sequence set forth in GGGGSGGGSGGGGGS [SEQ ID NO: 19].

[0062] As used herein, a "vector" is any nucleic acid molecule for the transfer of a nucleic acid into a cell or the expression of a nucleic acid in a cell. The term "vector" includes both viral and non-viral (e.g., plasmid) nucleic acid molecules for introducing a nucleic acid into a cell in vitro, ex vivo, and / or in vivo. A vector may include expression control sequences, restriction sites, and / or selectable markers. A "recombinant" vector refers to a vector that includes one or more heterologous nucleotide sequences.

[0063] By "signal sequence" or "leader sequence" is meant a peptide sequence (eg, 5, 10, 15, 20, 25 or 30 amino acids) present at the N-terminus of a newly synthesized protein that directs entry of the protein into the secretory pathway. Exemplary leader sequences include, but are not limited to, the IL-2 signal sequence: MYRMQLLSCIALSLALVTNS [SEQ ID NO:20] (human), MY SMQLASC VTLTLVLLVNS [SEQ ID NO:21] (mouse); kappa leader sequence: METP AQLLFLLLLWLPDTT G [SEQ ID NO:22] (human), METDTLLLW VLLLW VPGS TG [SEQ ID NO:23] (mouse); CD8 leader sequence: M ALP VT ALLLPL ALLLH A ARP [SEQ ID NO:24] (human); truncated human CD8 signal peptide: M ALP VT ALLLPL ALLLH A [SEQ ID NO:25] (human); albumin signal sequence: MKWVTFISLLFSSAYS [SEQ ID NO:26] (human); and prolactin signal sequence: MD SKGS SQKGSRLLLLLVV SNLLLCQGVV S [SEQ ID NO:27] (human). By "soluble" is meant a polypeptide that is capable of unlimited diffusion in an aqueous environment (eg, is not membrane bound).

[0064] By "specifically binds" is meant a polypeptide or fragment thereof that recognizes and binds a biological molecule (e.g., a polypeptide) of interest, but does not substantially recognize or bind other molecules in a sample, e.g., a biological sample that naturally contains a polypeptide of the present disclosure.

[0065] The term "tumor antigen," as used herein, refers to an antigen (e.g., a polypeptide) that is uniquely or differentially expressed in tumor cells compared to normal or non-IS neoplastic cells. In certain embodiments, a tumor antigen includes any polypeptide expressed by a tumor that can activate or induce an immune response via an antigen recognition receptor (e.g., CD19, MUC-16) or suppress an immune response via receptor ligand binding (e.g., CD47, PD-L1 / L2, B7.1 / 2).

[0066] Expression boosters are used herein for costimulatory ligands and costimulatory receptors (CCRs). In certain embodiments, the costimulatory ligand is selected from the group consisting of CD80, CD86, 41BBL, CD275, CD40L, OX40L, and any combination thereof. In certain embodiments, the cells further comprise or consist of one exogenous costimulatory ligand. In certain embodiments, the one exogenous costimulatory ligand is CD80 or 4-1BBL. In certain embodiments, the cells further comprise or consist of two exogenous costimulatory ligands. In certain embodiments, the two exogenous costimulatory ligands are CD80 and 4-1BBL. In certain embodiments, the immunoresponsive cells comprise at least one chimeric costimulatory receptor (CCR). In certain embodiments, the CCR comprises a costimulatory molecule selected from the group consisting of a CD80 polypeptide, a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP-10 polypeptide, and any combination thereof. Examples of costimulatory ligands, molecules and receptors (or fusion polypeptides) are described in WO 2021 / 016174, which is incorporated by reference in its entirety. Exemplary booster sequences include SEQ ID NOs: 32-33 and 53-54.

[0067] cell Immune cells (immune responsive cells) An immune cell according to the present disclosure is typically a mammalian cell, such as a human cell.

[0068] In particular, the cells of the present disclosure are derived from blood, bone marrow, lymph, or lymphoid organs (particularly the thymus) and are cells of the immune system, such as cells of innate or adaptive immunity (i.e., immune cells), e.g., myeloid or lymphoid cells, including lymphocytes, typically T cells and / or NK cells.

[0069] Preferably, according to the present disclosure, the cells are lymphocytes, including, inter alia, T cells, B cells, NK cells and their precursor cells.

[0070] The cells according to the present disclosure may also be immune cell precursors, such as lymphoid progenitor cells, more preferably T cell precursor cells. Examples of T cell precursor cells include pluripotent stem cells (PSCs), induced pluripotent stem cells (iPSCs), hematopoietic stem cells (HSCs), human embryonic stem cells (ESCs), adipose-derived stem cells (ADSCs), multipotent progenitor cells (MPPs), lymphocyte-stimulated multipotent progenitor cells (LMPPs), common lymphoid progenitor cells (CLPs), lymphoid progenitor cells (LPs), thymic colonized progenitor cells (TSPs); or early thymic progenitor cells (ETPs). Hematopoietic stem and progenitor cells can be obtained, for example, from umbilical cord blood or from peripheral blood, an example of which is peripheral blood-derived CD34+ cells after mobilization treatment with granulocyte colony-stimulating factor (G-CSF).

[0071] T cell progenitors typically express a set of consensus markers including CD44, CD117, CD135, and / or Sca-1, see also Petrie HT, Kincade PW. Many roads, one destination for T cell progenitors. The Journal of Experimental Medicine. 2005, 202(1):11-13.

[0072] The cells are typically primary cells, such as those isolated directly from a subject and / or those isolated from a subject and frozen.

[0073] The cells of the present disclosure may be allogeneic and / or autologous to the subject to be treated.

[0074] In autologous immune cell therapy, immune cells are collected from a patient, modified as described herein, and returned to the patient. In allogeneic immune cell therapy, immune cells are collected from a healthy donor rather than the patient, modified as described herein, and administered to the patient. Typically, they are HLA-matched to reduce the chance of rejection by the host. The immune cells may also contain modifications such as the destruction or removal of HLA class I molecules. For example, Torikai et al., Blood. 2013, 122:1341-1349, used ZFNs to knock out the HLA-A locus, and Ren et al., Clin. Cancer Res. 2017, 23:2255-2266, knocked out beta-2 microglobulin (B2M), which is required for HLA class I expression.

[0075] In addition, the immune cells of a universal "off-the-shelf" product must contain modifications designed to reduce graft-versus-host disease, such as inactivation (e.g., disruption or deletion) of the TCRαβ receptor, with the resulting cells exhibiting a significant reduction or near-absence of endogenous TCR expression. For a review, see Graham et al., Cells. October 2018, Vol. 7(10):155. Because the alpha chain (TRAC) is encoded by a single gene, rather than two genes as the beta chain is, the TRAC locus is a typical target for ablating or disrupting TCRαβ receptor expression, although the TCRβ locus may be disrupted instead. Alternatively, an inhibitor of TCRαβ signaling may be expressed; for example, a truncated form of CD3 zeta can act as a TCR inhibitory molecule. Ren et al. simultaneously knocked out TCRαβ, B2M, and the immune checkpoint PD1.

[0076] In some embodiments, the cells include one or more subsets of T cells or other cell types, such as the total T cell population, CD4+ cells and / or CD8+ cells, and subpopulations thereof, such as those defined by function, activation state, maturity, differentiation potential, expansion, recirculation, localization, and / or persistence ability, antigen specificity, antigen specificity, type of receptor, presence in a particular organ or compartment, marker or cytokine secretion profile, and / or degree of differentiation.

[0077] Subtypes and subpopulations of T cells and / or CD4+ and / or CD8+ T cells include naive T (TN) cells, such as stem cell memory T (TSCM) cells, central memory T (TCM) cells, effector memory T (TEM) cells, or terminally differentiated effector memory T cells, effector T cells (TEFF), memory T cells and subtypes thereof, tumor infiltrating lymphocytes (TIL), immature T cells, mature T cells, helper T cells, cytotoxic T cells, mucosal-associated invariant T (MAIT) cells, naturally occurring and acquired regulatory T (Treg) cells, helper T cells such as TH1 cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells, follicular helper T cells, alpha / beta T cells, and delta / gamma T cells. Preferably, the cells according to the present disclosure are TEFF cells, as well as TN cells, TSCM cells, TCM cells, TEM cells, and combinations thereof, which have stemness / memory properties and higher reconstitution potential due to inhibition of SUV39H1.

[0078] In some embodiments, one or more of the T cell populations are enriched or depleted for cells that are positive for or express high levels of one or more particular markers, such as surface markers, or cells that are negative for or express relatively low levels of one or more markers. In some cases, such markers are absent or expressed at relatively low levels in certain populations of T cells (such as non-memory cells) but present or expressed at relatively high levels in certain other populations of T cells (such as memory cells). In one embodiment, cells (such as CD8+ cells or T cells, e.g., CD3+ cells) are enriched for cells that are positive for or express high surface levels of CD117, CD135, CD45RO, CCR7, CD28, CD27, CD44, CD127, and / or CD62L, and / or are depleted (e.g., negatively selected) for cells that are positive for or express high surface levels of CD45RA. In some embodiments, the cells are enriched or depleted for cells that are positive for or express high surface levels of CD122, CD95, CD25, CD27, and / or IL7-Ra (CD127). In some examples, CD8+ T cells are enriched for cells that are CD45RO positive (or CD45RA negative) and CD62L positive. The subset of cells that are CCR7+, CD45RO+, CD27+, CD62L+ cells constitutes the central memory cell subset.

[0079] For example, according to the present disclosure, the cells can include a CD4+ T cell population and / or a CD8+ T cell subpopulation, such as a subpopulation enriched for central memory (TCM) cells. Alternatively, the cells can be other types of lymphocytes, including natural killer (NK) cells, mucosal-associated invariant T (MAIT) cells, innate lymphoid cells (ILCs), and B cells.

[0080] The cells for genetic engineering according to the present disclosure and compositions comprising such cells are isolated from a sample, particularly a biological sample obtained from or derived from a subject. Typically, the subject is in need of and / or will be receiving cell therapy (adoptive cell therapy). The subject is preferably a mammal, particularly a human. In one embodiment of the present disclosure, the subject has cancer.

[0081] Samples include tissue, fluid, and other samples taken directly from a subject, as well as samples resulting from one or more processing steps, such as separation, centrifugation, genetic manipulation (e.g., transduction with a viral vector), washing, and / or incubation. Biological samples may be samples obtained directly from a biological source or may be samples that have been processed. Biological samples include, but are not limited to, tissue samples from tissues or organs, or body fluid samples such as blood, plasma, serum, cerebrospinal fluid, or synovial fluid, including processed samples derived therefrom. Preferably, the sample from which the cells are derived or isolated is a blood or blood-derived sample, or is or is derived from an apheresis or leukapheresis product. Exemplary samples include whole blood, peripheral blood mononuclear cells (PBMC), white blood cells, bone marrow, thymus, tissue biopsy, tumor, leukemia, lymphoma, lymph node, gut-associated lymphoid tissue, mucosa-associated lymphoid tissue, spleen, other lymphoid tissue, and / or cells derived therefrom. In the context of cell therapy (typically adoptive cell therapy), samples include samples derived from autologous and allogeneic sources.

[0082] In some embodiments, the cells are derived from a cell line, such as a T cell line. The cells can also be obtained from xenogeneic sources, such as mouse, rat, non-human primate, or pig. Preferably, the cells are human cells.

[0083] The subject matter of the present disclosure provides an immunoresponsive cell comprising the HI-TCR disclosed herein. In certain embodiments, the HI-TCR can activate the immunoresponsive cell. Upon binding to an antigen, the immunoresponsive cell exhibits a cytolytic effect toward the antigen-bearing cell. In certain embodiments, the immunoresponsive cell comprising the HI-TCR exhibits comparable or better therapeutic efficacy compared to a cell comprising a chimeric antigen receptor (CAR) targeting the same antigen. In certain embodiments, the immunoresponsive cell comprising the HI-TCR exhibits comparable or better cytolytic effect compared to a cell comprising a chimeric antigen receptor (CAR) targeting the same antigen. In certain embodiments, the immunoresponsive cell comprising the HI-TCR secretes anti-tumor cytokines. Cytokines secreted by the immunoresponsive cell include, but are not limited to, TNFa, IFNy, and IL2.

[0084] According to the present subject matter, typically immune cells (immunoresponsive cells) are deficient for Suv39h1.

[0085] SUV39H1 Human SUV39H1 methyltransferase is referenced in UNIPROT as O43463 and is encoded by the gene SUV39H1 (gene ID: 6839 in NCBI) located on the X chromosome. One exemplary human gene sequence is SEQ ID NO: 15 and one exemplary human protein sequence is SEQ ID NO: 16, although it is understood that polymorphisms or variants with different sequences exist in the genomes of various subjects. Thus, the term SUV39H1 according to the present disclosure encompasses all mammalian variants of SUV39H1 and genes encoding proteins that have SUV39H1 activity (i.e., methylation of Lys-9 of histone H3 by H3K9-histone methyltransferase) and are at least 75%, 80%, or typically 85%, 90%, or 95% identical to SEQ ID NO: 16.

[0086] As used herein, the expression "deficient for Suv39h1" according to the present invention refers to the inhibition or blocking of Suv39h1 activity (i.e. methylation of Lys-9 of histone H3 by H3K9-histone methyltransferase) in a cell according to the present invention.

[0087] "Inhibition of Suv39h1 activity" according to the present invention refers to a reduction in Suv39h1 activity of at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% or more compared to the activity or level of uninhibited Suv39h1 protein. Preferentially, inhibition of Suv39h1 activity is associated with the absence of substantial detectable activity of Suv39h1 in the cell.

[0088] Inhibition of Suv39h1 activity can also be achieved through suppression of Suv39h1 gene expression or through Suv39h1 gene disruption. According to the present invention, said suppression reduces the expression of Suv39h1 in cells, particularly in immune cells of the present invention, by at least 50, 60, 70, 80, 90 or 95% compared to the same cells produced by the method in the absence of suppression. Gene disruption may also result in reduced expression of Suv39h1 protein or in expression of non-functional Suv39h1 protein.

[0089] By "non-functional" Suv39h1 protein is intended herein a protein that has reduced or no detectable activity as described above. Thus, an inhibitor of Suv39h1 activity in a cell according to the present invention can be selected from among any compound or agent that is natural or does not have the ability to inhibit the methylation of Lys-9 of histone H3 by H3K9-histone methyltransferase or inhibits H3K9-histone methyltransferase SUV39H1 gene expression.

[0090] The inhibition of Suv39h1 in immune cells according to the present invention may be permanent and irreversible, or may be transient, or may be reversible. However, preferably, the inhibition of Suv39h1 is permanent and irreversible. The inhibition of Suv39h1 in cells may be achieved before or after the injection of the cells into the targeted patient, as described below.

[0091] Antigen-specific receptors In some embodiments, immune cells express antigen-specific receptors on their surface. Thus, the cells may contain one or more nucleic acids encoding one or more antigen-specific receptors, optionally operably linked to heterologous regulatory control sequences. Typically, such antigen-specific receptors are expressed in the 10 -6 M or less, 10 -7 M or less, 10 -8 M or less, 10 -9 M or less, 10 -10 M or less, or 10 -11 In some embodiments, the antigen-binding domain binds to a target antigen with a Kd binding affinity of about 1×10 M or less (lower numbers indicate higher binding affinity). -7 Below, about 5×10 -8 Below, approximately 1×10 -8 Below, about 5×10 -9 Below, approximately 1×10 -9 Below, about 5×10 -10 Below, approximately 1×10 -10 Below, about 5×10 -11 Below, approximately 1×10 -11 Below, about 5×10 -12 Less than or equal to about 1×10 -12 Binds to target antigen with the following KD affinity:

[0092] Typically, the nucleic acid is exogenous (e.g., heterologous) (i.e., not normally found in the cell being genetically engineered and / or in the organism from which such cell is derived). In some embodiments, the nucleic acid is not naturally occurring and includes a chimeric combination of nucleic acids encoding various domains derived from multiple different cell types. The nucleic acids and their regulatory control sequences are typically heterologous. For example, a nucleic acid encoding an antigen-specific receptor may be heterologous to the immune cell and operably linked to an endogenous promoter of a T cell receptor such that its expression is under the control of the endogenous promoter. In some embodiments, a nucleic acid encoding a modified TCR or CAR is operably linked to an endogenous TRAC promoter.

[0093] Antigen-specific receptors according to the present disclosure include recombinant modified T cell receptors (TCRs) and components thereof, as well as functional non-TCR antigen-specific receptors such as chimeric antigen receptors (CARs).

[0094] Immune cells may be engineered to reduce graft-versus-host disease, particularly in allogeneic cases, and the cells contain inactivated (e.g., disrupted or deleted) TCRαβ receptors. The TRAC locus is a typical target for reducing TCRαβ receptor expression, since the alpha chain (TRAC) is encoded by a single gene, not two genes as the beta chain is. Thus, a nucleic acid encoding an antigen-specific receptor (e.g., CAR or TCR) may be integrated into the TRAC locus at a location that significantly reduces the expression of a functional TCR alpha chain, preferably in the 5' region of the first exon (SEQ ID NO: 17). See, e.g., Jantz et al., WO 2017 / 062451; Sadelain et al., WO 2017 / 180989; Torikai et al., Blood, vol. 119(2):5697-705 (2012); Eyquem et al., Nature. Mar. 2, 2017, vol. 543(7643):113-117. Expression of endogenous TCR alpha may be reduced by at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%. In such embodiments, expression of the nucleic acid encoding the antigen-specific receptor is optionally under the control of an endogenous TCR-alpha promoter.

[0095] Chimeric antigen receptors (CARs) In some embodiments, the engineered antigen-specific receptor comprises a chimeric antigen receptor (CAR), including an activating or stimulatory CAR, a costimulatory CAR (see WO 2014 / 055668), and / or an inhibitory CAR (iCAR, see Fedorov et al., Sci. Transl. Medicine, Vol. 5(215) (December 2013)).

[0096] Chimeric antigen receptors (CARs) (also known as chimeric immune receptors, chimeric T cell receptors, artificial T cell receptors) are genetically engineered antigen-specific receptors that graft arbitrary specificities onto immune effector cells (T cells). Typically, such receptors are used to graft the specificity of monoclonal antibodies onto T cells, and the transfer of their coding sequences is facilitated by retroviral vectors.

[0097] CARs generally comprise an extracellular antigen (or ligand) binding domain linked, in some embodiments, via a linker and / or a transmembrane domain, to one or more intracellular signaling components. Such molecules typically mimic or approximate signals through natural antigen receptors, signals through such receptors in combination with costimulatory receptors, and / or signals through costimulatory receptors alone.

[0098] CAR is (a) an extracellular antigen-binding domain; (b) a transmembrane domain, (c) optionally a costimulatory domain, and (d) Intracellular signaling domain may also include

[0099] In some embodiments, CARs are constructed with specificity for a particular antigen (or marker or ligand), such as an antigen expressed in a particular cell type targeted by adoptive cell therapy, such as a cancer marker. A CAR typically comprises, in its extracellular portion, one or more antigen-binding molecules, such as one or more antigen-binding fragments, domains, or portions of an antibody, typically one or more antibody variable domains. For example, the extracellular antigen-binding domain may comprise a light chain variable domain and a heavy chain variable domain, typically as an scFv.

[0100] The moieties used to bind to the antigen include three basic categories: either single chain antibody fragments (scFv) derived from antibodies, Fabs selected from libraries, or natural ligands that engage their cognate receptors (in the case of first generation CARs). Successful examples in each of these categories have been reported, inter alia, in Sadelain M, Brentjens R, Riviere I. The basic principles of chimeric antigen receptor (CAR) design. Cancer discovery. 2013, 3(4):388-398 (see especially Table 1), which are included in the present application.

[0101] Antibodies include chimeric, humanized, or human antibodies, which can be further affinity matured and selected as described above. Chimeric or humanized scFvs derived from rodent immunoglobulins (e.g., mouse, rat) are widely used because they are easily derived from well-characterized monoclonal antibodies. Humanized antibodies contain CDR regions from rodent sequences, typically with rodent CDRs grafted into a human framework, where some of the human framework residues may be backmutated to the original rodent framework residues to preserve affinity, and / or one or a few CDR residues may be mutated to increase affinity. Fully human antibodies do not have mouse sequences and are typically produced by phage display techniques of human antibody libraries or by immunizing transgenic mice in which the native immunoglobulin loci have been replaced with segments of the human immunoglobulin loci. Variants of antibodies can be produced with one or more amino acid substitutions, insertions, or deletions in the native amino acid sequence, where the antibody retains or substantially retains its specific binding function. Conservative substitutions of amino acids are well known and are described above. Additional variants with improved affinity for the antigen can also be produced.

[0102] Typically, a CAR comprises one or more antigen-binding portions of an antibody molecule, such as a single-chain antibody fragment (scFv) derived from the variable heavy (VH) and variable light (VL) chains of a monoclonal antibody (mAb).

[0103] In some embodiments, a CAR comprises an antibody heavy chain variable domain that specifically binds to an antigen, such as a cancer marker or cell surface antigen, of a targeted cell or disease, such as a tumor cell or cancer cell, such as any of the target antigens described herein or known in the art.

[0104] In some embodiments, a CAR comprises an antibody or antigen-binding fragment (e.g., scFv) that specifically recognizes an antigen, such as an intact antigen, expressed on the surface of a cell.

[0105] In some embodiments, the CAR comprises a TCR-like antibody, such as an antibody or antigen-binding fragment (e.g., scFv), that specifically recognizes an intracellular antigen, such as a tumor-associated antigen, that is presented as an MHC-peptide complex on the cell surface. In some embodiments, the antibody or antigen-binding portion thereof that recognizes the MHC-peptide complex may be expressed on the cell as part of a recombinant receptor, such as an antigen-specific receptor. Antigen-specific receptors include functional non-TCR antigen-specific receptors, such as chimeric antigen receptors (CARs). In general, a CAR that comprises an antibody or antigen-binding fragment that exhibits TCR-like specificity for a peptide-MHC complex may also be referred to as a TCR-like CAR.

[0106] In some aspects, the antigen-specific binding or recognition component is linked to one or more transmembrane domains and intracellular signaling domains. In some embodiments, the CAR comprises a transmembrane domain fused to the extracellular domain of the CAR. In one embodiment, a transmembrane domain that is naturally associated with one of the domains of the CAR is used. In some examples, the transmembrane domain is selected or modified by amino acid substitution to avoid its binding to the transmembrane domain of the same or different surface membrane protein, minimizing interaction with other members of the receptor complex.

[0107] In some embodiments, the transmembrane domain is derived from either a natural or synthetic source. If the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions include those derived from (i.e., at least including) the alpha, beta or zeta chain of the T cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, ICOS or GITR or NKG2D, OX40, 2B4, DAP10, DAP12 or CD40. For T cells, CD8, CD28, CD3 epsilon may be preferred. For NK cells, NKG2D, DAP10, DAP12 may be preferred. The transmembrane domain may also be synthetic. In some embodiments, the transmembrane domain is derived from CD28, CD8, or CD3 zeta.

[0108] In some embodiments, a short oligo- or polypeptide linker, e.g., a linker between 2-10 amino acids in length, is present and forms the link between the transmembrane domain and the cytoplasmic signaling domain of the CAR.

[0109] CARs generally comprise at least one or more intracellular signaling components derived from, for example, the intracellular signaling domains of the TCR gamma, delta, epsilon or zeta chain of the T cell receptor, CD28, CD3 epsilon, CD3 zeta, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, ICOS or GITR or NKG2D, OX40, 2B4, DAP10, DAP12 or CD40. For T cells, CD8, CD28, CD3 epsilon may be preferred. For NK cells, NKG2D, DAP10, DAP12 may be preferred. First generation CARs typically had an intracellular domain derived from the CD3 zeta chain, which is the main transduction mechanism of signals from endogenous TCR. Second generation CARs typically further comprise intracellular signaling domains derived from various costimulatory protein receptors (e.g., CD28, 41BB (CD28), ICOS) at the cytoplasmic end of the CAR to provide additional signals to the T cells. Costimulatory domains include domains derived from human CD28, 4-1BB (CD137), ICOS-1, CD27, OX40 (CD137), DAP10, and GITR (AITR). Combinations of two costimulatory domains are contemplated, for example, CD28 and 4-1BB, or CD28 and OX40. In third generation CARs, the combination of multiple signaling domains, such as CD3 zeta-CD28-4-1BB or CD3 zeta-CD28-OX40, increases potency.

[0110] The intracellular signaling domain may be derived from an intracellular component of the TCR complex, such as the TCR CD3+ chain, e.g., the CD3 zeta chain, which mediates T cell activation and cytotoxicity. Alternative intracellular signaling domains include FcεRIy. The intracellular signaling domain may comprise a modified CD3 zeta polypeptide lacking one or two of its three immunoreceptor tyrosine-based activation motifs (ITAMs), the ITAMs being ITAM1, ITAM2, and ITAM3 (numbered from N-terminus to C-terminus). The mature region of CD3-zeta is residues 22-164 of SEQ ID NO: 7. ITAM1 is located around amino acid residues 61-89, ITAM2 is located around amino acid residues 100-128, and ITAM3 is located around residues 131-159. Thus, the modified CD3 zeta polypeptide may have any one of ITAM1, ITAM2, or ITAM3 inactivated. Alternatively, the modified CD3 zeta polypeptide may have any two ITAMs inactivated, such as ITAM2 and ITAM3, or ITAM1 and ITAM2. Preferably, ITAM3 is inactivated, such as deleted. More preferably, ITAM2 and ITAM3 are inactivated, such as deleted, and ITAM1 is left intact. For example, one modified CD3 zeta polypeptide retains only ITAM1, and the remaining CD3 zeta domain is deleted (residues 90-164). As another example, ITAM1 is replaced with the amino acid sequence of ITAM3, and the remaining CD3 zeta domain is deleted (residues 90-164). See, e.g., Bridgeman et al., Clin. Exp. Immunol. 175(2):258-67 (2014); Zhao et al., J. Immunol. 183(9):5563-74 (2009); Maus et al., WO 2018 / 132506; Sadelain et al., WO 2019 / 133969; Feucht et al., Nat Med. 25(1):82-88 (2019).

