Neisseria meningitidis compositions and methods

Abstract

To provide cross-protective vaccines or compositions effective to various MnB isolated strains.SOLUTION: In one aspect, the invention relates to a composition comprising a first polypeptide having the sequence set forth in SEQ ID NO:1 and a second polypeptide having the sequence set forth in SEQ ID NO:2. In one embodiment, the composition includes about 120 μg / ml of a first polypeptide including the amino acid sequence set forth in SEQ ID NO: 1, 120 μg / ml of a second polypeptide including the amino acid sequence set forth in SEQ ID NO: 2, about 2.8 molar ratio polysorbate-80 to the first polypeptide, about 2.8 molar ratio polysorbate-80 to the second polypeptide, about 0.5 mg / ml aluminum, about 10 mM histidine, and about 150 mM sodium chloride. In one embodiment, a dose of the composition is about 0.5 ml in total volume. In one embodiment, two-doses of the composition induce a bactericidal titer against diverse heterologous subfamily A and subfamily B strains in a human.SELECTED DRAWING: Figure 1

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of U.S. Provisional Patent Application No. 61 / 875,068, filed September 8, 2013, U.S. Provisional Patent Application No. 61 / 926,717, filed January 13, 2014, and U.S. Provisional Patent Application No. 61 / 989,432, filed May 6, 2014, each of which is incorporated herein by reference in its entirety.

[0002] FIELD OF THE INVENTION The present invention relates to Neisseria meningitidis compositions and methods. [Background technology]

[0003] Neisseria meningitidis is a Gram-negative, encapsulated bacterium that can cause septicemia, meningitis, and death. N. meningitidis can be classified into at least 12 serotypes (including serotypes A, B, C, 29E, H, I, K, L, W-135, X, Y, and Z) based on its chemically and antigenically distinctive polysaccharide capsule. Strains of five of the serotypes (A, B, C, Y, W135) are responsible for the majority of disease.

[0004] Meningococcal meningitis is a devastating disease that can kill children and young adults within hours, despite the availability of antibiotics. Improved immunogenic compositions against meningococcal serotypes A, B, C, Y, and W135 and / or X are needed.

[0005] To date, no cross-protective vaccines or compositions effective against a wide range of MnB isolates are commercially available. For example, previously published results for multicomponent compositions licensed for protection against serogroup B disease have not demonstrated a direct bactericidal immune response to multiple strains expressing heterologous LP2086(fHBP) variants, at least in adolescents. At best, previously published results for multicomponent compositions for protection against serogroup B disease appear to demonstrate immunogenicity only against LP2086(fHBP) variants that are homologous to those in the multicomponent composition. [Prior art documents] [Patent documents]

[0006] [Patent Document 1] U.S. Provisional Patent Application No. 61 / 875,068 [Patent Document 2] U.S. Provisional Patent Application No. 61 / 926,717 [Patent Document 3] U.S. Provisional Patent Application No. 61 / 989,432 [Patent Document 4] WO / 2012 / 032489 [Patent Document 5] WO / 2013 / 132452 [Patent Document 6] U.S. Patent Publication No. US20120093852 [Patent Document 7] U.S. Patent Publication No. US20130243807 [Patent Document 8] US Patent Publication US2012 / 0093852 [Patent Document 9] WO2012025873 [Patent Document 10] US Patent Publication US2013 / 0171194 [Patent Document 11] US Patent Publication US2009 / 0016946 [Patent Document 12] U.S. Patent No. 7,479,283 [Patent Document 13] WO1990 / 013313 [Patent Document 14] EP1666057B1 [Patent Document 15] U.S. Patent No. 5,820,870 [Non-patent literature]

[0007] [Non-Patent Document 1] UK Marketing Authorization PL06745 / 0121 Summary of the Invention [Problem to be solved by the invention]

[0008] Therefore, there is a need for cross-protective vaccines or compositions that are effective against diverse MnB isolates, as well as a need to demonstrate real-world vaccine coverage against a diverse or heterogeneous panel of meningococcal strains (e.g., representing different geographic regions). [Means for solving the problem]

[0009] To meet these and other needs, the present invention relates to Neisseria meningitidis compositions and methods.