[0111] Thus, in some aspects, the antigen binding molecule is linked to one or more cell signaling modules. In some embodiments, the cell signaling module comprises a CD3 transmembrane domain, a CD3 intracellular signaling domain, and / or other CD transmembrane domains. The CAR may also further comprise portions of one or more additional molecules, such as Fc receptor gamma, CD8, CD4, CD25, or CD16.

[0112] In some embodiments, upon ligation of the CAR, the cytoplasmic or intracellular signaling domain of the CAR activates at least one of the normal effector functions or responses of the corresponding non-genetically engineered immune cell (typically a T cell). For example, the CAR can induce T cell function, such as cytolytic activity or T helper activity, secretion of cytokines or other factors.

[0113] In some embodiments, the intracellular signaling domain comprises the cytoplasmic sequence of a T cell receptor (TCR), and in some aspects, the cytoplasmic sequence of a co-receptor and / or variants of such molecules that act in concert with such receptors in their natural context to initiate signal transduction following antigen-specific receptor engagement, and / or any synthetic sequence having the same functional capability.

[0114] T cell activation has been described in some embodiments as mediated by two classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation via the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide secondary or costimulatory signals (secondary cytoplasmic signaling sequences). In some embodiments, a CAR comprises one or both of such signaling components.

[0115] In some aspects, the CAR comprises a primary cytoplasmic signaling sequence that regulates the primary activation of the TCR complex, either stimulatory or inhibitory. A primary cytoplasmic signaling sequence that acts in a stimulatory manner may comprise a signaling motif known as an immunoreceptor tyrosine-based activation motif or ITAM. Examples of ITAMs that comprise a primary cytoplasmic signaling sequence include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CDS, CD22, CD79a, CD79b, and CD66d. In some embodiments, the cytoplasmic signaling molecule of the CAR comprises a cytoplasmic signaling domain, a portion thereof, or a sequence derived from CD3 zeta.

[0116] CARs may also contain the signaling domain and / or transmembrane portion of a costimulatory receptor such as CD28, 4-1BB, OX40, DAP10, and ICOS. In some embodiments, the same CAR contains both an activating component and a costimulatory component, or alternatively, the activation domain is provided by one CAR and the costimulatory component is provided by another CAR that recognizes a different antigen.

[0117] The CAR or other antigen-specific receptor may also be an inhibitory CAR (e.g., iCAR), which contains an intracellular component that attenuates or suppresses a response, such as an immune response. Examples of such intracellular signaling components are those found in immune checkpoint molecules, including PD-1, CTLA4, LAG3, BTLA, OX2R, TIM-3, TIGIT, LAIR-1, PGE2 receptor, EP2 / 4 adenosine receptor, including A2AR. In some embodiments, the engineered cells contain an inhibitory CAR that contains a signaling domain of or derived from such an inhibitory molecule, so as to serve to attenuate the response of the cell. Such CARs are used, for example, to reduce the possibility of off-target effects, when the antigen recognized by the activating receptor, e.g., the CAR, is also expressed or can be expressed on the surface of normal cells.

[0118] TCR and its modified versions (e.g., Hi-TCR) In some embodiments, the antigen-specific receptor includes recombinant T cell receptors (TCRs) and / or TCRs cloned from naturally occurring T cells. Nucleic acids encoding TCRs can be obtained from a variety of sources, such as by amplifying naturally occurring TCR DNA sequences by polymerase chain reaction (PCR), followed by expression of the antibody variable regions, followed by selection for specific binding to the antigen. In some embodiments, the TCRs are obtained from T cells isolated from a patient, or from cultured T cell hybridomas. In some embodiments, TCR clones for target antigens have been generated in transgenic mice genetically engineered with human immune system genes (e.g., human leukocyte antigen system or HLA). See, e.g., tumor antigens (e.g., Parkhurst et al. (2009) Clin Cancer Res. 15:169-180 and Cohen et al. (2005) J Immunol. 175:5799-5808). In some embodiments, phage display is used to isolate TCRs against a target antigen (see, e.g., Varela-Rohena et al. (2008) Nat Med. 14:1390-1395 and Li (2005) Nat Biotechnol. 23:349-354). Engineered TCRs comprising one or more heterologous antigen binding domains (e.g., VH or fragments thereof or VL or fragments thereof) and a native TCR (alpha or beta) constant domain are described in WO 2019 / 157454, which are incorporated by reference in their entirety.

[0119] "T cell receptor" or "TCR" refers to a molecule that contains variable a and β chains (also known as TCRα and TCRβ, respectively) or variable γ and δ chains (also known as TCRγ and TCRδ, respectively) and is capable of specifically binding to an antigenic peptide bound to an MHC receptor. For example, a TCR or its extracellular antigen-binding domain may contain approximately 1×10 -7 Below, about 5×10 -8 Below, approximately 1×10 -8 Below, about 5×10 -9 Below, approximately 1×10-9 Below, about 5×10 -10 Below, approximately 1×10 -10 Below, about 5×10 -11 Below, approximately 1×10 -11 Below, about 5×10 -12 Less than or equal to about 1×10 -12 It binds to antigen with KD affinity of 0.01 to 0.01. In some embodiments, the TCR is in αβ form. TCRs, which typically exist in αβ and γδ forms, are generally structurally similar, although the T cells expressing them may have different anatomical locations or functions. TCRs may be found on the cell surface or in soluble form. Generally, TCRs are found on the surface of T cells (or T lymphocytes), where they are generally involved in the recognition of antigens bound to major histocompatibility complex (MHC) molecules. Also, in some embodiments, the TCR may comprise a constant domain, a transmembrane domain, and / or a short cytoplasmic tail (see, e.g., Janeway et al., Immunobiology: The Immune System in Health and Disease, 3rd Edition, Current Biology Publications, 4:33, 1997). For example, in some aspects, each chain of the TCR may have one N-terminal immunoglobulin variable domain, one immunoglobulin constant domain, a transmembrane region, and a short cytoplasmic tail at the C-terminus. In some embodiments, the TCR is associated with the invariant protein of the CD3 complex, which is involved in mediating signal transduction. Unless otherwise stated, the term "TCR" should be understood to encompass functional TCR fragments thereof. The term also encompasses intact or full-length TCRs, including αβ or γδ forms of TCRs.

[0120] Thus, for purposes of this specification, reference to a TCR includes any TCR or functional fragment, such as an antigen-binding portion of a TCR that binds to a specific antigenic peptide bound to an MHC molecule, i.e., an MHC-peptide complex. The term "TCR", as used herein, also refers to a TCR that has been modified to include an antibody VH and / or VL. An "antigen-binding portion" or "antigen-binding fragment" of a TCR may be used interchangeably and refers to a molecule that includes a portion of the structural domain of a TCR but binds to the antigen (e.g., an MHC-peptide complex) that a full-length TCR binds. In some cases, the antigen-binding portion generally includes sufficient variable domains of the TCR, such as the variable a and variable β chains of the TCR, to form a binding site for binding to a specific MHC-peptide complex, such as each chain including three complementarity determining regions.

[0121] In some embodiments, the variable domains of the TCR chains associate with loops, i.e., complementarity determining regions (CDRs) similar to immunoglobulins, that confer antigen recognition and form the binding site of the TCR molecule, thereby determining peptide specificity. Typically, as in immunoglobulins, the CDRs are separated by framework regions (FRs) (see, e.g., Jores et al., Pwc. Nat'lAcad. Sci. USA 87:9138, 1990; Chothia et al., EMBO J. 7:3745, 1988; see also Lefranc et al., Dev. Comp. Immunol. 27:55, 2003). In some embodiments, CDR3 is the main CDR involved in recognition of processed antigens, although CDR1 of the alpha chain has also been shown to interact with the N-terminal portion of antigenic peptides, and CDR1 of the beta chain interacts with the C-terminal portion of peptides. CDR2 is believed to recognize MHC molecules. In some embodiments, the variable region of the β chain may contain an additional hypervariable (HV4) region.

[0122] The engineered TCR may comprise (a) typically an antigen-binding fragment as well as an antibody fragment (examples of antibody fragments include, but are not limited to, Fv, Fab, Fab', Fab'-SH, F(ab')2; diabodies; linear antibodies; variable heavy chain (VH) regions, VHH antibodies, single chain antibody molecules such as scFv, and single domain antibodies; as well as multispecific antibodies formed from antibody fragments), in particular the extracellular domain including all three CDRs of the antibody, e.g. the heavy chain variable region (VH) and / or the light chain variable region (VL), and (b) a native or variant constant region of the alpha, beta, gamma or delta chain. Thus, the engineered TCR may comprise one or more antigen-binding domains fused to one or both of TRAC or TRBC or fragments or variants thereof as described herein. As already defined, the antigen-binding domain may be a VH, a VL, a single domain antibody, e.g. a VHH or nanobody, or an scFv or any multispecific antibody formed from an antibody fragment as described herein. In embodiments, it is contemplated herein that one antigen binding domain binds to TRAC (or a fragment or variant thereof) and one antigen binding domain binds to TRBC (or a fragment or variant thereof), and both antigen binding domains may be the same or different. They may or may not have the same specificity (bind to the same antigen or the same epitope).In some embodiments, the modified TCR comprises one or more heterologous polypeptides, such as (a) a VH or fragment of an antibody having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 98% sequence identity thereto (and preferably at least 60%, 65%, 70%, 75%, 80%, 85% identity to all three CDRs or parent CDRs), fused to TRBC1 (SEQ ID NO: 5) or TRBC2 (SEQ ID NO: 6) or a fragment or variant of TRBC1 (SEQ ID NO: 5), TRBC2 (SEQ ID NO: 6) or murine versions thereof (SEQ ID NOs: 28-29) having at least 90% sequence identity thereto. , 90%, 95% or 98% identical CDRs) and (b) antibody VL or fragment or variants thereof having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 98% sequence identity thereto (and preferably containing all three CDRs or CDRs at least 90% identical to the parent CDRs) fused to TRAC (SEQ ID NO: 4), a fragment or variant of TRAC (SEQ ID NO: 4) having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 98% sequence identity thereto, or a murine version thereof (SEQ ID NOs: 30-31). See FIG. 1A. The modified TCR may optionally further comprise a native or variant CD3 zeta polypeptide, such as a modified CD3 zeta polypeptide (SEQ ID NO: 7) in which one or two ITAM domains (e.g., ITAM2 and ITAM3) have been deleted. See Figure 1B.

[0123] In some designs, the HI-TCR comprises: (a) a chimeric TCR alpha chain comprising an antigen binding domain or fragment thereof, e.g., a VH or fragment thereof, fused to a native or variant TRAC or fragment thereof, optionally where 1-3 amino acids of the VH (or TRAC) have been removed; and (b) a chimeric TCR beta chain comprising an antigen binding domain or fragment thereof, e.g., a VL or fragment thereof, fused to a native or variant TRAC or fragment thereof, optionally where 1-3 amino acids of the VL (or TRAC) have been removed. In another design, the HI-TCR comprises (a) a chimeric TCR alpha chain comprising an antigen binding domain or fragment thereof, e.g., a VL or fragment thereof, fused to a native or variant TRAC or fragment thereof, optionally where 1-3 amino acids of the VL (or TRAC) have been removed, and (b) a chimeric TCR beta chain comprising an antigen binding domain or fragment thereof, e.g., a VH or fragment thereof, fused to a native or variant TRBC or fragment thereof, optionally where 1-3 amino acids of the VH (or TRBC) have been removed. In yet another design, the HI-TCR comprises only the antigen binding domain or fragment thereof, e.g., a scFv, VHH, VH or fragment thereof, fused to a native or variant TRAC or fragment thereof, or fused to a native or variant TRBC or fragment thereof, optionally where 1-3 amino acids of the VH (or TRAC or TRBC) have been removed. HI-TCRs (HIT-CARs) are described in WO 2019 / 157454, the entirety of which is incorporated herein by reference. Recombinant HLA-independent (or non-HLA-restricted) modified TCRs (referred to as "HI-TCRs") that bind to an antigen of interest in an HLA-independent manner are described in WO 2019 / 157454. Such HI-TCRs comprise an antigen-binding chain comprising: (a) a heterologous antigen-binding domain, e.g., an antigen-binding fragment of an immunoglobulin variable region, that binds to an antigen in an HLA-independent manner; and (b) a constant domain capable of associating with (and thus activating) a CD3 zeta polypeptide. Preferably, the antigen-binding domain or fragment thereof comprises: (i) a heavy chain variable region (VH) of an antibody and / or (ii) a light chain variable region (VL) of an antibody.The constant domain of the TCR includes, for example, a native or modified TRAC polypeptide (SEQ ID NO: 4 or a variant thereof), or a native or modified TRBC polypeptide (SEQ ID NO: 5 or 6 or a variant thereof). The constant domain of the TCR is, for example, a native TCR constant domain (alpha or beta) or a fragment thereof.

[0124] In certain embodiments, the extracellular antigen-binding domain comprises the heavy chain variable region (V H ) and / or the light chain variable region (V L ), where V H Or V L can dimerize with another extracellular antigen-binding domain, including a VL or a VH (e.g., to form a fragment variable (Fv)). In certain embodiments, the Fv is a human Fv. In certain embodiments, the Fv is a humanized Fv. In certain embodiments, the Fv is a murine Fv. In certain embodiments, the Fv is identified by screening an Fv phage library that contains antigen-Fc fusion proteins.

[0125] Additional extracellular antigen-binding domains targeting an antigen of interest can be obtained by sequencing existing scFv or Fab regions of existing antibodies targeting the same antigen.

[0126] In certain embodiments, the dimerized extracellular antigen-binding domain of the HI-TCR of the present disclosure is a mouse Fv. In certain embodiments, the dimerized extracellular antigen-binding domain is an Fv that binds to a previously defined human tumor antigen.

[0127] In certain embodiments, the extracellular antigen-binding domain is an Fv and specifically binds to a human CD19 polypeptide (e.g., a human CD19 polypeptide).

[0128] In certain embodiments, the Fv comprises a heavy chain variable region (V HIn certain embodiments, the Fv comprises a light chain variable region (V) comprising the amino acid sequence set forth in SEQ ID NO: 37 or 40. L In certain embodiments, the Fv comprises a V comprising the amino acid sequence set forth in SEQ ID NO: 36 or 40. H and V comprising the amino acid sequence set forth in SEQ ID NO: 37 or 41. L In certain embodiments, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80% (e.g., at least about 85%, at least about 90%, or at least about 95%) homologous or identical to SEQ ID NO: 36 or 40. H For example, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to SEQ ID NO:7. H In certain embodiments, the extracellular antigen-binding domain comprises a V H In certain embodiments, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80% (e.g., at least about 85%, at least about 90%, or at least about 95%) homologous to SEQ ID NO: 37 or 41. L For example, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to SEQ ID NO: 37 or 41. L In certain embodiments, the extracellular antigen-binding domain comprises a V L In certain embodiments, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80% (e.g., at least about 85%, at least about 90%, or at least about 95%) homologous to SEQ ID NO: 36 or 40. Hand V comprising an amino acid sequence that is at least about 80% (e.g., at least about 85%, at least about 90%, or at least about 95%) homologous or identical to SEQ ID NO: 37 or 41. L In certain embodiments, the extracellular antigen-binding domain comprises a V H and V comprising the amino acid sequence set forth in SEQ ID NO: 37 or 41 L Each of these includes

[0129] In certain embodiments, the extracellular antigen-binding domain is an Fv and specifically binds to a human PSMA polypeptide (e.g., a human PSMA polypeptide).

[0130] In certain embodiments, the Fv comprises a heavy chain variable region (V H In certain embodiments, the Fv comprises a light chain variable region (V) comprising the amino acid sequence set forth in SEQ ID NO:45. L In certain embodiments, the Fv comprises a V comprising the amino acid sequence set forth in SEQ ID NO:44. H and V comprising the amino acid sequence set forth in SEQ ID NO:45. L In certain embodiments, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80% (e.g., at least about 85%, at least about 90%, or at least about 95%) homologous or identical to SEQ ID NO:44. H For example, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to SEQ ID NO:44. H In certain embodiments, the extracellular antigen-binding domain comprises a V HIn certain embodiments, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80% (e.g., at least about 85%, at least about 90%, or at least about 95%) homologous to SEQ ID NO:45. L For example, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to SEQ ID NO:45. L In certain embodiments, the extracellular antigen-binding domain comprises a V L In certain embodiments, the extracellular antigen-binding domain comprises a V that comprises an amino acid sequence that is at least about 80% (e.g., at least about 85%, at least about 90%, or at least about 95%) homologous to SEQ ID NO:44. H and V comprising an amino acid sequence that is at least about 80% (e.g., at least about 85%, at least about 90%, or at least about 95%) homologous or identical to SEQ ID NO:45. L In certain embodiments, the extracellular antigen-binding domain comprises a V H and V comprising the amino acid sequence set forth in SEQ ID NO:45 L Each of these includes

[0131] Unlike chimeric antigen receptors, which typically contain an intracellular signaling domain themselves, HI-TCRs do not directly generate an activation signal; instead, the antigen-binding chain associates with the CD3 zeta polypeptide (SEQ ID NO: 7) and is activated as a result. Immune cells containing recombinant TCRs provide superior activity when the antigen has a low density at the cell surface, such as less than about 10,000 molecules per cell, e.g., less than about 5,000, 4,000, 3,000, 2,000, 1,000, 500, 250, or 100 molecules per cell. In some embodiments, the antigen is expressed by the target cell at a low density, e.g., less than about 6,000 molecules of target antigen per cell. In some embodiments, the antigen is expressed at a density of less than about 5,000, less than about 4,000, less than about 3,000, less than about 2,000, less than about 1,000, or less than about 500 molecules of target antigen per cell. In some embodiments, the antigen is expressed at a density of less than about 2,000 molecules of target antigen per cell, e.g., less than about 1,800, less than about 1,600, less than about 1,400, less than about 1,200, less than about 1,000, less than about 800, less than about 600, less than about 400, less than about 200, or less than about 100, etc. In some embodiments, the antigen is expressed at a density of less than about 1,000 molecules of target antigen per cell, e.g., less than about 900, less than about 800, less than about 700, less than about 600, less than about 500, less than about 400, less than about 300, less than about 200, or less than about 100, etc. In some embodiments, the antigen is expressed at a density ranging from about 5,000 to about 100 molecules of target antigen per cell, e.g., about 5,000 to about 1,000 molecules of target antigen per cell, about 4,000 to about 2,000 molecules, about 3,000 to about 2,000 molecules, about 4,000 to about 3,000 molecules, about 3,000 to about 1,000 molecules, about 2,000 to about 1,000 molecules, about 1,000 to about 500 molecules, about 500 to about 100 molecules, etc. In some embodiments, recombinant TCR T cell therapy targets an antigen that is expressed at a lower density compared to the density in wild type cells.

[0132] The CD3 zeta polypeptide optionally comprises an intracellular domain of a costimulatory molecule or a fragment thereof. Alternatively, the antigen binding domain optionally comprises a costimulatory domain capable of stimulating an immunoresponsive cell upon binding of the antigen binding chain to an antigen. Examples of costimulatory domains include stimulatory domains from CD28 (SEQ ID NO:8-9), 4-1BB (CD137) (SEQ ID NO:10-11), ICOS (SEQ ID NO:12), CD27, OX 40 (CD134) (SEQ ID NO:13), DAP10, DAP12, 2B4, CD40, FCER1G or GITR (AITR) or fragments or variants thereof. For T cells, CD28, CD27, 4-1BB (CD137), ICOS may be preferred. For NK cells, DAP10, DAP12, 2B4 may be preferred. Combinations of two costimulatory domains are contemplated, such as CD28 and 4-1BB or CD28 and OX40.

[0133] The aforementioned modified immune cells expressing an antigen-specific receptor, e.g., a modified TCR, preferably have one or more further properties as described herein: inactivation (e.g., mutation or inhibition) of the SUV39H1 gene and / or inactivation of one or two ITAM domains of the CD3 zeta intracellular signaling region of the antigen-specific receptor, and / or inactivation of one or both endogenous TCR chains (e.g., deletion or disruption of endogenous TCR alpha and / or TCR beta), and / or addition of a costimulatory receptor, or a combination of one, two, three or all of such properties.

[0134] In some embodiments, the TCR chain contains a constant domain. For example, like an immunoglobulin, the extracellular portion of a TCR chain (e.g., α chain, β chain) may contain two immunoglobulin domains, an N-terminal variable domain (e.g., Vα or Vβ, typically amino acids 1-116 according to Kabat numbering in Kabat et al., "Sequences of Proteins of Immunological Interest", US Dept. Health and Human Services, Public Health Service National Institutes of Health, 5th ed., 1991), and one constant domain adjacent to the cell membrane (e.g., α chain constant domain or Cα, typically amino acids 117-259 according to Kabat, or β chain constant domain or Cβ, typically amino acids 117-295 according to Kabat). For example, in some cases, the extracellular portion of the TCR formed by the two chains contains two membrane-proximal constant domains and two membrane-distal variable domains that include the CDRs. The constant domain of the TCR domain contains a short chain connector sequence in which cysteine ​​residues form disulfide bonds to create a link between the two chains, in some embodiments, the TCR may have an additional cysteine ​​residue in each of the α and β chains such that the TCR contains two disulfide bonds in the constant domain.

[0135] In some embodiments, the TCR chain may include a transmembrane domain. In some embodiments, the transmembrane domain is positively charged. In some cases, the TCR chain includes a cytoplasmic tail. In some cases, the structure allows the TCR to associate with other molecules, such as CD3. For example, a TCR that includes a constant domain with a transmembrane region can tether the protein to the cell membrane and associate with the invariant subunit of the CD3 signaling machinery or complex.

[0136] Generally, CD3 is a multiprotein complex that may have three distinct chains (γ, δ, and ε) and a ζ chain in mammals. For example, in mammals, the complex may include a homodimer of CD3 gamma chain, CD3 delta chain, two CD3 epsilon chains, and CD3 zeta chain. CD3 gamma, CD3 delta, and CD3 epsilon chains are highly related cell surface proteins of the immunoglobulin superfamily that contain a single immunoglobulin domain. The transmembrane regions of CD3 gamma, CD3 delta, and CD3 epsilon chains are negatively charged, a feature that allows these chains to associate with the positively charged T cell receptor chains. The intracellular tails of CD3 gamma, CD3 delta, and CD3 epsilon chains each contain a single conserved motif known as an immunoreceptor tyrosine-based activation motif or ITAM, although each CD3 zeta chain has three. Generally, ITAMs are involved in the signaling capacity of the TCR complex. These accessory molecules have negatively charged transmembrane regions and are responsible for propagating signals from the TCR into the cell. The CD3 gamma, delta, epsilon, and zeta chains, together with the TCR, form what is known as the T cell receptor complex.

[0137] In some embodiments, the TCR may be a heterodimer of two chains, alpha and beta (optionally gamma and delta), or the TCR may be a single chain TCR construct. In some embodiments, the TCR is a heterodimer comprising two separate chains (alpha and beta chains or gamma and delta chains) linked by one or more disulfide bonds. Variants of TCRs are disclosed in WO 2018 / 067993 and Baeuerle et al., Synthetic TRuC receptors engaging the complete T cell receptor for potent anti-tumor response. Nat Commun 10, 2087 (2019), which are incorporated by reference in their entireties. For example, any one or more of the alpha, beta, gamma or epsilon chains may be fused to the VH and / or VL of an antibody variable region, such as an scFv.

[0138] Exemplary antigen-specific receptors, including CARs and recombinant TCRs, and methods for genetically engineering and introducing receptors into cells include those described in, for example, WO 200014257, WO 2013126726, WO 2012 / 129514, WO 2014031687, WO 2013 / 166321, WO 2013 / 071154, WO 2013 / 123061, U.S. Patent Application No. 2002131960, U.S. Patent Application No. 2013287748, U.S. Patent Application Publication ... Nos. 130149337, 6,451,995, 7,446,190, 8,252,592, 8,339,645, 8,398,282, 7,446,179, 6,410,319, 7,070,995, 7,265,209, 7,354,762, 7,446,191, 8,324,353, and 8,479,118, as well as European Patent Application No. 2537416, and / or Sadelain et al., Cancer Discov. April 2013, 3(4):388-398; Davila et al. (2013) PLoS ONE 8(4):e61338; Turtle et al., Curr. Opin. Immunol., October 2012, 24(5):633-39; Wu et al., Cancer, March 2012, 18(2):160-75. In some aspects, antigen-specific receptors include CARs as described in U.S. Pat. No. 7,446,190 and those described in WO2014056668.

[0139] Costimulatory Ligands and Receptors The cells of the present disclosure having altered SUV39H1 expression may further comprise at least one, or at least two, exogenous costimulatory ligands.

[0140] In certain embodiments, the immune cells include an exogenous or recombinant costimulatory ligand (e.g., the cells are transduced with at least one costimulatory ligand). In certain embodiments, the immune cells co-express a CAR or an exogenous TCR (including a modified TCR) and at least one exogenous costimulatory ligand. The interaction between the CAR or modified TCR and at least one exogenous costimulatory ligand provides a non-antigen-specific signal that is important for the complete activation of immune responsive cells (e.g., T cells). Costimulatory ligands include, but are not limited to, members of the tumor necrosis factor (TNF) superfamily and immunoglobulin (Ig) superfamily ligands. TNF is a cytokine involved in systemic inflammation and stimulates the acute phase response. Its main role is in regulating immune cells. Members of the TNF superfamily share many common characteristics. Most TNF superfamily members are synthesized as type II transmembrane proteins (extracellular C-terminus) that contain a short cytoplasmic segment and a relatively long extracellular region. TNF superfamily members include, but are not limited to, nerve growth factor (NGF), CD40L (CD40L) / CD154, CD137L / 4-1BBL, TNF-a, CD134L / OX40L / CD252, CD27L / CD70, Fas Ligand (FasL), CD30L / CD153, tumor necrosis factor beta (TNFP) / lymphotoxin-alpha (LTa), lymphotoxin beta (TTb), CD257 / B cell activating factor (BAFF) / Blys / THANK / Tall-1, glucocorticoid-inducible TNF receptor ligand (GITRL) and TNF-related apoptosis-inducing ligand (TRAIL), LIGHT (TNFSF14). The immunoglobulin (Ig) superfamily is a large group of cell surface and soluble proteins involved in cell recognition, binding or adhesion processes. These proteins share structural characteristics with immunoglobulins - the immunoglobulin domain (fold). Immunoglobulin superfamily ligands include, but are not limited to, CD80 and CD86, both of which are ligands for CD28.In certain embodiments, at least one costimulatory ligand is selected from the group consisting of 4-1BBL, CD275, CD80, CD86, CD70, OX40L, CD48, TNFRSF14, and combinations thereof. In certain embodiments, the immunoresponsive cell comprises or comprises an exogenous or recombinant costimulatory ligand. In certain embodiments, one exogenous or recombinant costimulatory ligand is 4-1BBL or CD80. In certain embodiments, one exogenous or recombinant costimulatory ligand is 4-1BBL. In certain embodiments, the immunoresponsive cell comprises or comprises two exogenous or recombinant costimulatory ligands. In certain embodiments, the two exogenous or recombinant costimulatory ligands are 4-1BBL and CD80.

[0141] In certain embodiments, the immunoresponsive cells may comprise or be transduced with at least one chimeric costimulatory receptor (CCR). As used herein, the term "chimeric costimulatory receptor" or "CCR" refers to a chimeric receptor that binds to an antigen and provides a costimulatory signal to a cell (e.g., a T cell) that contains the CCR upon its binding to the antigen, but does not by itself provide an activation signal to the cell. CCRs are described in Krause et al., J. Exp. Med. (1998); 188(4):619-626 and US Patent Application 20020018783, which are incorporated by reference in their entirety. CCRs mimic costimulatory signals, but unlike CARs, do not provide T cell activation signals, e.g., CCRs lack the E03z polypeptide. CCRs provide costimulation, e.g., CD284ike signals, in the absence of natural costimulatory ligands on antigen-presenting cells. Combinatorial antigen recognition, i.e., the use of CCRs in combination with CARs, can enhance T cell reactivity against dual antigen-expressing T cells, thereby improving selective tumor targeting. See WO 2014 / 055668, incorporated by reference in its entirety. Kloss et al. described a strategy that integrates combinatorial antigen recognition, split signaling, and, crucially, the balanced strength of T cell activation and costimulation to generate T cells that eliminate target cells expressing a combination of antigens while sparing cells expressing each antigen individually (Kloss et al., Nature Biotechnology (2013); 31(1): 71-75, the contents of which are incorporated by reference in their entirety). Using this approach, T cell activation requires CAR-mediated recognition of one antigen, while costimulation is independently mediated by a CCR specific for the second antigen. To achieve tumor selectivity, combinatorial antigen recognition approaches reduce the efficiency of T cell activation to levels that are ineffective without rescue provided by simultaneous CCR recognition of a second antigen. In certain embodiments, the CCR comprises an extracellular antigen-binding domain that binds to a second antigen, a transmembrane domain, and a costimulatory signaling region that comprises at least one costimulatory molecule.In certain embodiments, the CCR does not deliver an activation signal to the cell by itself. Non-limiting examples of costimulatory molecules include CD28, 4-1BB, OX40, ICOS, DAP-10, and any combination thereof. In certain embodiments, the costimulatory signaling region of the CCR comprises one costimulatory signaling molecule. In certain embodiments, the one costimulatory signaling molecule is CD28. In certain embodiments, the one costimulatory signaling molecule is 4-1BB. In certain embodiments, the costimulatory signaling region of the CCR comprises two costimulatory signaling molecules. In certain embodiments, the two costimulatory signaling molecules are CD28 and 4-1BB. The second antigen is selected such that the expression of both the first antigen and the second antigen is restricted to the target cell (e.g., cancerous tissue or cell). Similar to the CAR, the extracellular antigen binding domain may be a fusion protein comprising a scFv, Fab, F(ab)2, or a heterologous sequence forming the extracellular antigen binding domain. In certain embodiments, the CCR is co-expressed with a modified TCR that binds an antigen different from the antigen to which the CAR or CCR binds, e.g., the CAR or modified TCR binds a first antigen and the CCR binds a second antigen.

[0142] Examples of costimulatory ligands, molecules and receptors (or fusion polypeptides) are disclosed in WO 2021 / 016174, which is incorporated by reference in its entirety. Exemplary booster sequences include SEQ ID NOs: 32-33 and 53-54.

[0143] antigen The antigens targeted by the antigen-specific receptors are those expressed in the context of the disease, condition, or cell type targeted by adoptive cell therapy. Diseases and conditions include proliferative, neoplastic, and malignant diseases and disorders, particularly cancer. Infectious and autoimmune diseases, inflammatory or allergic diseases are also contemplated.

[0144] The cancer may be a solid cancer or a "liquid tumor," such as cancers that affect the blood, bone marrow, and lymphatic system, also known as tumors of hematopoietic and lymphatic tissues, including, among others, leukemias and lymphomas, such as acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), and chronic lymphocytic leukemia (CLL), including various lymphomas such as mantle cell lymphoma, non-Hodgkin's lymphoma (NHL), adenomas, squamous cell carcinoma, laryngeal carcinoma, gallbladder and bile duct carcinoma, and cancers of the retina, such as retinoblastoma.

[0145] Solid cancers include, inter alia, cancers affecting one of the organs selected from the group consisting of colon, rectum, skin, endometrium, lung (including non-small cell lung cancer), uterus, bone (such as osteosarcoma, chondrosarcoma, Ewing's sarcoma, fibrosarcoma, giant cell tumor, adamantinoma, and chordoma), liver, kidney, esophagus, stomach, bladder, pancreas, cervix, brain (such as meningiomas, neuroblastomas, low-grade astrocytomas, oligodendrocytomas, pituitary tumors, schwannomas, and metastatic brain cancer), ovaries, breast, head and neck region, testes, prostate, and thyroid.

[0146] Preferably, the cancer according to the present disclosure is a cancer affecting the blood, bone marrow, and lymphatic system, as described above, hi some embodiments, the cancer is or is associated with multiple myeloma.

[0147] Diseases according to the present disclosure also include, but are not limited to, infectious diseases or conditions such as viral, retroviral, bacterial, and protozoal infections, HIV immunodeficiency, cytomegalovirus (CMV), Epstein-Barr virus (EBV), adenovirus, BK polyomavirus, and the like.

[0148] Diseases according to the present disclosure also include autoimmune or inflammatory diseases or conditions such as arthritis, e.g., rheumatoid arthritis (RA), type I diabetes, systemic lupus erythematosus (SLE), inflammatory bowel disease, psoriasis, scleroderma, autoimmune thyroid disease, Graves' disease, Crohn's disease, multiple sclerosis, asthma, and / or transplant-associated diseases or conditions. In such situations, the regulatory T cells may be cells in which SUV39H1 has been knocked out.

[0149] In some embodiments, the antigen is a polypeptide. In some embodiments, the antigen is a carbohydrate or other molecule. In some embodiments, the antigen is selectively expressed or overexpressed on diseased or condition cells, e.g., tumor or pathogenic cells, compared to normal or non-target cells or tissues. In other embodiments, the antigen is expressed on normal cells and / or expressed on genetically engineered cells. In some such embodiments, multiple targeting and / or gene disruption approaches as provided herein are used to improve specificity and / or efficacy. Any tumor antigen (antigenic peptide) may be used, as antigens targeted by antigen-specific receptors in the context of proliferative, neoplastic, and malignant diseases and disorders, particularly cancer. Sources of antigens include, but are not limited to, cancer proteins. Antigens may be expressed as peptides or as intact proteins or portions thereof. The intact proteins or portions thereof may be natural or mutagenized.

[0150] In some embodiments, the antigen is a universal tumor antigen. The term "universal tumor antigen" generally refers to an immunogenic molecule, such as a protein, that is expressed at a higher level in tumor cells than in non-tumor cells and is also expressed in tumors of different origin. In some embodiments, the universal tumor antigen is expressed in more than 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, or more of human cancers. In some embodiments, the universal tumor antigen is expressed in at least three, at least four, at least five, at least six, at least seven, at least eight, or more different types of tumors. In some cases, the universal tumor antigen may be expressed in non-tumor cells, such as normal cells, but at a lower level than expressed in tumor cells. In some cases, the universal tumor antigen is not expressed at all in non-tumor cells, such as not expressed in normal cells. Exemplary universal tumor antigens include, for example, human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B1 (CYP1B), HER2 / neu, p95HER2, Wilms tumor gene 1 (WT1), livin, alpha fetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate specific membrane antigen (PSMA), p53, or cyclin (D1).

[0151] In some aspects, the antigen is expressed in multiple myeloma, such as CD38, CD138, and / or CS-1. Other exemplary multiple myeloma antigens include CD56, TIM-3, CD33, CD123, and / or CD44. Antibodies or antigen-binding fragments against such antigens are known, including those described in, for example, U.S. Pat. No. 8,153,765, U.S. Pat. No. 8,603477, U.S. Pat. No. 8,008,450, U.S. Patent Publication No. 20120189622, and WO 2006099875, WO 2009080829, or WO 2012092612. In some embodiments, such antibodies or their antigen-binding fragments (e.g., scFv) can be used to generate CARs or engineered TCRs (Hi-TCRs).

[0152] In some embodiments, the antigen may be one that is expressed or upregulated on cancer or tumor cells, but may also be expressed on immune cells, such as resting or activated T cells. For example, in some cases, expression of hTERT, survivin, and other universal tumor antigens has been reported to be present on lymphocytes, including activated T lymphocytes (see, e.g., Weng et al. (1996) J Exp. Med. 183:2471-2479; Hathcock et al. (1998) J Immunol 160:5702-5706; Liu et al. (1999) Proc. Natl Acad Sci. 96:5147-5152; Turksma et al. (2013) Journal of Translational Medicine 11:152). Similarly, in some cases, CD38 and other tumor antigens may also be expressed on immune cells, such as T cells, such as being upregulated on activated T cells. For example, in some embodiments, CD38 is a known T cell activation marker.

[0153] In some embodiments, the cancer is accompanied or associated with overexpression of HER2 or p95HER2, a constitutively active C-terminal fragment of HER2 produced by alternative translation initiation at methionine 611 of the transcript encoding the full-length HER2 receptor. The amino acid sequence of the p95HER2 extracellular domain is MPIWKFPDEEGACQPCPINCTHSCVDKDDKGCPAEQRASPLT.

[0154] HER2 or p95HER2 has been reported to be overexpressed in breast cancer, as well as gastric (stomach), gastroesophageal, esophageal, ovarian, endometrial, cervical, colon, bladder, lung, and head and neck cancers. Patients with cancers that express the p95HER2 fragment are more likely to develop metastases and have a poorer prognosis than those that predominantly express the intact form of HER2. Saez et al., Clinical Cancer Research, 12:424-431 (2006).

[0155] Antibodies capable of specifically binding to p95HER2 relative to HER2 (i.e., bind to p95HER2 but do not significantly bind to the full-length HER2 receptor) are disclosed in Sperinde et al., Clin. Cancer Res. 16:4226-4235 (2010) and U.S. Patent Application Publication No. 2013 / 0316380, which are incorporated herein by reference in their entireties. Hybridomas producing monoclonal antibodies capable of specifically binding to p95HER2 relative to HER2 are disclosed in WO 2010 / 000565 and Parra-Palau et al., Cancer Res. 70:8537-8546 (2010). Exemplary CARs include 10 -7 M or less, 10 -8 M or less, 10 -9 M or less, or 10 -10It binds to the epitope PIWKFPD of p95HER2 with a binding affinity KD of less than or equal to M. In some embodiments, a CAR or modified TCR as described herein (e.g., Hi-TCR) comprises a VH / VL sequence as described in WO2021239965.

[0156] The modified immune cells, compositions and methods disclosed herein optionally include a modified TCR, such as a Hi-TCR, disclosed herein, in which the SUV39H1 gene has been inactivated, and / or: a) a TCR that is specifically targeted to a target antigen, e.g., at a concentration of about 10 -7 M or less, or about 10 -8 M or less, or about 10 -9 M or less, or about 10 -10 The present invention includes cells expressing a chimeric antigen receptor (CAR) comprising: a) an extracellular antigen-binding domain that specifically binds with a binding affinity of M or less; b) a transmembrane domain; c) optionally, one or more costimulatory domains; and d) an intracellular signaling domain comprising a modified CD3 zeta intracellular signaling domain that retains a single active ITAM. This can be achieved by any means known in the art, for example, ITAM2 and ITAM3 are inactivated, or ITAM1 and ITAM2 are inactivated. For example, the modified CD3 zeta polypeptide retains only ITAM1, and the remaining CD3 zeta domain is deleted (residues 90-164). As another example, ITAM1 is replaced with the amino acid sequence of ITAM3, and the remaining CD3 zeta domain is deleted (residues 90-164).

[0157] Rius Ruiz et al., Sci. Transl. Med. vol. 10, eaat1445 (2018) and US Patent Publication No. 2018 / 0118849, which are incorporated herein by reference in their entirety, describe a T cell bispecific antibody that specifically binds to the epitope PIWKFPD of p95HER2 and the CD3 epsilon chain of the TCR. The antibody, named p95HER2-TCB, is composed of an asymmetric two-arm immunoglobulin G1 (IgG1) that binds monovalently to CD3 epsilon and bivalently to p95HER2. The bispecific antibody has a low monovalent affinity for CD3 epsilon, about 70-100 nM, thereby reducing the chance of non-specific activation, and a high bivalent affinity for p95HER2, about 9 nM.

[0158] In the case where the antigen-specific receptor specifically binds p95HER2, the present disclosure provides engineered immune cells that are further engineered to secrete a soluble (non-membrane bound) bispecific antibody, e.g., a BiTE (bispecific soluble antibody), that binds both HER2 and a T cell activation antigen, e.g., CD3 epsilon or the constant chain (alpha or beta) of the TCR. Expressing a bispecific antibody can treat heterogeneous tumors that express both p95HER and HER2, and / or mitigate the effects of potential tumor cell escape through p95HER2 antigen reduction following treatment with CAR-T cells targeting p95HER2. See, e.g., Choi et al., "CAR-Tcells secreting BiTEs circumvent antigen escape without detectable toxicity," Nature Biotechnology, 37:1049-1058 (2019).

[0159] In some embodiments as provided herein, immune cells such as T cells may be genetically engineered such that the gene encoding the antigen is silenced or destroyed in the immune cell, such that the expressed antigen-specific receptor does not specifically bind to the antigen in the context of its expression on the immune cell itself. Thus, in some aspects, this can avoid off-target effects, such as binding of engineered immune cells to themselves, which may reduce the efficacy of the genetic engineering in the immune cells, for example in the context of adoptive cell therapy.

[0160] In some embodiments, such as in the case of inhibitory CARs, the target is an off-target marker, such as an antigen that is not expressed on diseased or targeted cells, but is expressed on normal or non-diseased cells that also express a disease-specific target that is targeted by an activation or stimulatory receptor of the same engineered cell. Exemplary such antigens are MHC molecules, such as MHC class I molecules, for example, associated with the treatment of a disease or condition in which such molecules are downregulated but maintained expressed in non-target cells.

[0161] In some embodiments, the engineered immune cells may comprise an antigen-specific receptor (e.g., a CAR and / or a Hi-TCR) that targets one or more other antigens. In some embodiments, the one or more other antigens are tumor antigens or cancer markers. Other antigens targeted by antigen-specific receptors on the provided immune cells, in some embodiments, include orphan tyrosine kinase receptor ROR1, tEGFR, Her2, p95HER2, LI-CAM, CD19, CD20, CD22, mesothelin, CEA, claudin 18.2, and hepatitis B surface antigen, antifolate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, EPHa2, ErbB2, ErbB3, or ErbB4, FBP, FcRH5, fetal acetylcholine e receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, L1-cell adhesion molecule, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D ligand, NY-ESO-1, MART-1, gplOO, oncofetal antigen, ROR1, TAG72, VEGF-R2, carcinoembryonic antigen (CEA), prostate specific antigen, PSMA, Her2 / neu, p95HER2, estrogen receptor, progesterone receptor, ephrin B2, CD123, CS-1, c-Met, GD-2, and cyclins such as MAGE A3, CE7, Wilms' tumor 1 (WT-1), cyclin A1 (CCNA1), and / or biotinylated molecules, and / or molecules expressed by HIV, HCV, HBV, or other pathogens.

[0162] In some embodiments, the extracellular antigen binding domain binds to e antigen derived from the grey or dark genome. In some embodiments, the extracellular antigen binding domain binds to any of the tumor neo-antigenic peptides disclosed in WO2021 / 043804, which are incorporated by reference in their entirety. For example, the antigen binding domain binds to any of the peptides of SEQ ID NOs: 1-117, or a neo-antigenic peptide comprising at least 8, 9, 10, 11, or 12 amino acids encoded by a portion of the open reading frame (ORF) of any of SEQ ID NOs: 118-17492 in WO2021 / 043804, or any of the fusion transcript sequences described in any of WO2018 / 234367, WO2022 / 189620, WO2022 / 189626, and WO2022 / 189639. In some embodiments, the antigen-specific receptor binds to a pathogen-specific antigen. In some embodiments, the antigen-specific receptor is specific for a viral antigen (such as HIV, HCV, HBV), a bacterial antigen, and / or a parasitic antigen.

[0163] Non-limiting examples of viruses include Retroviridae (e.g., human immunodeficiency virus, e.g., HIV-1 (also referred to as HDLV-III, LAVE, or HTLV-III / LAV, or HIV-III; and other isolates thereof, e.g., HIV-LP); Picornaviridae (e.g., poliovirus, Hepatitis A virus; enterovirus, human coxsackievirus, rhinovirus, echovirus); Caliciviridae (e.g., strains that cause gastroenteritis); Togaviridae (e.g., equine encephalitis virus, rubella virus); Flaviviridae (e.g., Viruses such as dengue virus, encephalitis virus, yellow fever virus; Coronaviridae (e.g. coronavirus); Rhabdoviridae (e.g. vesicular stomatitis virus, rabies virus); Filoviridae (e.g. Ebola virus); Paramyxoviridae (e.g. parainfluenza virus, mumps virus, measles virus, respiratory syncytial virus); Orthomyxoviridae (e.g. influenza virus); Bunyaviridae (e.g. Hantavirus, Bungavirus, Phlebovirus, and Nairavirus) virus); Arenaviridae (hemorrhagic fever viruses); Reoviridae (e.g., reovirus, orbivirus, and rotavirus); Birnaviridae, Hepadnaviridae (hepatitis B virus); Parvoviridae (parvovirus); Papovaviridae (papillomavirus, polyomavirus); Adenoviridae (most adenoviruses); Herpesviridae (herpes simplex virus (HSV) 1 and 2, varicella-zoster virus, cytomegalovirus (CMV), herpes viruses; Poxviridae (variola virus, vaccinia virus, pox virus); and Iridoviridae (e.g., African swine fever virus); and unclassified viruses (e.g., hepatitis delta agent (thought to be a defective satellite of hepatitis B virus), non-A, non-B hepatitis agents (class 1 = intemally transmitted); class 2 = parenterally transmitted (i.e., hepatitis C); Norwalk and related viruses, and astrovirus).

[0164] Non-limiting examples of bacteria include Pasteurella, Staphylococcus, Streptococcus, Escherichia coli, Pseudomonas species, and Salmonella species. Specific examples of infectious bacteria include, but are not limited to, Helicobacter pylori, Borrelia burgdorferi, Legionella pneumophilia, Mycobacteria species (e.g., M. tuberculosis, M. avium, M. intracellulare, M. kansaii, M. gordonae, M.gordonae, Staphylococcus aureus, Neisseria gonorrhoeae, Neisseria meningitidis, Listeria monocytogenes, Streptococcus pyogenes (group A streptococci), Streptococcus agalactiae (group B streptococci), Streptococcus (green streptococcus group), Streptococcus faecalis, Streptococcus bovis, Streptococcus (anaerobic species), Streptococcus pneumoniae, pathogenic Campylobacter species, Enterococcus species, Haemophilus influenzae influenzae, Bacillus anthracis, Corynebacterium diphtheriae, Corynebacterium spp., Erysipelothrix rhusiopathiae, Clostridium perfringers, Clostridium tetani, Enterobacter aerogenes, Klebsiella pneumoniae, Pasteurella multocida, Bacteroides spp., Fusobacterium nucleatum, Streptobacillus moniliformis, Treponema palladium palladium, Treponema pertenue, Leptospira, Rickettsia, and Actinomyces israelii.

[0165] In certain embodiments, the pathogen antigen is a viral antigen present in cytomegalovirus (CMV), a viral antigen present in Epstein-Barr virus (EBV), a viral antigen present in human immunodeficiency virus (HIV), or a viral antigen present in influenza virus.

[0166] In some embodiments, the antigen is an MHC restricted antigen. Peptide epitopes of tumor antigens, including universal tumor antigens or pathogen antigens as described above, are known in the art and can, in some embodiments, be used to generate MHC-restricted antigen antibodies or antibody fragments (see, e.g., WO2011009173 or WO2012135854 and US20140065708; see also Maus MV, Plotkin J, Jakka G, Stewart-Jones G, Riviere I, Merghoub T, Wolchok J, Renner C, Sadelain M. An MHC-restricted antibody-based chimeric antigen receptor requires TCR-like affinity to maintain antigen specificity. Mol Ther Oncolytics. 2017 Jan 11;3:1-9; and Denkberg G, Reiter Y. Recombinant antibodies with T-cell receptor-like specificity: novel tools to study MHC class I presentation. Autoimmun Rev. 2006;5:252-257; and Hulsmeyer M, Chames P, Hillig RC, Stanfield RL, Held G, Coulie PG. A major histocompatibility complex-peptide-restricted antibody and T cell receptor molecules recognize their target by distinct binding modes: crystal structure of human leukocyte antigen (HLA)-A1-MAGE-A1 in complex with FAB-HYB3. J Biol Chem. 2005;280:2972-2980).

[0167] In some embodiments, the cells of the present disclosure are engineered to express two or more antigen-specific receptors on the cell, each recognizing a different antigen and typically each containing a different intracellular signaling component. Such multiple targeting strategies are described, for example, in WO2014055668 (which describes a combination of activating and costimulatory CARs that target off-targets, e.g., two different antigens that are present individually on normal cells but together only on cells with the disease or condition to be treated), and Fedorov et al., Sci. Transl. Medicine, vol. 5 (p. 215) (December 2013) (which describes cells expressing an activating CAR and an inhibitory CAR, where the activating CAR binds to one antigen expressed on both normal or non-disease cells and cells with the disease or condition to be treated, and the inhibitory CAR binds to another antigen expressed only on normal cells or cells where treatment is not desired).

[0168] Exemplary antibodies include bispecific antibodies, which are T cell activating antibodies that bind not only to a desired antigen but also to an activating T cell antigen such as CD3 epsilon or the constant chain (alpha or beta) of the TCR.

[0169] In some situations, overexpression of a stimulatory factor (e.g., a lymphokine or cytokine) can be toxic to a subject. Thus, in some situations, the engineered cells contain gene segments that render the cells susceptible to negative selection in vivo, such as when administered in adoptive cell therapy. For example, in some embodiments, the cells are engineered to be eliminated as a result of changes in the in vivo conditions of the patient to whom they are administered. A negatively selectable phenotype may result from the insertion of a gene that confers sensitivity to an administered agent, e.g., a compound. Negatively selectable genes include the herpes simplex virus type I thymidine kinase (HSV-I TK) gene, which confers sensitivity to ganciclovir (Wigler et al., Cell II:223, 1977), the cellular hypoxanthine phosphribosyltransferase (HPRT) gene, the cellular adenosine phosphoribosyltransferase (APRT) gene, and bacterial cytosine deaminase (Mullen et al., Proc. Natl. Acad. Sci. USA. 89:33 (1992)).