[0010] In one aspect, the present invention relates to a composition comprising about 120 μg / ml of a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1, 120 μg / ml of a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2, about a 2.8 molar ratio of polysorbate 80 to the first polypeptide, about a 2.8 molar ratio of polysorbate 80 to the second polypeptide, about 0.5 mg / ml aluminum, about 10 mM histidine, and about 150 mM sodium chloride. In one embodiment, the initial dose is about 0.5 ml in total volume. In one embodiment, the composition elicits a bactericidal immune response against N. meningitidis serotype B. In one embodiment, the composition elicits a bactericidal immune response against N. meningitidis serotypes A, C, 29E, H, I, K, L, W-135, X, Y, or Z. In one embodiment, the composition does not further comprise a polypeptide having less than 100% sequence identity to SEQ ID NO:1. In one embodiment, the composition does not further comprise a polypeptide having less than 100% sequence identity to SEQ ID NO:2. In one embodiment, the first polypeptide has a total of 258 amino acids. In one embodiment, the second polypeptide has a total of 261 amino acids. In one embodiment, the composition induces a bactericidal titer of serum immunoglobulin in a human after receiving a first dose that is at least twice as strong as the bactericidal titer of serum immunoglobulin in the human before receiving the first dose, wherein the increase in bactericidal titer is measured under identical conditions in a serum bactericidal assay using human complement. In one embodiment, the first lipidated polypeptide consists of the amino acid sequence set forth in SEQ ID NO:1. In one embodiment, the second lipidated polypeptide consists of the amino acid sequence set forth in SEQ ID NO:2.

[0011] In another aspect, the present invention relates to a method of inducing an immune response against Neisseria meningitidis in a human. The method comprises administering to the human an initial and second dose of an effective amount of a composition comprising 120 μg / ml of a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1, 120 μg / ml of a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2, polysorbate 80 in a molar ratio of 2.8 relative to the first polypeptide, polysorbate 80 in a molar ratio of 2.8 relative to the second polypeptide, 0.5 mg / ml aluminum, 10 mM histidine, and 150 mM sodium chloride. In one embodiment, the dose of the composition has a total volume of 0.5 ml. In one embodiment, the human is administered at most two doses of the composition. In one embodiment, the human does not receive a further booster dose of the composition. In one embodiment, the human is administered a third dose of the composition. In one embodiment, the human does not receive a further booster dose of the composition after the third dose. In one embodiment, the human does not receive a fourth dose of the composition. In one embodiment, the third dose is administered to the human within a period of about six months after the first dose. In one embodiment, the second dose is administered at least 30 days after the first dose. In one embodiment, the method further comprises administering a third dose of the composition, wherein the third dose is administered at least 90 days after the second dose. In one embodiment, the composition induces a serum immunoglobulin bactericidal titer in the human after receiving the first dose that is at least twice as strong as the serum immunoglobulin bactericidal titer in the human before receiving the first dose, as measured under identical conditions in a serum bactericidal assay using human complement. In one embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily A strains that are heterologous to the A05-expressing N. meningitidis strain. In one embodiment, the immune response is bactericidal against a N. meningitidis serogroup B subfamily B strain that is heterologous to the N. meningitidis strain expressing B01.In one embodiment, the immune response is bactericidal against a N. meningitidis serogroup B subfamily A strain heterologous to N. meningitidis strain M98250771. In one embodiment, the immune response is bactericidal against a N. meningitidis serogroup B subfamily B strain heterologous to N. meningitidis strain CDC1127. In a preferred embodiment, the immune response is bactericidal against a N. meningitidis serogroup B subfamily B strain heterologous to N. meningitidis strain CDC1573. In one embodiment, the first polypeptide has a total of 258 amino acids. In one embodiment, the second polypeptide has a total of 261 amino acids. In one embodiment, the first lipidated polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 1. In one embodiment, the second lipidated polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 2.