[0170] In other embodiments of the present disclosure, the cells, e.g., T cells, are not genetically engineered to express a recombinant antigen-specific receptor, but rather comprise a naturally occurring antigen-specific receptor specific for a desired antigen, e.g., tumor-infiltrating lymphocytes and / or T cells cultured in vitro or ex vivo to promote expansion of cells with a particular antigen specificity during an incubation step. For example, in some embodiments, cells for adoptive cell therapy are produced by isolating tumor-specific T cells, e.g., autologous tumor-infiltrating lymphocytes (TILs). Direct targeting of human tumors using autologous tumor-infiltrating lymphocytes can, in some cases, mediate tumor regression (see Rosenberg SA et al. (1988) N Engl J Med. 319:1676-1680). In some embodiments, lymphocytes are extracted from a resected tumor. In some embodiments, such lymphocytes are expanded in vitro. In some embodiments, such lymphocytes are cultured with lymphokines (e.g., IL-2). In some embodiments, such lymphocytes mediate specific lysis of autologous tumor cells, but not allogeneic tumor or autologous normal cells.

[0171] Additional nucleic acids, e.g., genes for introduction, include those that improve the efficacy of therapy, such as by promoting viability and / or function of the transferred cells, genes that provide genetic markers for selecting and / or evaluating cells, such as for assessing in vivo survival or localization, and genes that improve safety by rendering cells susceptible to negative selection in vivo, as described by Lupton SD et al., Mol. and Cell Biol., vol. 11:6 (1991) and Riddell et al., Human Gene Therapy, vol. 3:319-338 (1992). See also International Application Publication No. PCT / US91 / 08442 and International Application Publication No. PCT / US94 / 05601, by Lupton et al., which describe the use of bifunctional selectable fusion genes derived from the fusion of dominant positive and negative selectable markers. See, e.g., Riddell et al., U.S. Pat. No. 6,040,177, columns 14-17.

[0172] Expression cassettes, vectors and targeting constructs In some aspects, genetic engineering involves introducing a nucleic acid that encodes an engineered component or other component for introduction into the cell, such as a component encoding a gene disruption protein or nucleic acid.

[0173] Generally, engineering a CAR into immune cells (such as T cells) requires culturing the cells to allow for transduction and expansion. A variety of methods can be used for transduction, but stable gene transfer is required to allow for maintenance of CAR expression so that the engineered cells can be clonally expanded and persist.

[0174] In some embodiments, gene transfer is achieved by first stimulating cell growth, e.g., T cell growth, proliferation, and / or activation, followed by transduction of the activated cells and expansion in culture to sufficient numbers for clinical application.

[0175] Traditional techniques utilize a suitable expression vector, where immune cells are transduced with a transgene, e.g., an expression cassette containing an exogenous nucleic acid encoding a CAR or modified TCR. Typically, the transgene or expression cassette is cloned into a targeting construct, resulting in targeted integration of the expression cassette or transgene at a targeted site in the genome (e.g., at the TCR or at the SUV39H1 locus).

[0176] Any suitable targeting construct suitable for expression in the cells of the invention, particularly immune cells, can be used. In a specific embodiment, the targeting construct is adapted for use with a suitable homologous recombination system for targeted integration of a nucleic acid sequence (transgene) at a site within the genome of the cell (e.g., the SUV39H1 locus).

[0177] Known vectors include viral vectors and pseudotyped viral vectors, such as retroviruses (e.g., Moloney murine leukemia virus, Harvey murine sarcoma virus, mouse mammary tumor virus, and Rous sarcoma virus), lentiviruses, adenoviruses, adeno-associated viruses (AAV), alphaviruses, vaccinia viruses, poxviruses, SV40-type viruses, polyomaviruses, Epstein-Barr viruses, herpes simplex viruses, papilloma viruses, polioviruses, foamiviruses, or Semliki Forest virus vectors; or transposase systems, such as the Sleeping Beauty transposase vector (see, e.g., Koste et al., (2014) Gene Therapy 3 April 2014; Carlens et al., (2000) Exp Hematol 28(10):1137-46; Alonso-Camino et al., (2013) Mol Ther. Nucl Acids 2, e93; Park et al., Trends Biotechnol. November 2011; 29(11):550-557). A number of exemplary retroviral systems have been described (e.g., U.S. Pat. No. 5,219,740; U.S. Pat. No. 6,207,453; U.S. Pat. No. 5,219,740; Miller and Rosman (1989) BioTechniques 7:980-990; Miller, AD (1990) Human Gene Therapy 1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al. (1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; and Boris-Lawrie and Temin (1993) Cur. Opin. Genet. Develop. 3:102-109.

[0178] Lentiviral transduction methods are also known.Exemplary methods are described, for example, in Wang et al. (2012) J. Immunother. 35(9):689-701, Cooper et al. (2003) Blood. 101:1637-1644, Verhoeyen et al. (2009) Methods Mol Biol. 506:97-114; and Cavalieri et al. (2003) Blood. 102(2):497-505.

[0179] Non-viral systems for delivery of naked plasmids into cells include lipofection, nucleofection, microinjection, gene guns, virosomes, lipids, cationic lipid complexes, liposomes, immunoliposomes, nanoparticles, gold particle or polymer complexes, polylysine conjugates, synthetic polyamino polymers, other agents that enhance DNA uptake, and artificial viral envelopes or virions.

[0180] In some embodiments, the recombinant nucleic acid is transferred into the T cell by electroporation (see, e.g., Chicaybam et al. (2013) PLoS ONE 8(3):e60298 and Van Tedeloo et al. (2000) Gene Therapy 7(16):1431-1437). In some embodiments, the recombinant nucleic acid is transferred into the T cell by transposition (see, e.g., Manuri et al. (2010) Hum Gene Ther 21(4):427-437; Sharma et al. (2013) Molec Ther Nucl Acids 2, e74; and Huang et al. (2009) Methods Mol Biol 506:115-126). Methods for introducing and expressing genetic material in immune cells include calcium phosphate transfection (e.g., as described in Current Protocols in Molecular Biology, John Wiley & Sons, New York City, NY), protoplast fusion, cationic liposome-mediated transfection, tungsten particle-accelerated microparticle bombardment (Johnston, Nature, 346:776-777 (1990)), and strontium phosphate DNA co-precipitation (Brash et al., Mol. Cell Biol., 7:2031-2034 (1987)).

[0181] Particularly useful vectors for generating targeting constructs that provide transgene vectorization for homologous recombination mediated targeting include, but are not limited to, recombinant adeno-associated virus (rAAV), recombinant non-integrating lentivirus (rNILV), recombinant non-integrating gamma-retrovirus (rNIgRV), single-stranded DNA (linear or circular), and the like.Such vectors can be used to introduce transgenes into immune cells of the invention by creating targeting constructs (see, e.g., Miller, Hum. Gene Ther. 1(1):5-14 (1990); Friedman, Science 244:1275-1281 (1989); Eglitis et al., BioTechniques 6:608-614 (1988); Tolstoshev et al., Current Opin. Biotechnol. 1:55-61 (1990); Sharp, Lancet 337:1277-1278 (1991); Cornetta et al., Prog. Nucleic Acid Res. Mol. Biol. 36:311-322 (1989); Anderson, Science 226:401-409 (1984); Moen, Blood Cells 17:407-416 (1991); Miller et al., Biotechnology 7:980-990 (1989); Le Gal La Salle et al., Science 259:988-990 (1993); and Johnson, Chest 107:77S-83S (1995); Rosenberg et al., N. Engl. J. Med. 323:370 (1990); Anderson et al., U.S. Pat. No. 5,399,346; Scholler et al., Sci. Transl. Med. 4:132-153 (2012); Parente-Pereira et al., J. Biol. Methods l(2):e7 (1-9) (2014); Lamers et al., Blood 117(l):72-82 (2011); Reviere et al., Proc. Natl. Acad. Sci. USA 92:6733-6737 (1995); Wang et al., Gene Therapy 15:1454-1459 (2008).

[0182] In some embodiments, the exogenous nucleic acid or targeting construct comprises a 5' homology arm and a 3' homology arm that facilitates recombination of the nucleic acid sequence into the cell genome at a nuclease cleavage site.

[0183] In some embodiments, exogenous nucleic acid may be introduced into cells using a single-stranded DNA template. The single-stranded DNA may comprise the exogenous nucleic acid, and in a preferred embodiment, may comprise 5' and 3' homology arms to facilitate insertion of the nucleic acid sequence into the nuclease cleavage site by homologous recombination. The single-stranded DNA may further comprise a 5' AAV inverted terminal repeat (ITR) sequence 5' upstream of the 5' homology arm and a 3' AAV ITR sequence 3' downstream of the 3' homology arm. In other specific embodiments, the targeting construct comprises, in 5' to 3' order: a first viral sequence, a left homology arm, a nucleic acid sequence encoding elements creating a polycistronic expression cassette (e.g., various viral and non-viral internal ribosome entry sites (IRES, e.g., FGF-1 IRES, FGF-2 IRES, VEGF IRES, IGF-II IRES, NF-kB IRES, RUNX1 IRES, p53 IRES, Hepatitis A IRES, Hepatitis C IRES, Pestivirus IRES, Aphthovirus IRES, picomavirus IRES, poliovirus IRES, and encephalomyocarditis virus IRES) and a cleavable linker (e.g., a 2A peptide, e.g., P2A, T2A, E2A, and F2A peptide), preferably a cleavable linker), a transgene, a polyadenylation sequence, a right homology arm, and a second viral sequence. In a preferred embodiment, the targeting construct comprises, in 5' to 3' order: a first viral sequence, a left homologous arm, a nucleic acid sequence encoding a self-cleaving linker (such as porcine teschovirus 2A), a nucleic acid sequence encoding a CAR or modified TCR (e.g., Hi-CTR), a polyadenylation sequence, a right homologous arm, and a second viral sequence. Another suitable targeting construct may comprise sequences from an integration-deficient lentivirus (see, e.g., Wanisch et al., Mol. Ther. 17(8):1316-1332 (2009)).

[0184] In some embodiments, the viral nucleic acid sequence comprises an integration-defective lentivirus sequence. It is understood that any suitable targeting construct compatible with the homologous recombination system used may be utilized. The AAV nucleic acid sequence that functions as part of the targeting construct may be packaged into some natural or recombinant AAV capsid or particle. In a specific embodiment, the AAV particle is AAV6. In a specific embodiment, the AAV2-based targeting construct is delivered to the target cell using an AAV6 viral particle. In a specific embodiment, the AAV sequence is an AAV2, AAV5 or AAV6 sequence.

[0185] In some embodiments, the gene encoding the exogenous nucleic acid sequence of the present invention may be introduced into cells by transfection using a linearized DNA template. In some cases, the plasmid DNA encoding the exogenous nucleic acid sequence may contain nuclease cleavage sites (e.g., class II, type II, type V or type VI Cas nuclease) on both sides of the left homology arm, which allows the circular plasmid DNA to be linearized and allows precise in-frame integration of the exogenous DNA without backbone vector sequence (see, for example, Hisano Y, Sakuma T, Nakade S et al., Precise in-frame integration of exogenous DNA mediated by CRISPR / Cas9 system in zebrafish. Sci Rep. 2015;5:8841).

[0186] In some embodiments, the vector incorporates an endogenous promoter, such as a TCR promoter. Such vectors can provide expression in a manner similar to that provided by an endogenous promoter, e.g., a TCR promoter. Such vectors can be useful, for example, when the integration site does not provide efficient expression of the transgene, or when disruption of the endogenous gene controlled by the endogenous promoter is harmful to the T cell or results in reduced efficacy of the T cell therapy. In a preferred embodiment, such vectors can be useful, for example, when the integration site does not provide efficient expression of the nucleic acid sequence encoding the CAR or modified TCR. The promoter can be an inducible promoter or a constitutive promoter. Expression of the nucleic acid sequence under the control of the endogenous or vector-associated promoter occurs under conditions suitable for the cell expressing the nucleic acid, such as growth conditions or in the presence of an inducer using an inducible promoter. Such conditions are well understood by those skilled in the art.

[0187] The targeting construct may optionally be designed to include elements that create a polycistronic expression cassette (including, but not limited to, a variety of viral and non-viral internal ribosome entry sites (IRES, e.g., FGF-1 IRES, FGF-2 IRES, VEGF IRES, IGF-II IRES, NF-kB IRES, RUNX1 IRES, p53 IRES, Hepatitis A IRES, Hepatitis C IRES, Pestivirus IRES, Aphthovirus IRES, Picornavirus IRES, Poliovirus IRES, and Encephalomyocarditis virus IRES) and a cleavable linker (e.g., 2A peptides, e.g., P2A, T2A, E2A, and F2A peptides) immediately upstream of the nucleic acid sequence encoding the transgene. In a preferred embodiment, the targeting construct may optionally be designed to include a cleavably linked (e.g., P2A, T2A, etc.) sequence immediately upstream of the nucleic acid sequence encoding a therapeutic protein (e.g., an engineered antigen receptor). P2A and T2A are self-cleaving peptide sequences and may be used for bicistronic or multicistronic expression of protein sequences (see Szymczak et al., Expert Opin. Biol. Therapy 5(5):627-638 (2005)).

[0188] AAV constructs suitable for HIT expression in immunoresponsive cells according to the present application are described, for example, in Mansilla-Soto, J., Eyquem, J., Haubner, S. et al., HLA-independent T cell receptors for targeting tumors with low antigen density. Nat Med 28:345-352 (2022) and were used in the results contained herein, particularly for in vivo experiments.

[0189] Exemplary compatible constructs typically include a TRBC or TRAC sequence (which may be a native or modified TRBC or TRAC sequence, including the murine sequence described herein), a cleavable linker sequence (as defined above, but such as a 2A sequence), and a TRAC or TRBC sequence (which may be a native or modified TRBC or TRAC sequence, including the murine sequence described herein). The TRBC and / or TRAC sequence is typically fused (preferably 5') to a sequence encoding an antibody fragment (e.g., VH, VH, scFv, single domain antibody, VHH, etc.) as described above. In some embodiments, a booster (co-stimulatory ligand) sequence is included in the construct, such that in preferred embodiments, the construct further includes a cleavable linker sequence (e.g., a 2A sequence) and a booster (co-stimulatory ligand) sequence. Typically, the TRAC or TRBC sequence at the 3' end of the construct is fused to a cleavable linker that is also fused to a booster (co-stimulatory ligand and / or co-stimulatory receptor CCR) sequence (see Figure 11 and Figures 29-30). The booster ((costimulatory ligand and / or costimulatory receptor CCR) sequence may be any of those described herein, and in particular a CD80 sequence or a CD80_4-1BB sequence described herein (see, e.g., SEQ ID NOs: 32-33 and 52-53).

[0190] If desired, the targeting construct may be designed to include a reporter, e.g., a reporter protein, that provides identification of transduced cells. Exemplary reporter proteins include, but are not limited to, fluorescent proteins, e.g., mCherry, green fluorescent protein (GFP), blue fluorescent proteins, e.g., EBFP, EBFP2, Azurite, and mKalamal, cyan fluorescent proteins, e.g., ECFP, Cerulean, and CyPet, and yellow fluorescent proteins, e.g., YFP, Citrine, Venus, and YPet. Typically, the targeting construct includes a polyadenylation (polyA) sequence 3' of the transgene. In a preferred embodiment, the targeting construct includes a polyadenylation (polyA) sequence 3' of the nucleic acid sequence encoding the CAR and / or modified TCR (e.g., Hi)-TCR).

[0191] Methods for obtaining cells according to the present disclosure In certain non-limiting embodiments, the HI-TCR, co-stimulatory ligand, CCR or any other molecule / transgene disclosed herein is expressed by the immunoresponsive cell through a modified genomic locus. In certain embodiments, the expression cassette of the transgene is integrated into the targeted genomic locus of the immunoresponsive cell using targeted genome editing methods. In certain embodiments, the targeted genomic locus may be the SUV39H1, CD3S, CD3e, CD247, B2M, TRAC, TRBC1, TRBC2, TRGC1 and / or TRGC2 locus.

[0192] Any suitable gene editing method and system can be used to modify endogenous T cell receptor locus. The genome editing method disclosed herein can be used to modify endogenous T cell receptor locus. In certain embodiments, a CRISPR system is used to modify T cell receptor locus. In certain embodiments, the CRISPR system targets exon 1 of human TRAC locus. In certain embodiments, the CRISPR system comprises a guide RNA (gRNA) that targets exon 1 of human TRAC locus.

[0193] Typically, the integration (knock-in) of a transgene, such as one encoding an antigen receptor as defined herein (e.g., a Hi-TCR as described herein) (knock-in), simultaneously removes the expression of an endogenous protein (e.g., an endogenous TCR or SUV39H1) (knock-out). The exogenous gene or transgene (e.g., encoding a Hi-TCR construct) may be integrated into an exonic position of the endogenous gene to be knocked out, as described above. In other embodiments, the exogenous gene may be integrated into an intronic locus of the endogenous gene to be knocked out, as described in WO 2021 / 183884 (see Figures 9A-9C for illustration). For example, when the intron KI strategy is close to the 5' end of the exon. The sequence of the transgene is juxtaposed to the exon and a novel splice acceptor is added. When the intron KI strategy is close to the 3' end of the exon, the sequence of the transgene may be juxtaposed to the exon and a novel splice donor is typically added. When the intron KI strategy is in the middle of an intron, the splice acceptor and splice donor typically add new exons to the transcript. For these three examples, the donor template construct typically contains the transgene flanked by typical self-cleaving peptides (e.g., P2A, E2A, T2A, or F2A) to preserve the transcriptional regulation of the endogenous gene. Stop codons and polyadenylation sequences may be added to the donor template construct to terminate translation and transcription.

[0194] The desired genetic change is typically stimulated by the introduction of a Cas protein (e.g., Cas9 or Cas12 protein) and a guide RNA (gRNA) ribonucleoprotein (RNP), which introduces a double- or single-stranded break in the selected gRNA sequence within the endogenous protein locus (e.g., within the T cell receptor alpha constant chain (TRAC) genomic locus or the SuV39H1 locus). Repair of these breaks can proceed either by homology directed repair (HDR), which allows the use of a homologous DNA template to direct the repair outcome, or by non-homologous end joining (NHEJ), which directly ligates the cut ends in an error-prone manner resulting in frequent insertions or deletions of surrounding bases (indels). The effect of NHEJ-mediated indels depends on the arrangement of the gRNA target sequence. Those gRNAs that target coding sequences or nearby structural elements tend to disrupt protein or mRNA expression, leading to NHEJ-mediated knockout of the targeted gene. The balance between NHEJ and HDR events depends on both the choice of gRNA target sequence and the availability of HDR templates (HDRTs).

[0195] Manipulation of the T cell receptor locus In certain embodiments, an antigen receptor such as a HI-TCR is expressed by an immunoresponsive cell through a modified endogenous T cell receptor locus. In certain embodiments, a HI-TCR expression cassette is integrated into an endogenous T cell receptor locus. In certain embodiments, a HI-TCR expression cassette is integrated into a T cell receptor alpha locus (TRA, GenBank ID: 6955). In certain embodiments, a HI-TCR expression cassette is integrated into a T cell receptor beta locus (TRB, GenBank ID: 6957). In certain embodiments, a HI-TCR expression cassette is integrated into a T cell receptor gamma locus (TRG, GenBank ID: 6965).

[0196] In certain embodiments, the HI-TCR expression cassette comprises an extracellular antigen binding domain integrated into the first exon of the TCR constant domain locus, whereby the extracellular antigen binding domain and the TCR constant domain are included in one antigen binding chain of the HI-TCR. In certain embodiments, the TCR constant domain locus may be TRAC, TRBC1, TRBC2, TRGC1 or TRGC2. In certain embodiments, the HI-TCR expression cassette comprises an extracellular antigen binding domain integrated into the first exon of the TRAC locus, whereby the extracellular antigen binding domain and the TRAC peptide are included in the first antigen binding chain of the HI-TCR. In certain embodiments, the HI-TCR expression cassette further comprises a second antigen binding chain optionally comprising the extracellular antigen binding domain and the TRBC peptide. In certain embodiments, the HI-TCR expression cassette comprises an extracellular antigen binding domain integrated into the first exon of the TRBC locus, whereby the extracellular antigen binding domain and the TRBC peptide are included in the first antigen binding chain of the HI-TCR. In certain embodiments, the HI-TCR expression cassette further comprises an extracellular antigen binding domain and a second antigen binding chain optionally comprising a TRAC peptide. In certain embodiments, the expression cassette comprises elements that create a polycistronic expression cassette, such as a cleavable peptide, e.g., a 2A peptide.

[0197] In certain embodiments, the recombinant TCR is expressed from an expression cassette placed at the endogenous TRAC locus and / or TRBC locus of the immunoresponsive cell. In certain embodiments, the installation of the recombinant TCR expression cassette (knock-in) disrupts or eliminates (knock-out) endogenous expression of the TCR, including the native TCR alpha chain and / or the native TCR beta chain, in the immunoresponsive cell. In certain embodiments, the installation of the recombinant TCR expression cassette prevents or eliminates mispairing between the recombinant TCR and the native TCR a chain and / or the native TCR b chain in the immunoresponsive cell.

[0198] In some embodiments, a transgene, typically encoding an antigen receptor (e.g., Hi-TCR), is placed in an intron position of the TRAC and / or TRBC locus. In such embodiments, the gRNA may have a sequence that is at least 85% (e.g., 85%, 87%, 89%, 91%, 93%, 95%, 97%, 99% or 100%) identical to any one of SEQ ID NOs: 2-9 of WO 2021 / 183884 (e.g., gRNA G526, gRNA G527, gRNA G528, gRNA G529, gRNA G530, gRNA G531, gRNA G532 and gRNA G533). In some embodiments, the gRNA may have a sequence that is at least 85% (e.g., 85%, 87%, 89%, 91%, 93%, 95%, 97%, 99% or 100%) identical to any one of SEQ ID NOs: 17 to 28 of WO 2021 / 183884 (e.g., gRNA G542, gRNA G543, gRNA G544, gRNA G545, gRNA G546, gRNA G547, gRNA G548, gRNA G549, gRNA G550, gRNA G551, gRNA G552 and gRNA G553).

[0199] SUV locus manipulation The present invention also includes targeted integration of an expression cassette into the Suv39H1 gene site in immune cells as described herein, preferably human T cells or their precursor cells, where the transgene (exogenous nucleic acid) encodes at least an engineered antigen receptor, a modified TCR (e.g., Hi-TCR) and / or any other therapeutic protein. The transgene may be integrated into any one of exons 1-6, or into the non-coding regulatory region upstream of exon 1, or into any intronic region between exons 1 and 2, between exons 2 and 3, between exons 3 and 4, between exons 4 and 5, and between exons 5 and 6.

[0200] Integration of exogenous proteins Integration of an exogenous protein (e.g., an exogenous intracellular or cell surface protein (e.g., exogenous Hi-tCR)) into a T cell at a gRNA target site may typically be directed by co-delivery of an HDRT that includes left and right homology arms that have homology to sequences flanking the genomic cleavage (LHA and RHA, respectively) and the surrounding exogenous protein (e.g., an exogenous intracellular or cell surface protein (e.g., exogenous Hi-TCR)) insertion. In some embodiments, the exogenous protein (e.g., an exogenous intracellular or cell surface protein (e.g., exogenous Hi-TCR)) is typically integrated in frame at the endogenous cell surface protein locus (e.g., the TRAC locus) following a self-cleaving peptide (e.g., P2A, E2A, T2A, or F2A) when an intronic locus is targeted. This results in expression of a CAR or exogenous protein (e.g., an exogenous intracellular or cell surface protein (e.g., an exogenous Hi-TCR)) insert, while simultaneously preventing expression of an endogenous cell surface protein (e.g., an endogenous TCR).

[0201] Knock-in efficiency directly correlates with the nuclear concentration of HDRT and may be increased by delivering HDRT using, for example, either a recombinant viral vector or a ssDNA / dsDNA hybrid Cas9 shuttle, e.g., as defined in WO 2021 / 183884. In some embodiments, the HDRT and / or gRNA in the compositions described herein may be introduced into cells by viral delivery using a viral vector. For example, viral vectors may be based on vaccinia virus, poliovirus, adenovirus, adeno-associated virus (AAV) (e.g., recombinant AAV (rAAV)), SV40, herpes simplex virus, human immunodeficiency virus, etc. Retroviral vectors may be based on murine leukemia virus, spleen necrosis virus, and vectors derived from retroviruses, e.g., Rous sarcoma virus, Harvey sarcoma virus, avian leukosis virus, lentivirus (e.g., integration-deficient lentivirus), human immunodeficiency virus, myeloproliferative sarcoma virus, mammary tumor virus, etc. In some embodiments, the retroviral vector may be an integration-deficient gamma retroviral vector. Other useful expression vectors are known to those skilled in the art, and many are commercially available. The following exemplary vectors are provided by way of example for eukaryotic host cells: pXT1, pSG5, pSVK3, pBPV, pMSG, and pSVLSV40. Examples of techniques that can be used to introduce viral vectors into cells include, but are not limited to, virus or bacteriophage infection, transfection, protoplast fusion, lipofection, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran-mediated transfection, liposome-mediated transfection, calcium phosphate precipitation, nanoparticle-mediated nucleic acid delivery, and the like.

[0202] Expression cassettes may be constructed in monocistronic, multicistronic expression cassettes, multiple expression cassettes in a single vector, or with auxiliary molecules (e.g., cytokines) in multiple vectors. Examples of elements that create polycistronic expression cassettes include, but are not limited to, various viral and non-viral internal ribosome entry sites (IRES, e.g., FGF-1 IRES, FGF-2 IRES, VEGF IRES, IGF-II IRES, NF-kB IRES, RUNX1 IRES, p53 IRES, Hepatitis A IRES, Hepatitis C IRES, Pestivirus IRES, Aphthovirus IRES, Picornavirus IRES, Poliovirus IRES, and Encephalomyocarditis virus IRES) and cleavable linkers (e.g., 2A peptides, e.g., P2A, T2A, E2A, and F2A peptides).

[0203] In some embodiments, the expression cassette is "promoterless" such that expression of the transgene is under the control of an endogenous promoter. In some other embodiments, the expression cassette includes a promoter that drives expression of the transgene. Examples include CMV, EF-1a, hPGK, and RPBSA. The CAG promoter is used to overexpress the lncRNA. Yin et al., Cell Stem Cell. 2015 May 7; 16(5):504-16. Inducible promoters driven by signals from activated T cells include the nuclear factor of activated T cells (NFAT) promoter. Other promoters for T cell expression of RNA include the CIFT chimeric promoter (containing a portion of the cytomegalovirus (CMV) enhancer, the core interferon gamma (IFN-γ) promoter, the JeT promoter (WO 2002 / 012514), and the T-lymphotropic virus long terminal repeat (TLTR)), the endogenous TRAC promoter, or the TRBC promoter. Inducible, constitutive or tissue-specific promoters are contemplated.

[0204] In certain non-limiting embodiments, the expression of the expression cassette integrated into the targeted genomic locus (e.g., SUV39H1 locus) is regulated by the endogenous transcription terminator of the genomic locus. In certain embodiments, the expression of the expression cassette integrated into the targeted genomic locus is regulated by a modified transcription terminator introduced into the genomic locus. Any targeted genome editing method can be used to modify the transcription terminator region of the targeted genomic locus, thereby altering the expression of the expression cassette in the immune cells of the present invention. In certain embodiments, the modification comprises replacing the endogenous transcription terminator with an alternative transcription terminator or inserting an alternative transcription terminator into the transcription terminator region of the targeted genomic locus. In certain embodiments, the alternative transcription terminator comprises a 3'UTR region or a polyA region of a gene. In certain embodiments, the alternative transcription terminator is endogenous. In certain embodiments, the alternative transcription terminator is exogenous. In certain embodiments, alternative transcription terminators include, but are not limited to, a TK transcription terminator, a GCSF transcription terminator, a TCRA transcription terminator, an HBB transcription terminator, a bovine growth hormone transcription terminator, an SV40 transcription terminator, and a P2A element.

[0205] Preferentially, inactivation of SUV39H1 activity results in the absence of substantial detectable activity of SUV39H1 in the cells. Inactivation of SUV39H1 activity can be achieved by suppression of SUV39H1 gene expression, or by mutation of the SUV39H1 gene of the cells, or by expression, delivery or contact with an exogenous inhibitor. For example, suppression can reduce the expression of SUV39H1 in the cells by at least 50, 60, 70, 80, 90 or 95% compared to the same cells produced by the method in the absence of suppression. Gene disruption (mutation) can also result in reduced expression of SUV39H1 protein, or expression of a non-functional SUV39H1 protein. Inhibition of SUV39H1 in immune cells according to the present disclosure can be permanent and irreversible, or can be transient, or can be reversible. Preferably, SUV39H1 inhibition is permanent and irreversible. Inhibition of SUV39H1 in cells can be achieved before or after injection of the cells into the targeted patient, as described below.

[0206] In some embodiments, inhibition of SUV39H1 activity in the genetically engineered immune cells disclosed herein is achieved by delivering or expressing at least one agent that inhibits or blocks SUV39H1 expression and / or activity, i.e., a "SUV39H1 inhibitor."

[0207] Small molecule SUV39H1 inhibitors are known, for example inhibitors of the epipolythiodioxopiperazine (ETP) class of methyltransferase inhibitors such as chaetocin, ETP69 or other epidithiodioxopiperazine alkaloids.

[0208] One inhibitor of the H3K9-histone methyltransferase SUV39H1 is described in Greiner D, Bonaldi T, Eskeland R, Roemer E, Imhof A. "Identification of a specific inhibitor of the histone methyltransferase SU(VAR)3-9". Nat Chem Biol. August 2005;l(3):143-5.;Weber, HP et al., "The molecular structure and absolute configuration of chaetocin", Acta Cryst, B28, 2945-2951 (1972);Udagawa, S. et al., "The production of chaetoglobosins, sterigmatocystin, O-methylsterigmatocystin, and chaetocin by Chaetomium spp. and related fungi", Can. J. microbiol, 25, 170-177 (1979);and Gardiner, Chaetocin (CAS 28097-03-2) as described by DM et al., "The epipolythiodioxopiperazine (ETP) class of fungal toxins: distribution, mode of action, functions and biosynthesis", Microbiol, vol. 151, pp. 1021-1032 (2005). Chaetocin is commercially available from Sigma Aldrich.

[0209] The inhibitor of Suv39h1 may be ETP69 (Rac-(3S,6S,7S,8aS)-6-(benzo[d][1,3]dioxol-5-yl)-2,3,7-trimethyl-1,4-dioxohexahydro-6H-3,8a-epidithiopyrrolo[1,2-a]pyrazine-7-carbonitrile), a racemic analogue of the epidithiodiketopiperazine alkaloid Chaetocine A (see WO2014066435; see also Baumann M, Dieskau AP, Loertscher BM, et al., Tricyclic Analogues of Epidithiodioxopiperazine Alkaloids with Promising In Vitro and In Vivo Antitumor Activity. Chemical science (Royal Society of Chemistry: 2010). 2015;6:4451-4457; and see Snigdha S, Prieto GA, Petrosyan A, et al., H3K9me3 Inhibition Improves Memory, Promotes Spine Formation, and Increases BDNF Levels in the Aged Hippocampus. The Journal of Neuroscience. 2016;36(12):3611-3622.

[0210] The inhibitory activity of the compounds may be determined using various methods as described in Greiner D. et al., Nat Chem Biol. 2005 Aug;l(3):143-5 or Eskeland, R. et al., Biochemistry 43:3740-3749 (2004).

[0211] Inhibition of Suv39h1 in cells can be achieved before or after injection into a patient or subject. In some embodiments, the inhibition as previously defined is performed in vivo after administration of cells to a subject. Alternatively, the Suv39h1 inhibitor as defined herein can be included in a composition containing cells. Suv39h1 can be administered separately before, simultaneously or after administration of cells to a subject.

[0212] In some embodiments, the inhibition of Suv39h1 according to the invention may be achieved by incubation of the cells according to the invention with a composition containing at least one pharmacological inhibitor as previously described. The inhibitor is included during the in vitro expansion of anti-tumor T cells, thereby modifying their reconstitution, survival and therapeutic efficacy after adoptive transfer.

[0213] Other suitable SUV39H1 inhibitors include, for example, agents that hybridize or bind to the SUV39H1 gene or its regulatory elements, such as aptamers that block or inhibit expression or activity of SUV39H1; nucleic acid molecules that block transcription or translation, such as antisense molecules complementary to SUV39H1, RNA interference agents (such as small interfering RNA (siRNA), small hairpin RNA (shRNA), long non-coding RNA (lncRNA), microRNA (miRNA), or piwiRNA (piRNA)), ribozymes, and combinations thereof.

[0214] It was shown that the antisense lncRNA, AF196970.3, has a silencing function against SUV39H1 in human cells, inhibiting SUV39H1 expression and thereby reducing the level of SUV39H1 protein in cells. AF196970.3 has an expression pattern very similar to that of SUV39H1. It is detected in many different cell types, with endothelial cells, fibroblasts and muscle cells showing the highest levels, similar to SUV39H1. The locus of SUV39H1 is located on the X chromosome (position p11.23, 48695554-48709016, GRCh38.p13 assembly). At the same locus, in an antiparallel orientation, the unannotated gene ENSG00000232828 is located at positions 48698963-48737163. Both genes have annotated promoter regions. SEQ ID NO: 55: lncRNA AF196970.3 RNA sequence:

[0215] [ka]

[0216] is the predicted RNA sequence expressed after transcription and splicing from ENSG00000232828. SEQ ID NO: 1 is a 925 base sequence containing three exons. AF196970.3 exon 1 is 125 bases in length and has no significant complementarity to the SUV39H1 gene. AF196970.3 exon 2 is 600 bases in length and is antiparallel to most of exon 3 of the SUV39H1 gene with 100% similarity. AF196970.3 exon 3 is 200 bases in length and is antiparallel to part of exon 2 (42.5% similarity) and part of the adjacent intron of the SUV39G1 gene. The inhibitory polynucleotides of the present disclosure for use in cells and methods of the present disclosure include AF196970.3 (SEQ ID NO: 1) or a fragment or variant thereof.

[0217] Suitable SUV39H1 inhibitors may also include a) engineered non-naturally occurring clustered regularly interspaced short palindromic repeats (CRISPR) guide RNAs that hybridize with SUV39H1 genomic nucleic acid sequences, and / or b) exogenous nucleic acids that include nucleotide sequences encoding CRISPR proteins (typically type II Cas9 proteins), and optionally the cells are transgenic to express Cas9 proteins or RNPs that include guide RNAs and CRISPR proteins. The agent may also be a zinc finger protein (ZF) or TAL protein. The Cas9 protein, TAL protein, and / or ZF protein are directly or indirectly linked to repressors and / or inhibitors, or linked to nucleases that confer gene editing activity.

[0218] Also suitable SUV39H1 inhibitors include non-functional SUV39H1. In some embodiments, wild-type SUV39H1 gene is not inactivated, but rather SUV39H1 inhibitor is expressed in cells. In some embodiments, the inhibitor is a dominant-negative SUV39H1 gene that expresses a non-functional gene product at a level that inhibits the activity of wild-type SUV39H1. This may include overexpression of dominant-negative SUV39H1.

[0219] Inactivation of SUV39H1 in immune cells and introduction of an antigen-specific receptor that specifically binds to a target antigen can be performed simultaneously or sequentially in any order.

[0220] Inactivation of SUV39H1 in cells according to the present disclosure can also be achieved by suppression or disruption of the SUV39H1 gene, such as by deletion, e.g., deletion of the entire gene, exons, or regions, and / or replacement with an exogenous sequence, and / or by mutations within the gene, typically within an exon of the gene, e.g., frameshift or missense mutations. In some embodiments, the disruption results in the incorporation of a premature stop codon into the gene, and the SUV39H1 protein is not expressed or is non-functional. The disruption is generally performed at the DNA level. The disruption is generally permanent, irreversible, or non-transient.

[0221] In some embodiments, gene inactivation is achieved using a gene editing agent, such as a DNA targeting molecule, such as a DNA binding protein or a DNA binding nucleic acid that specifically binds or hybridizes to a gene, or a complex, compound, or composition comprising the same. In some embodiments, the DNA targeting molecule comprises a DNA binding domain, such as a zinc finger protein (ZFP) DNA binding domain, a transcription activator-like protein (TAL) or a TAL effector (TALE) DNA binding domain, a clustered regularly interspaced short palindromic repeats (CRISPR) DNA binding domain, or a DNA binding domain derived from a meganuclease.

[0222] Zinc finger, TALE, and CRISPR binding domains can be "engineered" to bind to a given nucleotide sequence.

[0223] In some embodiments, the DNA targeting molecule, complex, or combination comprises a DNA binding molecule and one or more additional domains, such as an effector domain, to facilitate gene suppression or disruption. For example, in some embodiments, gene disruption is performed by a fusion protein comprising a DNA binding protein and a heterologous regulatory domain or a functional fragment thereof.

[0224] Typically, the additional domain is a nuclease domain. Thus, in some embodiments, gene disruption is facilitated by gene editing or genome editing using engineered proteins, such as nuclease-containing complexes or fusion proteins that are composed of a sequence-specific DNA binding domain fused or complexed with a nuclease and a non-specific DNA cutting molecule such as a nuclease.

[0225] These targeted chimeric nucleases or nuclease-containing complexes induce targeted double-strand or single-strand breaks and stimulate cellular DNA repair mechanisms, including error-prone non-homologous end joining (NHEJ) and homology-directed repair (HDR), to perform precise genetic modification. In some embodiments, the nuclease is an endonuclease, such as a zinc finger nuclease (ZFN), a TALE nuclease (TALEN), an RNA-guided endonuclease (RGEN), such as a CRISPR-associated (Cas) protein, or a meganuclease. Such systems are well known in the art (see, e.g., U.S. Pat. No. 8,697,359; Sander and Joung (2014) Nat. Biotech. 32:347-355; Hale et al. (2009) Cell 139:945-956; Karginov and Hannon (2010) Mol. Cell 37:7; U.S. Patent Application Publication Nos. 2014 / 0087426 and 2012 / 0178169; Boch et al. (2011) Nat. Biotech. 29:135-136; Boch et al. (2009) Science 326:1509-1512; Moscou and Bogdanove (2009) Science 326: 1501, Weber et al. (2011) PLoS One 6:el9722, Li et al. (2011) Nucl. Acids Res. 39:6315-6325, Zhang et al. (2011) Nat. Biotech. 29:149-153, Miller et al. (2011) Nat. Biotech. 29:143-148, Lin et al. (2014) Nucl. Acids Res. 42:e47). Such genetic strategies can use constitutive or inducible expression systems, according to methods well known in the art.

[0226] ZFPs and ZFNs, TALs, TALEs, and TALENs In some embodiments, the DNA targeting molecule comprises a DNA binding protein, such as one or more zinc finger proteins (ZFPs) or transcription activator-like proteins (TALs), fused to an effector protein, such as an endonuclease. Examples include ZFNs, TALEs, and TALENs. See Lloyd et al., Frontiers in Immunology, vol. 4(221), pp. 1-7 (2013).

[0227] In some embodiments, the DNA targeting molecule comprises one or more zinc finger proteins (ZFPs) or domains thereof that bind to DNA in a sequence-specific manner. A ZFP or domain thereof is a protein or domain within a larger protein that binds to DNA in a sequence-specific manner through one or more zinc finger regions of amino acid sequences within the binding domain whose structure is stabilized by the coordination of zinc ions. In general, the sequence specificity of a ZFP can be altered by making amino acid substitutions at the four helical positions (-1, 2, 3, and 6) of the zinc finger recognition helix. Thus, in some embodiments, the ZFP or ZFP-containing molecule is not naturally occurring, e.g., genetically engineered to bind to a selected target site. See, e.g., Beerli et al. (2002) Nature Biotechnol. 20:135-141; Pabo et al. (2001) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001) Nature Biotechnol. 19:656-660; Segal et al. (2001) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416.

[0228] In some embodiments, the DNA targeting molecule is or comprises a zinc finger DNA binding domain fused to a DNA cleavage domain to form a zinc finger nuclease (ZFN). In some embodiments, the fusion protein comprises a cleavage domain (or cleavage half-domain) derived from at least one type IIS restriction enzyme and one or more zinc finger binding domains, which may or may not be engineered. In some embodiments, the cleavage domain is derived from the type IIS restriction endonuclease Fok I. See, e.g., U.S. Pat. Nos. 5,356,802, 5,436,150, and 5,487,994, as well as Li et al. (1992) Proc. Natl. Acad. Sci. USA 89:4275-4279, Li et al. (1993) Proc. Natl. Acad. Sci. USA 90:2764-2768, Kim et al. (1994a) Proc. Natl. Acad. Sci. USA 91:883-887, Kim et al. (1994b) J. Biol. Chem. 269:31,978-31,982.

[0229] In some aspects, ZFNs efficiently generate double-strand breaks (DSBs) at predetermined sites in the coding region of a target gene (i.e., SUV39H1), for example. Exemplary targeted gene regions include exons, regions encoding N-terminal regions, first exons, second exons, and promoter or enhancer regions. In some embodiments, transient expression of ZFNs facilitates highly efficient and permanent disruption of target genes in engineered cells. Notably, in some embodiments, delivery of ZFNs results in permanent disruption of genes with greater than 50% efficiency. Many gene-specific engineered zinc fingers are commercially available. For example, Sangamo Biosciences (Richmond, CA, USA), in collaboration with Sigma-Aldrich (St. Louis, MO, USA), has developed a platform for zinc finger construction (CompoZr) that allows researchers to bypass all zinc finger construction and validation, providing zinc fingers specifically targeted to thousands of proteins. Gaj et al., Trends in Biotechnology, 2013, 31(7), 397-405. In some embodiments, commercially available zinc fingers are used or custom designed. (See, e.g., Sigma-Aldrich catalog numbers CSTZFND, CSTZFN, CTI1-1KT, and PZD0020).

[0230] In some embodiments, the DNA targeting molecule comprises a naturally occurring or engineered (non-naturally occurring) transcription activator-like protein (TAL) DNA binding domain, such as that found in a transcription activator-like protein effector (TALE) protein. See, for example, US Patent Publication No. 20110301073. In some embodiments, the molecule is a DNA-binding endonuclease, such as a TALE nuclease (TALEN). In some aspects, a TALEN is a fusion protein that includes a DNA binding domain derived from a TALE and a nuclease catalytic domain for cleaving a nucleic acid target sequence. In some embodiments, the TALE DNA binding domain is engineered to bind to a target sequence in a gene encoding a target antigen and / or an immunosuppressive molecule. For example, in some aspects, the TALE DNA binding domain can target an adenosine receptor, such as CD38 and / or A2AR.

[0231] In some embodiments, TALENs recognize and cleave target sequences in genes. In some aspects, DNA cleavage results in double-strand breaks. In some aspects, cleavage stimulates the rate of homologous recombination or non-homologous end joining (NHEJ). In general, NHEJ is an incomplete repair process, which often results in changes to the DNA sequence at the cleavage site. In some aspects, the repair mechanism involves rejoining the remains of the two DNA ends by direct religation (Critchlow and Jackson, Trends Biochem Sc. October 1998, vol. 23(10):394-8) or by so-called microhomology-mediated end joining. In some embodiments, repair by NHEJ results in small insertions or deletions, which can be used to disrupt and thereby silence genes. In some embodiments, the modification may be a substitution, deletion, or addition of at least one nucleotide. In some aspects, cells in which a breakage-induced mutagenesis event has occurred, i.e., a mutagenesis event subsequent to an NHEJ event, can be identified and / or selected by methods well known in the art.

[0232] TALE repeats can be assembled to specifically target the SUV39H1 gene. (Gaj et al., Trends in Biotechnology, 2013, 31(7), 397-405). A library of TALENs targeting 18,740 human protein-coding genes has been constructed (Kim et al., Nature Biotechnology. 31, 251-258 (2013)). Custom-designed TALE arrays are commercially available from Cellectis Bioresearch (Paris, France), Transposagen Biopharmaceuticals (Lexington, KY, USA), and Life Technologies (Grand Island, NY, USA). In particular, TALENs targeting CD38 are commercially available (see Gencopoeia, Catalog Nos. HTN222870-1, HTN222870-2, and HTN222870-3, available on the World Wide Web at www.genecopoeia.com / product / search / detail.php?prt=26&cid=&key=HTN222870). Exemplary molecules are described, for example, in U.S. Patent Publication No. 2014 / 0120222 and U.S. Patent Publication No. 2013 / 0315884.

[0233] In some embodiments, the TALENs are introduced as transgenes encoded by one or more plasmid vectors. In some aspects, the plasmid vectors may contain a selection marker that provides for identification and / or selection of cells that have received the vector.

[0234] RGEN (CRISPR / Cas system) Gene suppression can be performed using one or more DNA-binding nucleic acids, such as destruction by RNA-guided endonucleases (RGENs) or other forms of suppression by other RNA-guided effector molecules. For example, in some embodiments, gene suppression can be performed using clustered regularly interspaced short palindromic repeats (CRISPR) and CRISPR-associated proteins. See Sander and Joung, Nature Biotechnology, 32(4):347-355.

[0235] In general, a "CRISPR system" is a collective term referring to transcripts and other elements involved in directing the expression or activity of CRISPR-associated ("Cas") genes, including sequences encoding Cas genes, tracr (trans-activating CRISPR) sequences (e.g., tracrRNA or an active partial tracrRNA), tracr-mate sequences (including "directed repeats" in the context of an endogenous CRISPR system and partial directed repeats processed by the tracrRNA), guide sequences (also referred to as "spacers" in the context of an endogenous CRISPR system), and / or other sequences and transcripts from the CRISPR locus.

[0236] Typically, a CRISPR / Cas nuclease or CRISPR / Cas nuclease system comprises a non-coding RNA molecule (guide) RNA that binds to DNA in a sequence-specific manner, and a CRISPR protein with nuclease functionality (e.g., two nuclease domains). One or more elements of the CRISPR system may be derived from a type I, type II, or type III CRISPR system, such as a Cas nuclease. Preferably, the CRISPR protein is a Cas enzyme, such as Cas9. Cas enzymes are well known in the art, for example, the amino acid sequence of the S. pyogenes Cas9 protein can be found in the SwissProt database under accession number Q99ZW2. In some embodiments, the Cas nuclease and gRNA are introduced into the cell. In some embodiments, the CRISPR system induces a DSB at the target site, followed by disruption as discussed herein. In other embodiments, a Cas9 variant considered a "nickase" can be used to nick a single strand at the target site. Also, paired nickases, each directed by a different pair of gRNA targeting sequences, can be used, for example, to improve specificity. In yet other embodiments, catalytically inactive Cas9 can be fused to a heterologous effector domain, such as a transcriptional repressor, to affect gene expression.

[0237] Generally, CRISPR systems are characterized by elements that promote the formation of CRISPR complexes at the site of target sequences. Typically, in the context of the formation of CRISPR complexes, "target sequence" generally refers to a sequence that guide sequence is designed to have complementarity with, and hybridization of target sequence and guide sequence promotes the formation of CRISPR complexes. Full complementarity is not necessarily required, as long as there is sufficient complementarity to cause hybridization and promote the formation of CRISPR complexes. Target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotide. In general, a sequence or template that can be used for recombination into a targeted locus that includes a target sequence is called an "editing template" or an "editing polynucleotide" or an "editing sequence". In some aspects, an exogenous template polynucleotide may be called an editing template. In some aspects, the recombination is a homologous recombination.

[0238] In some embodiments, one or more vectors driving the expression of one or more elements of the CRISPR system are introduced into the cell such that the expression of the elements of the CRISPR system directs the formation of a CRISPR complex at one or more target sites. For example, the Cas enzyme, the guide sequence linked to the tracr-mate sequence, and the tracr sequence may each be operably linked to separate regulatory elements in separate vectors. Alternatively, two or more of the elements expressed from the same or different regulatory elements may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector. In some embodiments, the CRISPR system elements combined in a single vector may be arranged in any suitable orientation. In some embodiments, the CRISPR enzyme, the guide sequence, the tracr-mate sequence, and the tracr sequence are operably linked to and expressed from the same promoter. In some embodiments, the vector comprises a regulatory element operably linked to an enzyme coding sequence encoding a CRISPR enzyme, such as a Cas protein.

[0239] In some embodiments, the CRISPR enzyme combined with (and optionally complexed with) guide sequence is delivered to cells. Typically, CRISPR / Cas9 technology can be used to knock down gene expression of SUV39H1 in genetically engineered cells. For example, Cas9 nuclease and guide RNA specific to SUV39H1 gene can be introduced into cells using any of a number of known delivery methods or cell transfer vehicles, such as, for example, lentivirus delivery vectors, or any of a number of known methods or vehicles for delivering Cas9 molecules and guide RNA (see also below).

[0240] Delivery of nucleic acids encoding gene disrupting molecules and complexes In some embodiments, nucleic acids encoding DNA targeting molecules, complexes, or combinations are administered or introduced into cells. Typically, viral and non-viral based gene transfer methods can be used to introduce nucleic acids encoding components of CRISPR, ZFP, ZFN, TALE, and / or TALEN systems into cells in culture.

[0241] In some embodiments, the polypeptide is synthesized in situ in the cell as a result of introducing a polynucleotide encoding the polypeptide into the cell. In some aspects, the polypeptide may be produced outside the cell and then introduced into the cell.

[0242] Methods for introducing polynucleotide constructs into animal cells are known, and non-limiting examples include stable transformation methods in which the polynucleotide construct is integrated into the genome of the cell, transient transformation methods in which the polynucleotide construct is not integrated into the genome of the cell, and virus-mediated methods.

[0243] In some embodiments, the polynucleotide may be introduced into the cell by, for example, a recombinant viral vector (e.g., retrovirus, adenovirus), liposome, etc. Transient transformation methods include microinjection, electroporation, or biolistics. The nucleic acid is administered in the form of an expression vector. Preferably, the expression vector is a retroviral expression vector, an adenoviral expression vector, a DNA plasmid expression vector, or an AAV expression vector.

[0244] Non-viral delivery methods of nucleic acid include lipofection, nucleofection, microinjection, gene gun, virosome, liposome, immunoliposome, polycation or lipid nucleic acid conjugate, naked DNA, artificial virion, and agent-enhanced DNA uptake.Lipofection is described, for example, in U.S. Pat. No. 5,049,386, U.S. Pat. No. 4,946,787, and U.S. Pat. No. 4,897,355, and lipofection reagents are commercially available (e.g., Transfectam™ and Lipofectin™).Cationic and neutral lipids suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91 / 17424, WO 91 / 16024.Delivery can be to cells (e.g., in vitro or ex vivo administration) or to target tissue (e.g., in vivo administration).

[0245] RNA or DNA viral-based systems include retroviral, lentiviral, adenoviral, adeno-associated viral, and herpes simplex viral vectors for gene transfer.

[0246] For reviews of gene therapy procedures, see Anderson, Science 256:808-813 (1992); Nabel & Feigner, TIBTECH 11:211-217 (1993); Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon. TIBTECH 11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt, Biotechnology 6(10):1149-1154 (1988); Vigne, Restorative Neurology and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British Medical Bulletin 51(1):31-44 (1995), Haddada et al., in Current Topics in Microbiology and Immunology Doerfler and Bohm (eds.) (1995), and Yu et al., Gene Therapy 1:13-26 (1994).

[0247] Reporter genes, including but not limited to glutathione-5-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), autofluorescent proteins including HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and blue fluorescent protein (BFP), can be introduced into cells to encode gene products that serve as markers for measuring alterations or modifications in gene product expression.

[0248] Genetic modification of immune responsive cells (e.g., T cells or NKT cells) as defined herein may be achieved by transducing a substantially homogenous cell composition with a recombinant DNA construct. In some embodiments, a retroviral vector (either gamma retrovirus or lentivirus) may be used for the introduction of the DNA construct into cells. For example, a polynucleotide encoding an antigen receptor, such as the Hi-TCR disclosed herein, may be cloned into a retroviral vector, and expression may be driven from its endogenous promoter, from a retroviral terminal repeat, or from a promoter specific for the target cell type of interest. Non-viral vectors may be used as well.

[0249] For the initial genetic modification of immunoresponsive cells to contain a HI-TCR, retroviral vectors are commonly used for transduction, although any other suitable viral vector or non-viral delivery system may be used. The HI-TCR may be constructed including ancillary molecules (e.g., cytokines) in a single cistronic expression cassette, a multicistronic expression cassette, multiple expression cassettes in a single vector, or in multiple vectors. Examples of elements that create polycistronic expression cassettes include, but are not limited to, various viral and non-viral internal ribosome entry sites (IRES, e.g., FGF-1 IRES, FGF-2 IRES, VEGF IRES, IGF-II IRES, NF-kB IRES, RUNX1 IRES, p53 IRES, Hepatitis A IRES, Hepatitis C IRES, Pestivirus IRES, Aphthovirus IRES, Picornavirus IRES, Poliovirus IRES, and Encephalomyocarditis virus IRES) and cleavable linkers (e.g., 2A peptides, e.g., P2A, T2A, E2A, and F2A peptides). Combination of retroviral vectors with appropriate packaging lines is also suitable if the capsid protein will be functional to infect human cells. A variety of amphotropic virus-producing cell lines are known, including, but not limited to, PA12 (Miller et al., (1985) Mol. Cell. Biol. 5:431-437); PA317 (Miller et al., (1986) Mol. Cell. Biol. 6:2895-2902); and CRIP (Danos et al., (1988) Proc. Natl. Acad. Sci. USA 85:6460-6464).

[0250] In some embodiments, the AAV construct can be used for targeted delivery of antigen receptor constructs (e.g., Hi-TCR constructs) as described herein at specific loci. For example, a suitable sequence according to the present application is described in Mansilla-Soto, J., Eyquem, J., Haubner, S. et al., HLA-independent T cell receptors for targeting tumors with low antigen density. Nat Med 28:345-352 (2022).

[0251] Non-amphotropic particles, such as particles pseudotyped with the VSVG, RD114 or GALV envelope and any others known in the art, are also suitable.

[0252] Possible methods of transduction include direct co-culture of the cells with producer cells, e.g., by the method of Bregni et al. (1992) Blood 80:1418-1422, or culture with viral supernatant alone or concentrated vector stocks with or without appropriate growth factors and polycations, e.g., by the method of Xu et al. (1994) Exp. Hemat. 22:223-230; and Hughes et al. (1992) J. Clin. Invest. 89:1817.

[0253] Other transducing viral vectors can be used to modify immunoresponsive cells. In certain embodiments, the selected vector exhibits high infection efficiency and stable integration and expression (see, e.g., Cayouette et al., Human Gene Therapy 8:423-430, 1997; Kido et al., Current Eye Research 15:833-844, 1996; Bloomer et al., Journal of Virology 71:6641-6649, 1997; Naldini et al., Science 272:263-267, 1996; and Miyoshi et al., Proc. Natl. Acad. Sci. USA 94:10319, 1997). Other viral vectors which can be used include, for example, adenoviruses, lentiviruses and adeno-associated viral vectors, vaccinia viruses, bovine papilloma viruses or herpes viruses such as Epstein-Barr virus (see, for example, Miller, Human Gene Therapy 15-14, 1990; Friedman, Science 244:1275-1281, 1989; Eglitis et al., BioTechniques 6:608-614, 1988; Tolstoshev et al., Current Opinion in Biotechnology 1:55-61, 1990; Sharp, Lancet 337:1277-1278, 1991; Cometta et al., Nucleic Acid Research and Molecular Biology 36:311-322, 1989; Anderson, (see vectors in Science 226:401-409, 1984; Moen, Blood Cells 17:407-416, 1991; Miller et al., Biotechnology 7:980-990, 1989; Le Gal La Salle et al., Science 259:988-990, 1993; and Johnson, Chest 107:77S-83S, 1995).Retroviral vectors have been particularly well developed and are used in clinical settings (Rosenberg et al., N. Engl. J. Med 323:370, 1990; Anderson et al., US Pat. No. 5,399,346).

[0254] Non-viral techniques can also be used for the genetic modification of immunoresponsive cells. For example, nucleic acid molecules can be administered in the presence of lipofection (Feigner et al., Proc. Natl. Acad. Sci. USA 84:7413, 1987; Ono et al., Neuroscience Letters 17:259, 1990; Brigham et al., Am. J. Med. Sci. 298:278, 1989; Staubinger et al., Methods in Enzymology 101:512, 1983), asialoorosomucoid-polylysine conjugation (Wu et al., Journal of Biological Chemistry 263:14621, 1988; Wu et al., Journal of Biological Chemistry 263:14621, 1988), and the like. The gene can be introduced into immunocompetent cells by microinjection (Wolff et al., Science 264:16985, 1989) or by microinjection under surgical conditions (Wolff et al., Science 247:1465, 1990). Other non-viral means for gene transfer include in vitro transfection using calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes may also be potentially useful for delivery of DNA to cells. Transplantation of normal genes into infected tissues of a subject can be accomplished ex vivo (e.g., autologous or xenogeneic primary cells or their progeny) by transferring normal nucleic acid into a culturable cell type, after which the cells (or their progeny) are injected into the target tissue or injected systemically.

[0255] The recombinant receptor may be derived from or obtained using a transposase or a targeted nuclease (e.g., zinc finger nuclease, meganuclease or TALE nuclease, CRISPR). Transient expression may be obtained by RNA electroporation. In certain embodiments, the recombinant receptor may be introduced by a transposon-based vector. In certain embodiments, the transposon-based vector comprises a transposon (also known as a transposable element). In certain embodiments, the transposon may be recognized by a transposase. In certain embodiments, the transposase is a Sleeping Beauty transposase.

[0256] The clustered regularly interspaced short palindromic repeats (CRISPR) system is a genome editing tool discovered in prokaryotic cells. When used for genome editing, the system includes Cas9 (a protein that can modify DNA using the crRNA as its guide), CRISPR RNA (crRNA, the RNA used by Cas9 to guide it to the correct section of the host DNA, along with a region that binds to tracrRNA (generally in a hairpin loop form) that forms an active complex with Cas9), transactivating crRNA (tracrRNA, which binds to the crRNA and forms an active complex with Cas9), and an optional section of DNA repair template (DNA that guides the cellular repair process, allowing the insertion of a specific DNA sequence). CRISPR / Cas9 often uses a plasmid to transfect the target cell. The crRNA needs to be designed for each application, since this is the sequence that Cas9 uses to identify and directly bind to the target DNA in the cell. A CAR expression cassette carrying the repair template must also be designed for each application, as it must overlap the sequences on either side of the cut and code for the insertion sequence. Multiple crRNAs and tracrRNAs may be packaged together to form a single guide RNA (sgRNA). This sgRNA may be linked together with the Cas9 gene and made into a plasmid to be transfected into cells.

[0257] Zinc finger nucleases (ZFNs) are artificial restriction enzymes generated by combining a zinc finger DNA binding domain with a DNA cleavage domain. The zinc finger domain may be engineered to target specific DNA sequences allowing the zinc finger nuclease to target desired sequences in the genome. The DNA binding domain of an individual ZFN typically contains multiple individual zinc finger repeats, each capable of recognizing multiple base pairs. The most common method for generating novel zinc finger domains is to combine small zinc finger "modules" of known specificity. The most common cleavage domain in ZFNs is the non-specific cleavage domain derived from the type II restriction endonuclease Fokl. Using the endogenous homologous recombination (HR) machinery and a CAR expression cassette bearing a homologous DNA template, ZFNs can be used to insert a CAR expression cassette into the genome. When the targeting sequence is cleaved by the ZFN, the HR machinery searches for homology between the damaged chromosome and the homologous DNA template and then replicates the sequence of the template between the two broken ends of the chromosome, thereby integrating the homologous DNA template into the genome.

[0258] Transcription activator-like effector nucleases (TALENs) are restriction enzymes that can be engineered to cleave specific sequences in DNA. TALEN systems work on much the same principle as ZFNs. They are generated by combining a transcription activator-like effector DNA binding domain with a DNA cleavage domain. Transcription activator-like effectors (TALEs) are composed of a repeating motif of 33-34 amino acids that contains two variable positions that strongly recognize specific nucleotides. By assembling an array of these TALEs, the TALE DNA binding domain can be engineered to bind to a desired DNA sequence, thereby guiding the nuclease to cleave a specific position in the genome. cDNA expression for use in polynucleotide therapy can be directed from any suitable promoter (e.g., human cytomegalovirus (CMV), simian virus 40 (SV40) or metallothionein promoters) and regulated by any suitable mammalian regulatory element or intron (e.g., elongation factor la enhancer / promoter / intron structure). For example, if desired, enhancers known to preferentially direct gene expression in a particular cell type can be used to direct expression of the nucleic acid. Enhancers that can be used include, but are not limited to, those that have been characterized as tissue- or cell-specific enhancers. Alternatively, if a genomic clone is used as a therapeutic construct, control can be mediated by cognate regulatory sequences or, if desired, by regulatory sequences derived from a heterologous source, including any of the promoters or regulatory elements described above.

[0259] The resulting cells may be grown under conditions similar to those for the unmodified cells, so that the modified cells may be expanded and used for a variety of purposes.

[0260] Cell preparation Isolation of cells involves one or more preparation and / or non-affinity-based cell separation steps by techniques well known in the art. In some cases, cells are washed, centrifuged, and / or incubated in the presence of one or more reagents, for example, to remove unwanted components, enrich for desired components, lyse or remove cells that are sensitive to a particular reagent. In some cases, cells are separated based on one or more properties, such as density, adhesion properties, size, sensitivity and / or resistance to a particular component.

[0261] In some embodiments, the cell preparation includes a step for freezing, e.g., cryopreserving, the cells, either before or after isolation, incubation, and / or genetic manipulation. In some aspects, any of a variety of known freezing solutions and parameters can be used.

[0262] The incubation step may include culturing, incubation, stimulation, activation, expansion, and / or proliferation.

[0263] In some embodiments, the compositions or cells are incubated under stimulatory conditions or in the presence of stimulatory agents, including conditions designed to induce proliferation, expansion, activation, and / or survival of cells in a population, mimic antigen exposure, and / or initially prime cells for genetic manipulation, such as introduction of an antigen-specific receptor.

[0264] Incubation conditions may include one or more of a particular medium, temperature, oxygen content, carbon dioxide content, time, agents, such as nutrients, amino acids, antibiotics, ions, and / or stimulatory factors such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate cells.

[0265] In some embodiments, the stimulatory conditions or agents include one or more agents, e.g., ligands, capable of activating the intracellular signaling domain of the TCR complex. In some aspects, the agents turn on or initiate the TCR / CD3 intracellular signaling cascade in the T cells. Such agents can include antibodies, such as those specific for TCR components and / or costimulatory receptors, e.g., anti-CD3, anti-CD28, and / or one or more cytokines, that are coupled to a solid support, such as beads. Optionally, the expansion method can further include adding anti-CD3 and / or anti-CD28 antibodies to the culture medium (e.g., at a concentration of at least about 0.5 ng / ml). In some embodiments, the stimulatory agents include IL-2 and / or IL-15, e.g., the IL-2 concentration is at least about 10 units / mL.

[0266] In some aspects, incubation is performed in accordance with techniques such as those described in U.S. Pat. No. 6,040,177 to Riddell et al., Klebanoff et al., J Immunother. 2012, 35(9):651-660, Terakura et al., Blood. 2012, 1:72-82, and / or Wang et al., J Immunother. 2012, 35(9):689-701.

[0267] In some embodiments, T cells are expanded by adding to a culture starting composition feeder cells, such as non-dividing peripheral blood mononuclear cells (PBMCs) (e.g., such that the resulting cell population comprises at least about 5, 10, 20, or 40 or more PBMC feeder cells for each T lymphocyte in the initial population to be expanded) and incubating the culture (e.g., for a time sufficient to expand the number of T cells). In some aspects, the non-dividing feeder cells may comprise gamma-irradiated PBMC feeder cells. In some embodiments, the PBMCs are irradiated with gamma radiation in the range of about 3000-3600 rads to prevent cell division. In some aspects, the feeder cells are added to the medium prior to adding the population of T cells.

[0268] In some embodiments, the stimulatory conditions include a temperature suitable for proliferation of human T lymphocytes, e.g., at least about 25 degrees Celsius, typically at least about 30 degrees Celsius, and typically about 37 degrees Celsius. Optionally, the incubation may further include adding non-dividing EBV-transformed lymphoblastoid cells (LCL) as feeder cells. The LCL may be irradiated with gamma radiation in the range of about 6000-10,000 rads. In some aspects, the LCL feeder cells are provided in any suitable amount, such as at a ratio of LCL feeder cells to primary T lymphocytes of at least about 10:1.

[0269] In embodiments, antigen-specific T cells, such as antigen-specific CD4+ and / or CD8+ T cells, are obtained by stimulating naive or antigen-specific T lymphocytes with an antigen. For example, antigen-specific T cell lines or clones against a cytomegalovirus antigen can be generated by isolating T cells from an infected subject and stimulating the cells in vitro with the same antigen.

[0270] In some aspects, the method includes assessing the expression of one or more markers on the surface of the engineered or engineered cells. In one embodiment, the method includes assessing the surface expression of one or more target antigens (e.g., antigens recognized by antigen-specific receptors) that are to be targeted in the adoptive cell therapy, for example, by affinity-based detection methods such as flow cytometry.

[0271] Vectors and methods for genetic engineering of cells In some aspects, genetic engineering involves introducing a nucleic acid that encodes an engineered component or other component for introduction into the cell, such as a component encoding a gene disruption protein or nucleic acid.

[0272] Generally, engineering a CAR into immune cells (such as T cells) requires culturing the cells to allow for transduction and expansion. A variety of methods can be used for transduction, but stable gene transfer is required to allow for maintenance of CAR expression so that the engineered cells can be clonally expanded and persist.

[0273] In some embodiments, gene transfer is achieved by first stimulating cell growth, e.g., T cell growth, proliferation, and / or activation, followed by transduction of the activated cells and expansion in culture to sufficient numbers for clinical application.

[0274] Various methods for introducing genetically engineered components, such as antigen-specific receptors, such as CARs, are well known and can be used with the methods and compositions provided herein. Exemplary methods include methods for transferring nucleic acids encoding receptors, including by viruses, such as retroviruses or lentiviruses, transduction, transposons, and electroporation.

[0275] In some embodiments, the recombinant nucleic acid is transferred into the cell using a recombinant infectious viral particle, such as, for example, a vector derived from simian virus 40 (SV40), adenovirus, or adeno-associated virus (AAV). In some embodiments, the recombinant nucleic acid is transferred into the T cell using a recombinant lentiviral or retroviral vector, such as a gamma retroviral vector (see, e.g., Koste et al. (2014) Gene Therapy April 3, 2014; Carlens et al. (2000) Exp Hematol 28(10):1137-46; Alonso-Camino et al. (2013) Mol Ther Nucl Acids 2, e93; Park et al., Trends Biotechnol. November 2011, 29(11):550-557).

[0276] In some embodiments, retroviral vectors, such as those derived from Moloney Murine Leukemia Virus (MoMLV), Myeloproliferative Sarcoma Virus (MPSV), Murine Embryonic Stem Cell Virus (MESV), Murine Stem Cell Virus (MSCV), Spleen Focus Forming Virus (SFFV), or Adeno-Associated Virus (AAV), have long terminal repeats (LTRs). Most retroviral vectors are derived from murine retroviruses. In some embodiments, retroviruses include those derived from any avian or mammalian cell source. Retroviruses are typically amphotropic, meaning that they are capable of infecting host cells of several species, including humans. In one embodiment, the gag, pol, and / or env sequences of the retrovirus are replaced by the gene to be expressed. A number of exemplary retroviral systems have been described (e.g., U.S. Pat. No. 5,219,740; U.S. Pat. No. 6,207,453; U.S. Pat. No. 5,219,740; Miller and Rosman (1989) BioTechniques 7:980-990; Miller, AD (1990) Human Gene Therapy 1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al. (1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; and Boris-Lawrie and Temin (1993) Cur. Opin. Genet. Develop. 3:102-109).

[0277] Lentiviral transduction methods are also known.Exemplary methods are described, for example, in Wang et al. (2012) J. Immunother. 35(9):689-701; Cooper et al. (2003) Blood. 101:1637-1644; Verhoeyen et al. (2009) Methods Mol Biol. 506:97-114; and Cavalieri et al. (2003) Blood. 102(2):497-505.

[0278] In some embodiments, the recombinant nucleic acid is transferred into the T cell by electroporation (see, e.g., Chicaybam et al. (2013) PLoS ONE 8(3):e60298 and Van Tedeloo et al. (2000) Gene Therapy 7(16):1431-1437). In some embodiments, the recombinant nucleic acid is transferred into the T cell by transposition (see, e.g., Manuri et al. (2010) Hum Gene Ther 21(4):427-437; Sharma et al. (2013) Molec Ther Nucl Acids 2, e74; and Huang et al. (2009) Methods Mol Biol 506:115-126). Other methods for introducing and expressing genetic material in immune cells include calcium phosphate transfection (e.g., as described in Current Protocols in Molecular Biology, John Wiley & Sons, New York City, NY), protoplast fusion, cationic liposome-mediated transfection, tungsten particle-accelerated microparticle bombardment (Johnston, Nature, 346:776-777 (1990)), and strontium phosphate DNA co-precipitation (Brash et al., Mol. Cell Biol., 7:2031-2034 (1987)).

[0279] Other techniques and vectors for transferring engineered nucleic acids encoding engineered products are described, for example, in WO2014055668 and U.S. Pat. No. 7,446,190. The subject matter of the present disclosure further provides a method for producing an antigen-specific immunoresponsive cell. In certain embodiments, the method comprises introducing a nucleic acid sequence encoding a recombinant TCR described herein into an immunoresponsive cell. The nucleic acid sequence may be included in a vector. In certain embodiments, an expression cassette for at least one antigen binding chain of the recombinant TCR is located at an endogenous gene locus of the immunoresponsive cell. In certain embodiments, an expression cassette for two antigen binding chains of the recombinant TCR is located at an endogenous gene locus of the immunoresponsive cell, where the two antigen binding chains are capable of dimerization. The endogenous gene locus may be the CD3S locus, the CD3s locus, the CD247 locus, the B2M locus, the TRAC locus, the TRBC locus, the TRDC locus, and / or the TRGC locus. In certain embodiments, the endogenous gene locus is the TRAC locus or the TRBC locus. In certain embodiments, the placement of the expression cassette of the recombinant TCR disrupts or eliminates endogenous expression of the TCR, including the native TCR a chain and / or the native TCR b chain, in the immunoresponsive cell, thereby preventing or eliminating mispairing between the recombinant TCR and the native TCR a chain and / or the native TCR b chain in the immunoresponsive cell. In certain embodiments, the endogenous gene locus comprises a modified transcription terminator region. In certain embodiments, the modified transcription terminator region comprises a genomic element selected from the group consisting of a TK transcription terminator, a GCSF transcription terminator, a TCRA transcription terminator, an HBB transcription terminator, a bovine growth hormone transcription terminator, an SV40 transcription terminator, and a P2A element. In certain embodiments, when one endogenous T cell receptor locus in a cell is modified to express at least one antigen-binding chain of a recombinant TCR, one or more other endogenous T cell receptor loci in the cell are modified to eliminate expression of an endogenous TCR chain.

[0280] In certain embodiments, one or more other endogenous T cell receptor loci are further modified to express a gene of interest. In certain embodiments, the gene of interest is an anti-tumor cytokine, a costimulatory molecule ligand, a tracking gene, or a suicide gene. The presently disclosed subject matter further provides nucleotide acids encoding the recombinant TCRs described herein, and nucleic acid compositions comprising the recombinant TCRs described herein. In certain embodiments, the nucleic acid sequence is contained in a vector.

[0281] The subject matter of the present disclosure also provides a vector comprising the nucleic acid composition described herein.Further provided is a kit comprising the recombinant TCR described herein, the immunoresponsive cell described herein, the pharmaceutical composition described herein, the nucleic acid composition described herein, or the vector described herein.In certain embodiments, the kit further comprises instructions for treating and / or preventing a neoplasm, a pathogen infection, an autoimmune disorder, or an allogeneic transplant.

[0282] composition The present disclosure also includes compositions comprising cells as described herein and / or produced by the methods provided. Typically, such compositions are pharmaceutical compositions and formulations for administration, preferably sterile compositions and formulations, such as for adoptive cell therapy.

[0283] Pharmaceutical compositions of the present disclosure generally comprise at least one genetically engineered immune cell of the present disclosure and a sterile, pharma- ceutically acceptable carrier.

[0284] As used herein, the phrase "pharmaceutical acceptable carrier" includes saline, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonicity agents, and absorption delaying agents, etc., that are compatible with pharmaceutical administration. Complementary active compounds can be further incorporated into the composition. In some aspects, the choice of carrier in a pharmaceutical composition is determined, in part, by the particular engineered CAR or TCR, vector or cell expressing the CAR or TCR, and by the particular method used to administer the vector or host cell expressing the CAR. Thus, there are a variety of suitable formulations. For example, the pharmaceutical composition may include a preservative. Suitable preservatives can include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride. In some aspects, a mixture of two or more preservatives is used. The preservative or mixtures thereof are typically present in an amount of about 0.0001 to about 2% by weight of the total composition.

[0285] A pharmaceutical composition is formulated to be compatible with its intended route of administration.

[0286] treatment The present disclosure also relates to the previously defined cells for use in adoptive cell therapy (particularly adoptive T cell therapy), typically for the treatment of cancer in a subject in need thereof, as well as for the treatment of infectious diseases and autoimmune, inflammatory, or allergic diseases. Treatment of any of the diseases listed in the "Antigens" section above is contemplated.

[0287] Immune cells, particularly T cells or NK cells in which SUV39H1 has been inactivated, exhibit enhanced central memory phenotypes, enhanced survival and persistence after adoptive transfer, and reduced exhaustion. Increased efficiency and effectiveness can allow for their administration at lower levels compared to such cells that do not exhibit the improvements described herein. Thus, T cells or NK cells in which SUV39H1 has been inactivated and optionally have any of the other features described herein (e.g., expressing a CAR and / or the T cell receptor (TCR) alpha constant region gene has been inactivated by insertion of a nucleic acid sequence encoding a CAR or a TCR, and / or the CAR comprises a) an extracellular antigen binding domain, b) a transmembrane domain, c) optionally one or more costimulatory domains, and d) an intracellular signaling domain comprising a modified CD3 zeta intracellular signaling domain in which ITAM2 and ITAM3 have been inactivated or deleted and / or the HLA-A gene has been inactivated or deleted) can be administered at a certain dose. For example, immune cells (e.g., T cells) in which SUV39H1 has been inactivated can be administered to adults at a dose of less than about 108 cells, less than about 5x107 cells, less than about 107 cells, less than about 5x106 cells, less than about 106 cells, less than about 5x105 cells, or less than about 105 cells. The dose for pediatric patients may be about 100 times lower. In alternative embodiments, any of the immune cells (e.g., T cells or NK cells) described herein can be administered to a patient at a dose ranging from 105-109 cells, or 105-108 cells, or 106-108 cells.

[0288] The subject (i.e., patient) of the present disclosure is a mammal, typically a primate such as a human. In some embodiments, the primate is a monkey or ape. The subject may be male or female and may be of any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects. In some embodiments, the subject is a non-primate mammal, such as a rodent. In some examples, the patient or subject is a validation animal model for evaluating disease, adoptive cell therapy, and / or toxicity outcomes, such as cytokine release syndrome (CRS). In some embodiments of the present disclosure, the subject has cancer, is at risk of having cancer, or is in remission from cancer.

[0289] The cells of the present disclosure are particularly beneficial when administered to treat chronic diseases, such as chronic infectious diseases, or when administered to treat refractory, recurrent or resistant cancers.

[0290] In some embodiments, the patient has or may have cancer recurrence. In some embodiments, the patient has or may have cancer metastasis. In some embodiments, the patient has not achieved sustained cancer remission after one or more prior cancer therapies. In some embodiments, the patient has a cancer that is resistant or non-responsive to one or more prior cancer therapies. In some embodiments, the patient has a refractory cancer. In some embodiments, the patient is likely to respond to cell therapy without persistence. In some embodiments, the patient is ineligible for immune checkpoint therapy or has not responded to immune checkpoint therapy. In some embodiments, the patient is ineligible for treatment with high dose chemotherapy and / or ineligible for treatment with high adoptive cell therapy doses.

[0291] In certain embodiments, immune cells comprising modified TCRs disclosed herein can be used to treat subjects with tumor cells that have low levels of expression of surface antigens. In some conditions, antigens are expressed at low density due to disease recurrence, typically where the subject has undergone a treatment that results in residual tumor cells. In certain embodiments, tumor cells have a low density of target molecules on the surface of the tumor cells, since the targeted antigen, typically the tumor antigen, is expressed at low density (e.g., e-antigen, etc., as previously defined). In certain embodiments, the low density of target molecules on the cell surface has a density of less than about 5,000 molecules per cell, less than about 4,000 molecules per cell, less than about 3,000 molecules per cell, less than about 2,000 molecules per cell, less than about 1,500 molecules per cell, less than about 1,000 molecules per cell, less than about 500 molecules per cell, less than about 200 molecules per cell, less than about 100 molecules per cell. In certain embodiments, the low density of target molecules on the cell surface has a density of less than about 2,000 molecules per cell. In certain embodiments, the low density of target molecules at the cell surface has a density of less than about 1,500 molecules per cell. In certain embodiments, the low density of target molecules at the cell surface has a density of less than about 1,000 molecules per cell. In certain embodiments, the low density of target molecules at the cell surface has a density of between about 4,000 molecules per cell and about 2,000 molecules per cell, between about 2,000 molecules per cell and about 1,000 molecules per cell, between about 1,500 molecules per cell and about 1,000 molecules per cell, between about 2,000 molecules per cell and about 500 molecules per cell, between about 1,000 molecules per cell and about 200 molecules per cell, or between about 1,000 molecules per cell and about 100 molecules per cell.

[0292] In certain embodiments, immunoresponsive cells comprising the HI-TCR disclosed herein can be used to treat subjects with recurrent disease. Typically, the cells also comprise a recombinant booster sequence (CCR) as defined herein above. Typically, such cells lack Suv39, in particular suv39h1. In certain embodiments, tumor cells have a low density of tumor-specific antigens (e.g., CD19, CD22, CD70, or any of the e antigens defined above) on the surface of the tumor cells.

[0293] In some embodiments, immune cells expressing an antigen receptor (e.g., Hi T cell antigen receptor) as described herein may be used for the treatment of patients with a median of less than about 6,000 molecules of target antigen per cell. In some embodiments, the antigen is expressed at a density (typically a median) of less than about 5,000, less than about 4,000, less than about 3,000, less than about 2,000, less than about 1,000, or less than about 500 molecules of target antigen per cell. In some embodiments, the antigen is expressed at a density (typically a median) of less than about 2,000 molecules of target antigen per cell, such as less than about 1,800, less than about 1,600, less than about 1,400, less than about 1,200, less than about 1,000, less than about 800, less than about 600, less than about 400, less than about 200, or less than about 100 molecules of target antigen. In some embodiments, the antigen is expressed at a density of less than about 1,000 molecules of target antigen per cell, e.g., less than about 900 molecules, less than about 800 molecules, less than about 700 molecules, less than about 600 molecules, less than about 500 molecules, less than about 400 molecules, less than about 300 molecules, less than about 200 molecules, or less than about 100 molecules of target antigen. In some embodiments, the antigen is expressed at a density range of about 5,000 to about 100 molecules of target antigen per cell, e.g., about 5,000 to about 1,000 molecules, about 4,000 to about 2,000 molecules, about 3,000 to about 2,000 molecules, about 4,000 to about 3,000 molecules, about 3,000 to about 1,000 molecules, about 2,000 to about 1,000 molecules, about 1,000 to about 500 molecules, about 500 to about 100 molecules of target antigen per cell. Quantification of target antigen density per cell may be achieved as described in Jasper, GA, Arun, I., Venzon, D., Kreitman, RJ, Wayne, AS, Yuan, CM, Marti, GE, & Stetler-Stevenson, M. (2011), Variables affecting the quantitation of CD22 in neoplastic Bcells. Cytometry. Part B, Clinical cytometry, 80(2), 83-90.

[0294] In certain embodiments, the disease is CD19+ALL. In certain embodiments, the tumor cells have low density of CD19 on the tumor cells. The therapeutic method or application of the present invention is particularly suitable for patients in which the antigen to be targeted is expressed at low density on at least 50% of tumor cells, and in particular, 50% of tumor cells express said antigen.

[0295] The cells can be administered at a certain dose. For example, immune cells (e.g., T cells or NK cells) in which SUV39H1 is inhibited can be administered at a dose of about 10 8 Less than 5 x 10 cells 7 Less than 10 cells, approximately 7 Less than 5 x 10 cells 6 Less than 10 cells, approximately 6 Less than 5 x 10 cells 5 Less than 10 cells, or about 10 5 A dose of less than 10 cells can be administered to an adult. The dose for a pediatric patient may be about 100 times lower. In an alternative embodiment, any of the immune cells (e.g., T cells) described herein can be administered in a dose of about 10 5 ~about 10 9 cells, or approximately 10 5 ~about 10 8 cells, or approximately 10 5 ~about 10 7 cells, or approximately 10 6 ~about 10 8 The antibody can be administered to a patient in doses ranging from 10 to 20 cells.

[0296] The cancer may be a solid cancer or a "liquid tumor," such as cancers that affect the blood, bone marrow, and lymphatic system, also known as tumors of hematopoietic and lymphatic tissues, including, among others, leukemias and lymphomas, such as acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), and chronic lymphocytic leukemia (CLL), including various lymphomas such as mantle cell lymphoma, non-Hodgkin's lymphoma (NHL), adenomas, squamous cell carcinoma, laryngeal carcinoma, gallbladder and bile duct carcinoma, and cancers of the retina, such as retinoblastoma.

[0297] Solid cancers include, inter alia, cancers affecting one of the organs selected from the group consisting of colon, rectum, skin, endometrium, lung (including non-small cell lung cancer), uterus, bone (such as osteosarcoma, chondrosarcoma, Ewing's sarcoma, fibrosarcoma, giant cell tumor, adamantinoma, and chordoma), liver, kidney, esophagus, stomach, bladder, pancreas, cervix, brain (such as meningioma, glioblastoma, low-grade astrocytoma, oligodendrocytoma, pituitary tumor, schwannoma, and metastatic brain cancer), ovary, breast, head and neck region, testis, prostate, and thyroid.

[0298] Preferably, the cancer according to the present disclosure is a cancer affecting the blood, bone marrow and lymphatic system, as described above. Typically, the cancer is or is associated with multiple myeloma.

[0299] In some embodiments, the subject has or is at risk for an infectious disease or condition, including, but not limited to, viral, retroviral, bacterial, and protozoan infections, immunodeficiencies, cytomegalovirus (CMV), Epstein-Barr virus (EBV), adenovirus, BK polyomavirus, and the like.

[0300] In some embodiments, the disease or condition is an autoimmune or inflammatory disease or condition, such as arthritis, e.g., rheumatoid arthritis (RA), type I diabetes, systemic lupus erythematosus (SLE), inflammatory bowel disease, psoriasis, scleroderma, autoimmune thyroid disease, Graves' disease, Crohn's disease, multiple sclerosis, asthma, and / or a disease or condition associated with a transplant.

[0301] The present disclosure also relates to a method of treatment, in particular adoptive cell therapy, preferably adoptive T cell therapy, comprising the step of administering to a subject in need thereof a composition as previously described.

[0302] In some embodiments, the cells or compositions are administered to a subject, such as a subject having or at risk for cancer or any one of the diseases as mentioned above. In some aspects, the methods thereby treat, e.g., ameliorate, one or more symptoms of a disease or condition, such as those associated with cancer, e.g., by reducing the tumor burden of a cancer that expresses an antigen recognized by the genetically engineered cells.

[0303] Methods for administering cells for adoptive cell therapy are known and can be used with the methods and compositions provided herein. For example, methods for adoptive T cell therapy are described, for example, in U.S. Patent Application Publication No. 2003 / 0170238 to Gruenberg et al., U.S. Patent No. 4,690,915 to Rosenberg, and Rosenberg (2011) Nat Rev Clin Oncol. 8(10):577-85. See, for example, Themeli et al. (2013) Nat Biotechnol. 31(10):928-933, Tsukahara et al. (2013) Biochem Biophys Res Commun 438(1):84-9, and Davila et al. (2013) PLoS ONE 8(4):e61338.

[0304] In some embodiments, cell therapy, e.g., adoptive cell therapy, e.g., adoptive T cell therapy, is performed by autologous transfer, where cells are isolated and / or otherwise prepared from the subject to be treated with cell therapy or from a sample derived from such a subject. Thus, in some aspects, cells are derived from a subject, e.g., a patient, in need of treatment, and the cells are administered to the same subject after isolation and processing.

[0305] In some embodiments, cell therapy, e.g., adoptive cell therapy, e.g., adoptive T cell therapy, is performed by allogeneic transfer, where cells are isolated and / or otherwise prepared from a subject other than the subject who is to receive or will eventually receive cell therapy, e.g., a first subject. In such embodiments, the cells are then administered to a different subject of the same species, e.g., a second subject. In some embodiments, the first and second subjects are genetically identical. In some embodiments, the first and second subjects are genetically similar. In some embodiments, the second subject expresses the same HLA class or supertype as the first subject. In some embodiments, HLA matching is less important when immune cells are modified to reduce expression of endogenous TCR and HLA class I molecules.

[0306] The administration of at least one cell according to the present disclosure to a subject in need thereof may be performed in combination with one or more additional therapeutic agents, or with another therapeutic intervention, either simultaneously or sequentially in any order. In some circumstances, the cells are co-administered in sufficient temporal proximity with another therapy such that the cell population enhances the effect of the one or more additional therapeutic agents, or vice versa. In some embodiments, the cell population is administered before the one or more additional therapeutic agents. In some embodiments, the cell population is administered after the one or more additional therapeutic agents.

[0307] With respect to cancer treatment, combination cancer therapies can include, but are not limited to, cancer chemotherapeutic agents, cytotoxic agents, hormones, anti-angiogenic agents, radiolabeled compounds, immunotherapy, surgery, cryotherapy, and / or radiation therapy.

[0308] Conventional cancer chemotherapeutic agents include alkylating agents, antimetabolites, anthracyclines, topoisomerase inhibitors, microtubule inhibitors, and B-raf enzyme inhibitors.

[0309] Alkylating agents include nitrogen mustards (such as mechlorethamine, cyclophosphamide, ifosfamide, melphalan, and chlorambucil), ethyleneamine and methyleneamine derivatives (such as altretamine, thiotepa), alkyl sulfonates (such as busulfan), nitrosoureas (such as carmustine, lomustine, estramustine), triazenes (such as dacarbazine, procarbazine, temozolomide), and platinum-containing antineoplastic agents (such as cisplatin, carboplatin, oxaliplatin, etc.).

[0310] Antimetabolites include 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), capecitabine (Xeloda®), cytarabine (Ara-C®), floxuridine, fludarabine, gemcitabine (Gemzar®), hydroxyurea, methotrexate, and pemetrexed (Alimta®).

[0311] Anthracyclines include daunorubicin, doxorubicin (Adriamycin®), epirubicin, and idarubicin. Other antitumor antibiotics include actinomycin-D, bleomycin, mitomycin-C, and mitoxantrone.

[0312] Topoisomerase inhibitors include topotecan, irinotecan (CPT-11), etoposide (VP-16), teniposide, or mitoxantrone.

[0313] Microtubule inhibitors include estramustine, ixabepilone, taxanes (such as paclitaxel, docetaxel, and cabazitaxel), and vinca alkaloids (such as vinblastine, vincristine, vinorelbine, vindesine, and vinflunine).

[0314] B-raf enzyme inhibitors include vemurafenib (Zelboraf), dabrafenib (Tafinlar), and encorafenib (Braftovi).

[0315] Immunotherapies include, but are not limited to, immune checkpoint modulators (i.e., inhibitors and / or agonists), cytokines, immunomodulatory monoclonal antibodies, and cancer vaccines.

[0316] Preferably, administration of cells in adoptive T cell therapy according to the present disclosure is combined with administration of an immune checkpoint modulator, such as an inhibitor (e.g., an antibody that specifically binds to and inhibits activity) of EP2 / 4 adenosine receptors, including PD-1, CTLA4, LAG3, BTLA, OX2R, TIM-3, TIGIT, LAIR-1, PGE2 receptor, and / or A2AR. Preferably, the immune checkpoint modulator comprises an anti-PD-1 and / or anti-PDL-1 inhibitor (e.g., an anti-PD-1 and / or anti-PDL-1 antibody).

[0317] The present disclosure also relates to the use of a composition comprising a genetically engineered immune cell as described herein for the manufacture of a medicament for treating cancer, an infectious disease or condition, an autoimmune disease or condition, or an inflammatory disease or condition in a subject. EXAMPLES

[0318] Example 1 Inactivation of SUV39H1 in human CD8+ T cells (SUV39H1 knockout T cells) Activated human CD8+ T cells or their progenitors are electroporated with Cas9 ribonucleoprotein particles (RNPs) containing gRNAs targeted to delete an exon of the SUV39H1 gene (SEQ ID NO: 15). A consistent decrease in SUV39H1 expression was observed by RT-qPCR 4 days after electroporation, indicating a successful knockout, as shown in Example 1B below.

[0319] The memory phenotype of SUV39H1KO T cells is evaluated. Cells are stimulated with aCD3+aCD28 beads for one week and then analyzed by flow cytometry. Central memory T cell markers CCR7, CD27 and CD62L show increased levels of expression in SUV39H1KO cells. The fraction of CCR7+CD45RO+CD27+CD62L+ cells, which constitute the central memory cell subset, is increased in SUV39H1 KO cells. Increased persistence and reduced exhaustion are evaluated by stimulating cells once a week for four weeks. SUV39H1KO cells continue to show increased proliferation after a series of stimulations, as shown in Example 2D below.

[0320] Example 1A In one example experiment, pan CD3+ (negatively isolated) T cells from two healthy donors were rapidly thawed on day 0 and activated in X-vivo T cell medium supplemented with IL-7 (450 U / ml), IL-15 (60 U / ml) and TransAct (1:100). Approximately 24 hours after activation (day 1), T cells were electroporated with CRISPR-Cas9 ribonucleoprotein particles (RNPs) containing either a scrambled (control) gRNA, designated "scr," or a SUV39H1 gRNA targeting exon 2 of the SUV39H1 gene, designated "SUV KO." T cells contacted with the scrambled gRNA retain functional SUV39H1, while T cells contacted with the SUV39H1-targeting gRNA contain inactivated SUV39H1. Cells were then transduced with vectors to produce modified TCRs as described in Example 2A below.

[0321] Example 1B SUV39H1 protein depletion in HIT T cells prepared according to Examples 1A and 2A was assessed by Western blot. Proteins from transduced T cells were collected on the last day of expansion before freezing. Cells were washed with PBS containing protease inhibitors, lysed with SDS lysis buffer and passed through a Qiashredder column. Lysates were quantified for protein, resuspended in 4× Laemmli buffer under reducing conditions, separated in a 10% protein gel and then transferred to a nitrocellulose membrane. Membranes were blocked and then incubated overnight with SUV39H1-specific primary antibody or GAPDH loading control antibody. After washing, membranes were incubated with the corresponding HRP-conjugated secondary antibody, washed several times in TBS-T and developed by addition of ECL substrate according to the manufacturer's instructions.

[0322] Figure 5 illustrates that cells electroporated with SUV39H1-targeting gRNA showed efficient knockdown of SUV39H1. HiT cells electroporated with SUV39H1-targeting gRNA showed depletion of SUV39H1 protein levels in contrast to HiT cells electroporated with scrambled control gRNA (Figure 5A). An average of 90-95% reduction in SUV39H1 protein was observed in SUV39H1 KO T cells (transduced with either HiT or HiT booster) compared to the scrambled control (Figure 5B, average of two donors). These data indicate efficient gene editing of SUV39H1 in HiT / HiT booster T cells.

[0323] Example 2 Introduction of engineered TCR Concurrently with or consecutively to the SUV39H1 knockout, cells are transduced with a donor viral vector containing the insert of FIG. 2A (VH-TRBC, VL) with complementary homology arms to the flanking regions that are sufficiently homologous to facilitate the integration of novel sequences, for example, next to TRAC exon 1 (SEQ ID NO: 17). VH and VL comprise, for example, an antigen-binding fragment of an antibody that specifically binds to CD19. Using CRISPR-Cas9 RNP, a CAR gene was introduced into the T cell receptor alpha constant (TRAC) locus, as shown in Eyquem et al., Nature 543:113:117 (2017), resulting in T cells with significantly reduced or nearly eliminated expression of the endogenous TCR. The resulting T cells express the CAR under the control of the endogenous TRAC promoter.

[0324] The percentage of cells expressing the modified TCR is assessed, and as shown in Example 2B below, a significant number of cells express the modified TCR. Endogenous TCR expression is also assessed and is reduced.

[0325] The properties of SUV39H1KO cells expressing the modified TCR are assessed for killing of cells expressing the target antigen, e.g., CD19-positive Raji cells or CD19-positive NALM-6 cells, in vitro and / or in vivo in mice.

[0326] The T cells generated displayed both knock-in of the modified TCR into the TRAC locus and specific deletion of SUV39H1.

[0327] Example 2A In one experimental example, T cells carrying either (1) a functional SUV39H1 gene or (2) an inactivated SUV39H1 gene prepared as described above were further modified to express a HI-TCR specific for the mesothelin antigen. Two days after the first round of electroporation, T cells were transfected with a scrambled (control) gRNA designated "scr" or a TRAC gRNA designated "TRAC KO" (targeting the TRAC locus) (Mansilla-Soto, J., Eyquem, J., Haubner, S., et al., HLA-independent T cell receptors for targeting tumors with low antigen density. Nat Med 28:345-52). (2022), or exon 1 as described in. Approximately 24 hours later (day 3), T cells were electroporated with either (a) the insert in FIG. 2A (encoding the VH of an anti-mesothelin Ab, TRBC, a 2A self-cleaving linker, exon sequence sufficient to reconstitute the VL of an anti-mesothelin Ab and TRAC polypeptide, a 2A self-cleaving linker, a booster sequence (CD80)), "RV-66HiT booster" or "HiT booster." (b) were transduced with retroviral particles (donor viral vectors) containing the insert of FIG. 2A without the booster sequence (VH-TRBC-2A-VL-exon reconstructing TRAC), termed "RV-66HiT" or "HiT", or (c) were left by spinoculation onto retronectin-coated 6-well plates (untransduced control, "UT"). On day 4, cells were transferred into 6-well G-Rex, IL-7 (450 U / ml) and IL-15 (60 U / ml) in a total of 30 ml of X-vivo T cell medium.

[0328] Example 2B On day 8, cells were assessed for transduction efficiency by staining with recombinant mesothelin protein (FITC) and the transduction markers LNGFR (for gRV-66HiT) or CD80 (for gRV-66HiT booster). Cells were also assessed for CD3 reconstitution by staining with Pacific Blue rodent anti-human CD3 antibody.

[0329] HiT+ cells were defined by binding to recombinant MSLN and stained for expression of LNGFR for HiT or CD80 for HiT booster (Figure 3). Figure 3 illustrates that transduced T cells show LNGFR (for gRV-66HIT) / CD80 (for gRV-66HIT booster) expression and bind to human MSLN-Fc fusion protein. SUV39H1 KO TRAC KO T cells transduced with HiT construct were approximately 42.3% HiT+ (average of two donors), while those transduced with Hit booster construct were 41.5% HiT+ at day 8. This transduction efficiency was comparable to the SUV39H1 WT counterpart (average of 55.4% for HiT and 49.2% for HiT booster (CD80) in this experiment (Figure 3).

[0330] Given that disruption of the endogenous TRAC locus results in a substantial decrease in cell surface CD3 expression, as shown in FIG. 4A (middle and bottom panels of untransduced compared to scr / scr controls in the top panel), an alternative method of defining HiT+ T cells was utilized. Reconstitution of CD3 complex expression along with MSLN binding was assessed. Indeed, partial CD3 reconstitution along with simultaneous binding to MSLN protein was observed in HiT-transduced cells. FIG. 4 illustrates that transduced T cells showed CD3 complex reconstitution and surface binding to recombinant mesothelin. Specifically, SUV39H1 KO TRAC KO T cells transduced with the HiT construct were approximately 50.8% HiT+ (average of two donors), while those transduced with the Hit booster construct (CD80) were 51.4% for HiT booster T cells at day 8. This transduction efficiency was comparable to the SUV39H1 WT counterpart (average, 61% for HiT and 58.9% for HiT booster) (Figure 4B).

[0331] Example 2C Cytotoxic activity A luciferase-based assay was used to evaluate the cytotoxic capacity of anti-MSLN HiT+ cells against MSLN+ and MSLN- target cells. Target cells were plated in 96-well plates containing HiT+ effector T cells at 2-fold dilutions ranging from 2:1 to 1:64 E:T ratios in a total volume of 200 uL at 1 × 10 cells. 4 SUV39H1 KO HiT+ T cells were seeded at a density of 10 ...

[0332] In addition, booster-free SUV39H1 KO HiT+ cells exhibited cytotoxic potency comparable to HiT booster+ T cells with or without SUV39H1. Importantly, this cytotoxicity was specific to the presence of target expression, as MSLN-line HEK293T cells did not induce responses from HiT+ cells (SUV39H1KO or WT, in the presence or absence of booster). Notably, this data indicates that SUV39H1 inactivation enhanced immune cell cytotoxic activity to the same extent as the chimeric booster receptor.

[0333] Example 2D Repeated stimulation assay To analyze T cell proliferation and persistence, SUV39H1 KO and control HiT+ cells were stimulated with the MSLN+ target cell line at an E:T ratio of 1:2. Three days after priming, the number of HiT-booster+ cells was counted by flow cytometry using counting beads and anti-LNGFR or CD80 specific antibodies. Transduced T cells were also stained with antibodies specific for CD4, CD8, CCR7, CD27 and CD45RO before analysis by flow cytometry. Cells were also stained with CD33 to exclude target cells. T cells were then restimulated every 3-4 days under the same conditions. These steps were repeated until day 36 after priming. To address the persistence and functionality of SUV-deficient HiT-booster cells, both WT and SUV39H1 KO HiT-booster T cells were exposed to repeated antigen challenge with Nomo-1 target cells that endogenously express the MSLN+ target system.

[0334] At day 8 (FIG. 9A), SUV39H1 WT HiT-booster cells showed slightly increased expansion compared to SUV39H1 KO HiT-booster cells. However, by day 19, SUV39H1 KO HiT-booster cells out-proliferated SUV39H1 WT cells and continued to expand at later time points such as days 22 and 26. In addition, in contrast to SUV39H1 WT HiT-booster cells, SUV39H1 KO HiT-booster cells continued to suppress MSLN+ target cell proliferation until day 36 (FIG. 9B). SUV39H1 KO HiT-booster cells also showed an increased percentage of CD27+ CD45RO+ and CCR7+ CD45RO+ memory cells, indicating an increase in the central memory HiT-booster+ T cell population (FIGS. 9C and 9D). This enhanced memory phenotype was observed at various time points before (day 0) and after (days 15 and 22) stimulation with MSLN+ target cells. The persistence of CD8+HiT-booster+ cells was followed over repeated rounds of stimulation. At later time points (day 26 onwards), SUV39H1 KO HiT-booster+ cells showed an increased CD8 / CD4 ratio (Figure 9E), suggesting preferential persistence of CD8+HiT-booster+ T cells upon depletion of SUV39H1.

[0335] Repeated experiments in unrelated donors (Figure 8) showed consistent trends in increased T cell proliferation and target killing along with enhanced memory phenotype and persistence of CD8+HiT booster+ cells.

[0336] FIG. 7 also illustrates that SUV39H1-deficient gRV-66HIT cells exhibit increased T cell expansion, persistence, memory and target killing capacity upon repeated antigen exposure using the NOMO-1 targeting system, compared to wt(src gSUV) gRV-66HIT cells.

[0337] These results were confirmed again for another donor with gRV-66HiT and with the gRV-66HiT booster (Figure 10).

[0338] Together, these results show that SUV39H1KO HiT + These results show that the cells (in the presence or absence of booster constructs) exhibit better persistence, killing and memory than their WT counterparts.

[0339] (Examples 3 to 4) Generation and validation of gammaretroviral (gRV) HIT constructs targeting PSMA (mJ591 HIT) or CD19 (FMC63 HIT) for random integration Cells were electroporated using a Lonza nucleofector using CRISPR / Cas9 to KO SUV39H1 and TRAC in a single step on day 2. On day 3, T cells were transduced with gammaretroviruses encoding FMC63 HIT, mJ591 HIT, FMC63 HIT+booster, and mJ591 HIT+booster (CD80_4-1BB).

[0340] A schematic of the gammaretroviral (gRV) HIT constructs used herein is shown in Figure 11. Construct A contains the transduction marker LNGFR. Construct B contains the booster molecule.

[0341] Western blots of SUV39H1 confirmed effective SUV-KO (see FIG. 12) in representative samples of FMC63-HiT+booster and mJ591-HiT+booster (CD80_4-1BB) engineered T cells. Western blots (FIG. 12C) confirm knockout of the 48 kDa SUV39H1 band (lower band, highlighted by black box).

[0342] T cells were transduced with gRV-FMC63-HiT and gRV-FMC63-HiT+booster constructs (Figure 13). Dot plots show gRV-FMC63-HiT (left) and gRV-FMC63-HiT+booster cells when transduced with their respective viruses based on either LNGFR or booster expression (Figure 13A). Successful TRAC-KO can be observed with a reduction in CD3 when compared to the expression markers (Figure 13B, reduction of the CD3+ population as in Figure 4).

[0343] HIT T cells expressing the FMC63 HIT construct specifically bind recombinant CD19 protein (see FIG. 14). TRACKO / scrambled (SCR) and TRACKO / SUVKO samples were incubated with recombinant biotinylated CD19 protein and stained with streptavidin-A647. Both gRV-FMC63-HiT and gRV-FMC63-HiT+booster showed similar binding to recombinant CD19 protein in combination with their respective expression markers (LNGFR and booster).

[0344] T cells were transduced with gRV-mJ591-HiT (left) and gRV-mJ591-HiT+booster constructs (Figure 15). (A) Dot plots show gRV-mJ591-HiT (left) and gRV-mJ591-HiT+booster cells when transduced with their respective viruses based on LNGFR or booster expression. (B) Successful TRAC-KO was observed with a reduction in CD3 when compared to expression markers (same reduction in CD3+ population as in Figure 4).

[0345] mJ591-HiT T cells specifically bound recombinant PSMA protein (Figure 16). (A) TRACKO / scrambled (SCR) and (B) TRACKO / SUVKO samples were incubated with recombinant biotinylated PSMA protein and stained with streptavidin-A647.

[0346] SUV-KO HiT samples exhibited increased killing compared to scrambled (SCR) controls in kinetic killing assays. TRAC-KO-scrambled and TRAC-KO-SUV-KO or gRV-FMC63-HiT+ booster cells were co-cultured with GFP+ LNCaP-19 target system at 1:20 E:T in 96-well plates and placed in InCucyte for 7 days for GFP detection. Non-transduced T cells were used as negative control (Figure 17). TRAC-KO-scrambled and TRAC-KO-SUV-KO (Figure 18A) gRV-mJ591-HiT or (Figure 18B) gRV-mJ591-HiT+ booster cells were co-cultured with GFP+ LNCaP-19 target system at 1:20 E:T in 96-well plates and placed in InCucyte for 7 days for GFP detection. Non-transduced T cells were used as negative control.

[0347] SUV-KO cells showed increased killing after the second stimulation compared to the scrambled (SCR) control in a kinetic killing assay (Figure 19). TRAC-KO-scrambled and TRAC-KO-SUV-KO gRV-FMC63-HiT cells that had already received the first antigen stimulation were filtered using a 20 μM filter and FACS analyzed to determine the % of HiT+ cells. These gRV-FMC63-HiT+ booster cells were co-cultured with GFP+ LNCap-19 target cells at two different E:T ratios: (A) 1:5 and (B) 1:10 in 96-well plates and placed in InCucyte for 7 days for GFP detection. "Target cells only" was used as a negative control for these experiments.

[0348] TRAC-KO-SUV-KO gRV FMC63-HiT+ booster T cells showed increased expansion compared to the scrambled (SCR) control (Figure 20). TRAC-KO-scrambled and TRAC-KO-SUV-KO gRV-FMC63-HiT+ booster cells were co-cultured with GFP+ LNCap-19 target cells at the indicated E:T ratios in 96-well plates and placed in InCucyte for 7 days for GFP detection. After 7 days, the co-cultures were subjected to FACS analysis for cell counting.

[0349] SUV-KO gRV HiT cells exhibited an enhanced memory-related profile, a reduced effector-like profile and a reduced exhaustion marker phenotype compared to scrambled (SCR) controls after production (Figure 21). (A) Phenotype of gRV TRAC-KO and scrambled / SUV-KO FMC63-HiT+booster and (B) gRV mJ591-HiT+booster T cells 15 days after initial T cell activation. Cells were gated using the following gating strategy: (A) and (B) lymphocyte + Singlet + alive + CD4 + / - CD8 + / - Booster + CD45RO + , and analyzed for surface marker expression. CCR7 and CD27 expression were analyzed to confirm stemness and degradation as appropriate. CM: central memory, Ttm: transitional memory, and EM: effector memory. (C) and (D) Lymphocytes were analyzed for CD57 and TIM3, respectively. + Singlet + alive + CD4 + / - CD8 + / - Booster + .

[0350] SUV-KO gRV HiT cells exhibited an enhanced memory-related profile, a reduced effector-like profile and a reduced exhaustion marker phenotype compared to scrambled (SCR) controls after the first round of antigen stimulation (Figure 22). (A) gRV TRAC-KO and scrambled / SUV-KO FMC63-HiT+ boosters and (B) gRV mJ591-HiT+ boosters were co-cultured with GFP+ LNCap-19 target line at various E:T ratios. The following gating strategies were used: (A) and (B) lymphocyte + Singlet + alive + CD4 + / - CD8 + / - Booster +CD45RO + Analysis of surface marker expression in lymphocytes 7 days after plating. CCR7 and CD27 expression were analyzed appropriately to confirm stemness and degradation. CM: central memory, Ttm: transitional memory, and EM: effector memory. (C) and (D) Lymphocyte surface marker expression for CD57 and TIM3, respectively. + Singlet + alive + CD4 + / - CD8 + / - Booster +

[0351] SUV-KO gRV HiT cells displayed an enhanced memory-related profile, a reduced effector-like profile, and a reduced exhaustion marker phenotype compared to scrambled (SCR) controls after the second round of antigen stimulation (Figure 23). TRAC-KO-scrambled and TRAC-KO-SUV-KO gRV-HiT+ booster cells that had already received the first round of antigen stimulation were filtered using a 20 μM filter and FACS analyzed to determine the % of HiT+ cells. These gRV-HiT+ booster cells were cocultured 1:5 (HIT T cells 1.5e) with the GFP+ LNCap-19 target line. 3 and target cells 7.5e 3 The cells were co-cultured in 96-well plates at an E:T ratio of 100-1500 cells / mL and placed in InCucyte for 7 days for GFP detection. Graphs (A) and (C) show gRV FMC63-HiT+ booster cells, and graphs (B) and (D) show gRV mJ591-HiT+ booster cells. The following gating strategies were used: (A) and (B) lymphocytes. + Singlet + alive + CD4 + / - CD8 + / - Booster + CD45RO +Analysis of surface marker expression in lymphocytes 7 days after plating. CCR7 and CD27 expression were analyzed appropriately to confirm stemness and degradation. CM: central memory, Ttm: transitional memory, and EM: effector memory. (C) and (D) Lymphocyte surface marker expression for CD57 and TIM3, respectively. + Singlet + alive + CD4 + / - CD8 + / - Booster + ).

[0352] Example 5 Generation of TRAC-HIT cells containing inactivated SUV39H1 Another approach for the generation of HIT cells uses a knock-in approach to the TRAC locus. Briefly, an adeno-associated virus (HIT-AAV) vector repair matrix was designed that contains left and right homology arms (Mansilla-Soto et al., Nat Med 2022 February; vol. 28(2): pp. 345-352). This targeting construct (HIT-AAV) contains a splice acceptor site followed by a P2A cleavage peptide connected to TRAC exon 1 and CD19-specific HIT gene elements (VH-Cβ gene followed by P2A and VL genes); all flanked by sequences homologous to the TRAC locus (left and right homology arms: LHA and RHA). In the presence of Cas9 ribonucleoparticles that target the TRAC locus and mediate double-strand breaks, the DNA repair machinery integrates the HIT-AAV matrix. Upon integration, VH-Cβ and VL-Cα expression is driven by the endogenous TCRα promoter and polyA element, while endogenous TCRα expression is abolished (Figure 24). The VH-Cβ and VL-Cα chains associate to form HIT heterodimers, which are confirmed by CD3 expression at the cell surface. The approach can be multiplexed by using additional Cas9 RNPs targeting other loci, namely SUV39H1 (Figure 24). TRAC-HIT cells targeted to CD19 and lacking SUV39H1 were generated from two different donors (Figure 25A). In the presence of the 19-HIT-AAV repair matrix, successful reconstitution was detected as seen by a double positive CD3+TCRαβ+ population. TRAC-19-HIT-SUVKO T cells had low levels of SUV39H1 protein (Figure 25B) and low levels of H3K9me3 (Figure 25C).

[0353] Thus, TRAC-19-HIT T cells that were either sufficient (SCR) or deficient for SUV39H1 (SUVKO) were successfully generated and then cryopreserved for future use.

[0354] Example 6 SUV39H1 KO HIT T cells have an enhanced memory phenotype in vitro TRAC-19-HIT T cells, either sufficient (SCR) or deficient for SUV39H1 (SUVKO), were thawed in culture medium at 37° C. for 2 hours. Cells were then tested for viability and HIT expression. Biotinylated CD19 soluble molecules were used to determine HIT expression on the cell surface. Both SCR and SUVKO T cells showed good viability and reactivity with soluble CD19 (FIG. 26A). TRAC-19-HIT T cells were then used in an in vitro co-culture assay with NALM6 cells at various effector:target cell ratios (effector determined by percentage of CD19 reactivity) for 10 days (FIG. 26B). After completion of the assay, TRAC-19-HIT cells were phenotyped by flow cytometry. TRAC-19-HIT-SUVKO T cells showed an increase in the percentage of CD27+ cells compared to TRAC-19-HIT-SCR T cells (FIG. 26C).

[0355] Thus, SUV39H1 inactivation enhances the memory phenotype of TRAC-19-HIT cells.

[0356] Example 7 SUV39H1 KO HIT T cells are better at rejecting liquid tumors. To investigate the effect of SUV39H1 inactivation on HIT T cell antitumor efficacy at various levels of antigen, a xenogeneic model of acute lymphoblastic leukemia (ALL) in NSG mice was used. Briefly, female NSG mice were inoculated with 5 × 10 NALM6-Luc cells expressing either wild-type levels of CD19 (20,000 molecules per cell) (WT) or low levels of CD19 (200 molecules per cell) (LOW). 5were injected via the tail vein on D0 (Mansilla-Soto et al., Nat Med 2022 Feb;28(2):345-352). On D3, tumor burden was measured by bioluminescence imaging using a Xenogen IVIS Imaging System (PerkinElmer). The acquired bioluminescence data was analyzed using Living Image software (PerkinElmer) and expressed as mean radiant radiance (photons / sec / cm2 / sr), and mice were randomized into groups. On the same day, TRAC-19-HIT T cells, either sufficient (SCR) or deficient for SUV39H1 (SUVKO), were injected via the tail vein (Figure 27A). Tumor burden was then assessed once or twice a week.

[0357] cells 5×10 5 At this dose, TRAC-19-HIT-SUVKO T cells rejected NALM6-WT cells better than TRAC-19-HIT-SCR T cells (Figure 27B) and increased mouse survival (Figure 27C).

[0358] FIG. 28 shows the results of the comparison of 5×10 TRAC-19-HIT cells to NALM6-LOW cells. 5 The responses are shown in Fig. 28B. SUVKO cells showed slightly stronger rejection of NALM6-LOW cells in vivo (Fig. 28B, right panel). Thus, SUV39H1 inactivation enhances the antitumor function of TRAC-19-HIT T cells against liquid tumors, even at low antigen density.

[0359] Together, the results provided herein demonstrate that SUV39H1 deletion (e.g., Suv KO) unexpectedly enhances the in vivo persistence, killing and memory phenotype of Hi-TCR T cells, even in the absence of a CCR (booster) receptor.

[0360] Example 8 Cells with inactivated SUV39H1 and reduced ITAM activity CD3 zeta polypeptides are engineered to be deficient in ITAM2 and ITAM3, either simultaneously or sequentially with SUV39H1 knockout, using CRISPR-Cas9 RNP targeting the gene encoding amino acids 90-164 of CD3 zeta (SEQ ID NO: 7) for deletion. The resulting cells are assessed for central memory cell phenotype (CCR7+CD45RO+CD27+CD62L+), proliferation after continuous stimulation, and exhaustion traits (TIM-3, PD-1, LAG-3 expression). The addition of 1XX results in further improvement of cytotoxic activity.

[0361] array SEQ ID NO:1: Human (Homo sapiens) T cell receptor alpha delta locus (TCRA / TCRD) on chromosome 14 SEQ ID NOs: 2-3: Human T cell receptor beta locus (TRB) on chromosome 7 SEQ ID NO: 4: TRAC polypeptide SEQ ID NOs: 5-6 TRBC polypeptide SEQ ID NO:5: TRBC1 SEQ ID NO: 6: TRBC2 SEQ ID NO:7 CD3 zeta polypeptide, e.g., a modified CD3 zeta polypeptide SEQ ID NO: 8-9: CD28 SEQ ID NO: 10-11: 4-1BB SEQ ID NO: 12: ICOS SEQ ID NO: 13: OX40 SEQ ID NO: 14: CD80 costimulatory ligand SEQ ID NO: 15: Human SUV39H1 gene SEQ ID NO: 16: SUV39H1 human protein sequence SEQ ID NO: 17: TRAC exon 1 SEQ ID NO: 18: p95HER2 extracellular domain: MPIWKFPDEEGACQPCPINCTHSCVDKDDKGCPAEQRASPLT. SEQ ID NO: 19: Exemplary linker sequence GGGSGGGGSGGGGGS SEQ ID NO: 20: IL-2 signal sequence (human) MYRMQLLSCIALSLALVTNS SEQ ID NO: 21: IL-2 signal sequence (mouse) MYSMQLASCVTLTLVLLVNS SEQ ID NO:22 Kappa leader sequence (human) METPAQLLFLLLLWLPDTT G SEQ ID NO:23 Kappa leader sequence (mouse) METDTLLLWVLLLWVPGSTG SEQ ID NO: 24 CD8 leader sequence MALPVTALLLPLALLLHAARP SEQ ID NO: 25 Truncated human CD8 signal peptide: MALPVTALLLPLALLLHA SEQ ID NO: 26 Albumin signal sequence: MKWVTFISLLFSSAYS SEQ ID NO: 27: Prolactin signal sequence: MD SKGS SQKGSRLLLLLVV SNLLLCQGVV S SEQ ID NO: 28: Mouse TRBC nucleotide sequence

[0362] [ka]

[0363] SEQ ID NO: 29: Mouse TRBC aa sequence

[0364] [ka]

[0365] SEQ ID NO: 30: Mouse TRAC1 nucleotide sequence

[0366] [ka]

[0367] SEQ ID NO: 31: Mouse TRAC1 aa sequence

[0368] [ka]

[0369] SEQ ID NO: 32: CD80-4-1BB booster nucleotide sequence

[0370] [ka]

[0371] SEQ ID NO: 33: CD80-4-1BB booster aa sequence

[0372] [ka]

[0373] The sequences utilized for AAV6 HIT for KI at the TRAC locus were described herein: Mansilla-Soto et al., https: / / doi.org / 10.1038 / s41591-021-01621-1 SEQ ID NO: 34: SJ25C1 nucleotide VH

[0374] [ka]

[0375] SEQ ID NO: 35: SJ25C1 nucleotide VL

[0376] [ka]

[0377] SEQ ID NO: 36: SJ25C1 aa VH

[0378] [ka]

[0379] SEQ ID NO: 37: SJ25C1 aa VL

[0380] [ka]

[0381] The sequence for the gRV HIT is as follows: SEQ ID NO: 38: FMC63 nucleotide VH

[0382] [ka]

[0383] SEQ ID NO: 39: FMC63 nucleotide VL

[0384] [ka]

[0385] SEQ ID NO: 40: FMC63 aa VH

[0386] [ka]

[0387] SEQ ID NO: 41: FMC63 aa VL

[0388] [ka]

[0389] SEQ ID NO: 42: mJ591 nucleotide VH

[0390] [ka]

[0391] SEQ ID NO: 43: mJ591 nucleotide VL

[0392] [ka]

[0393] SEQ ID NO: 44: mJ591 aa VH

[0394] [ka]

[0395] SEQ ID NO: 45: mJ591 aa VL

[0396] [ka]

[0397] SEQ ID NO: 46: TRAC nucleotide

[0398] [ka]

[0399] SEQ ID NO: 47: TRAC nucleotide

[0400] [ka]

[0401] SEQ ID NO: 48: TRAC (aa)

[0402] [ka]

[0403] SEQ ID NO: 49: TRBC nucleotide

[0404] [ka]

[0405] SEQ ID NO: 50: TRBC aa

[0406] [ka]

[0407] SEQ ID NO: 51: P2A (nt) Ggctctggcgctaccaatttttccctcctcaaacaggctggagatgtcgaagagaaccccggacct SEQ ID NO: 52: CD8 alpha (nt) Atggctctcccagtgactgccctactgcttcccctagcgcttctcctgcatgcagccaggccg SEQ ID NO: 53: CD80 booster (nt)

[0408] [ka]

[0409] SEQ ID NO: 54: CD80 booster (aa)

[0410] [ka]

[0411] SEQ ID NO: 55: lncRNA AF196970.3 cDNA sequence

[0412] [ka]

Claims

1. 1. An engineered immune cell expressing an antigen-specific receptor, which is an engineered TCR comprising a heterologous antigen-binding domain that specifically binds to a target antigen: (a) the immune cell has an inactivated SUV39H1 gene; and (b) optionally, the antigen-specific receptor comprises a single active ITAM domain; Engineered immune cells.

2. 2. The modified immune cell of claim 1, comprising a nucleic acid encoding a SUV39H1 inhibitor, optionally comprising (a) a dominant negative SUV39H1 gene, or (b) an RNAi, lncRNA, shRNA, ribozyme, or antisense oligonucleotide complementary to a fragment of the SUV39H1 gene.

3. 3. The modified immune cell of claim 1 or 2, wherein the SUV39H1 gene contains one or more mutations that result in a deleted or non-functional SUV39H1 protein.

4. 2. The modified immune cell of claim 1, wherein the SUV39H1 gene is inactivated by contacting the immune cell with a SUV39H1 inhibitor, optionally an inhibitor of the epipolythiodioxopiperazine (ETP) class, such as an epidithiodioxopiperazine alkaloid or ETP69.

5. Antigen-specific receptors (a) an antigen-binding fragment of an antibody, optionally a first antigen-binding chain comprising a heavy chain variable region (VH); and (b) an antigen-binding fragment of an antibody, optionally a second antigen-binding chain comprising a light chain variable region (VL); A modified TCR comprising: The first and second antigen binding chains comprise a TRAC polypeptide or a TRBC polypeptide, respectively, and optionally at least one of the TRAC polypeptide and the TRBC polypeptide is endogenous, and optionally one or both of the endogenous TRAC and TRBC polypeptides are inactivated.

5. The modified immune cell of any one of claims 1 to 4.

6. 6. The modified immune cell of any one of claims 1 to 5, wherein the modified TCR comprises (a) a VH or fragment thereof linked to a TCR beta constant region having at least 90% sequence identity to SEQ ID NO: 5 or 6, and (b) a VL or fragment thereof linked to a TCR alpha constant region having at least 90% sequence identity to SEQ ID NO: 4, and optionally (c) a CD3 zeta polypeptide comprising a single ITAM, optionally a CD3 zeta polypeptide comprising a deletion of amino acids 90 to 164 of SEQ ID NO:

7.

7. The antigen-binding domain is approximately 1 × 10 -7 Below, about 5×10 -8 Below, approximately 1×10 -8 Below, about 5×10 -9 Below, approximately 1×10 -9 Below, about 5×10 -10 Below, approximately 1×10 -10 Below, about 5×10 -11 Below, approximately 1×10 -11 Below, about 5×10 -12 Less than or equal to about 1×10 -12 7. The modified immune cell of any one of claims 1 to 6, which binds to an antigen with a KD affinity of:

8. 8. The modified immune cell of any one of Claims 1 to 7, comprising a second antigen-specific receptor that binds to a second target antigen.

9. SUV39H1 cells: (a) an extracellular antigen-binding domain; (b) a transmembrane domain, (c) optionally one or more costimulatory domains, and (d) an intracellular signaling domain, optionally comprising a modified CD3 zeta intracellular signaling domain in which ITAM2 and ITAM3 are inactivated.

9. The modified immune cell of any one of claims 1 to 8, which also expresses a chimeric antigen receptor (CAR), comprising:

10. 10. The modified immune cell of any one of claims 1 to 9, further comprising a costimulatory receptor, optionally comprising: (a) the extracellular and transmembrane domains of CD86, 41BBL, CD275, CD40L, OX40L, PD-1, TIGIT, 2B4, or NRP1, and (b) an intracellular costimulatory molecule of CD28, 4-1BB, 0X40, ICOS, CD27, CD40, or CD2; or optionally a receptor comprising a CD80 costimulatory ligand (SEQ ID NO: 14) and a 4-1BB costimulatory molecule (SEQ ID NO: 10), optionally comprising a receptor of SEQ ID NO:

33.

11. 11. The modified immune cell of any one of claims 1 to 10, wherein a nucleic acid encoding a heterologous antigen-binding domain or an antigen-specific receptor is inserted into the endogenous TRAC locus and / or TRBC locus of the immune cell, and optionally the nucleic acid is operably linked to an endogenous TCR promoter.

12. 12. The modified immune cell of any one of claims 1 to 11, wherein insertion of a nucleic acid sequence encoding the antigen-specific receptor and / or the antigen-binding domain disrupts or eliminates endogenous expression of a TCR comprising a native TCR alpha chain and / or a native TCR beta chain.

13. 13. The modified immune cell of any one of claims 1 to 12, wherein the antigen has a low density on the cell surface, less than about 10,000 molecules, or less than about 5,000 molecules, or less than about 2,000 molecules per cell.

14. 14. The modified immune cell of any one of claims 1 to 13, wherein the cell is a T cell, a CD4+ T cell, a CD8+ T cell, a CD4+ and CD8+ T cell, a NK cell, a Treg cell, a Tm cell, a memory stem cell (TSCM), a TCM cell, a TEM cell, a T cell progenitor cell, a NK cell progenitor cell, a pluripotent stem cell, an induced pluripotent stem cell (iPSC), a hematopoietic stem cell (HSC), an adipose-derived stem cell (ADSC), or a pluripotent stem cell of myeloid or lymphoid lineage.

15. The extracellular antigen binding domains include those that bind to orphan tyrosine kinase receptor ROR1, tEGFR, Her2, p95HER2, LI-CAM, CD19, CD20, CD22, mesothelin, CEA, claudin 18.2, hepatitis B surface antigen, antifolate receptor, CD23, CD24, CD30, CD33, CD38, CD44, CD70, EGFR, EGP-2, EGP-4, EPHa2, ErbB2, 3 or 4, FcRH5, FBP, fetal acetylcholine e receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, BCMA, Lewis 15. The modified immune cell of any one of claims 1 to 14, wherein the extracellular antigen binding domain binds to Y, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D ligand, NY-ESO-1, MART-1, gplOO, oncofetal antigen, TAG72, VEGF-R2, carcinoembryonic antigen (CEA), prostate specific antigen (PSMA), estrogen receptor, progesterone receptor, ephrin B2, CD123, CS-1, c-Met, GD-2, MAGE A3, CE7 or Wilms Tumor 1 (WT-1), or optionally wherein the extracellular antigen binding domain binds to any of the tumor neoantigenic peptides disclosed in WO 2021 / 043804.

16. 16. The modified immune cell of any one of claims 1 to 15, wherein SUV39H1 expression or SUV39H1 protein activity is reduced by at least about 50%, 60%, 70%, 75%, 80%, 85%, 90% or 95%.

17. 17. The modified immune cell of any one of claims 1 to 16, wherein endogenous TCR expression is reduced by at least about 75%, 80%, 85%, 90%, or 95%.

18. 18. The modified immune cell of any one of claims 1 to 17, wherein the immune cell is autologous.

19. 19. The modified immune cell of any one of claims 1 to 18, wherein the immune cell is allogeneic.

20. 20. The modified immune cell of any one of claims 1 to 19, wherein the HLA-A locus is inactivated.

21. 21. The modified immune cell of any one of claims 1 to 20, wherein HLA class I expression is reduced by at least about 75%, 80%, 85%, 90%, or 95%.

22. 22. A sterile pharmaceutical composition comprising the modified immune cell of any one of claims 1 to 21.

23. 23. A kit comprising the modified immune cells of any one of claims 1 to 22 and a delivery device or container.

24. 24. A method for treating a patient suffering from or at risk of an antigen-associated disease, optionally cancer, using the modified immune cell or pharmaceutical composition or kit of any one of claims 1 to 23, by administering a therapeutically effective amount of said immune cell or pharmaceutical composition to the patient.

25. The immune cells are T cells or NK cells, and the number of cells is about 5×10 7 less than 10 cells, optionally about 10 5 ~about 10 7 24. The method of claim 23, wherein a dose of cells is administered to the patient.

26. 25. The method of claim 23 or 24, wherein a second therapeutic agent, optionally one or more cancer chemotherapeutic agents, cytotoxic agents, hormones, anti-angiogenic agents, radiolabeled compounds, immunotherapy, surgery, cryotherapy, and / or radiation therapy, is administered to the patient.

27. 25. The method of claim 23 or 24, wherein an immune checkpoint modulator is administered to the patient.

28. 27. The method of claim 26, wherein the immune checkpoint modulator is an antibody that specifically binds to PD1, PDL1, CTLA4, LAG3, BTLA, OX2R, TIM-3, TIGIT, LAIR-1, PGE2 receptor, EP2 / 4 adenosine receptor, or A2AR, or other inhibitor thereof.

Images