[0012] In another aspect, the invention relates to a composition comprising 60 μg of a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1, 60 μg of a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2, polysorbate 80 at a molar ratio of 2.8 relative to the first polypeptide, polysorbate 80 at a molar ratio of 2.8 relative to the second polypeptide, 0.5 mg / ml aluminum, 10 mM histidine, and 150 mM sodium chloride, in a total volume of about 0.5 ml. In one embodiment, the composition elicits a bactericidal immune response against a N. meningitidis serogroup B subfamily A strain heterologous to an A05-expressing N. meningitidis strain. In one embodiment, the composition elicits a bactericidal immune response against a N. meningitidis serogroup B subfamily B strain heterologous to an B01-expressing N. meningitidis strain. In one embodiment, the composition induces a serum immunoglobulin bactericidal titer in a human after receiving the first dose that is at least twice as strong as the serum immunoglobulin bactericidal titer in a human before receiving the first dose, when measured under identical conditions in a serum bactericidal assay using human complement. In one embodiment, the composition does not further comprise a polypeptide that shares less than 100% sequence identity with SEQ ID NO:1. In one embodiment, the composition does not further comprise a polypeptide that shares less than 100% sequence identity with SEQ ID NO:2. In one embodiment, the first polypeptide has a total of 258 amino acids. In one embodiment, the second polypeptide has a total of 261 amino acids. In one embodiment, the first lipidated polypeptide consists of the amino acid sequence set forth in SEQ ID NO:1. In one embodiment, the second lipidated polypeptide consists of the amino acid sequence set forth in SEQ ID NO:2. [Brief explanation of the drawings]

[0013] [Figure 1] Graph showing the percentage of subjects achieving hSBA titers equal to or greater than the LLOQ. hSBA = serum bactericidal assay using human complement; LLOQ = lower limit of quantitation. [Figure 2]1 is a graph showing the percentage of individual human subjects achieving a four-fold increase in hSBA titer against the Princeton University outbreak strain and the UCSB outbreak strain after immunization with rLP2086 (B1971012 study - described in Examples 5 and 6). Serum samples from nine human subjects immunized with bivalent rLP2086 in clinical trial B1971012 were evaluated in a pilot hSBA using the MnB outbreak strains from Princeton University and UCSB. See Example 9. DETAILED DESCRIPTION OF THE INVENTION

[0014] The present inventors have unexpectedly discovered a composition comprising a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1 and a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2. The composition has an acceptable safety profile in humans, and the composition surprisingly elicits a broadly cross-reactive bactericidal immune response in humans against at least more than two diverse strains of Neisseria meningitidis.

[0015] The inventors further unexpectedly discovered that the two-dose and three-dose schedules produced hSBA titers of 8 or greater in a high percentage of human subjects against test strains from N. meningitidis serogroup B subfamilies A and B that harbor LP2086 (factor H binding protein (fHBP)), which is non-homologous to the vaccine. The three-dose schedule provides the broadest protection against diverse MnB clinical strains in humans when compared to the two-dose schedule.

[0016] The inventors also unexpectedly discovered that co-administration of the rLP2086 composition with a tetravalent immunogenic composition against human papillomavirus (HPV4) resulted in vigorous immune responses against human papillomavirus and N. meningitidis serotype B. For example, co-administration of the rLP2086 composition with the HPV4 composition resulted in immune responses against at least test N. meningitidis serotype B strains expressing fHBPs that are heterologous to the fHBP in the rLP2086 composition. Such heterologous test strains include wild-type N. meningitidis serotype B strains that express A22 fHBP, A56 fHBP, B24 fHBP, or B44 fHBP, each of which is heterologous to the fHBP in the rLP2086 composition. See WO / 2012 / 032489, WO / 2013 / 132452, U.S. Patent Publication No. US20120093852, and U.S. Patent Publication No. US20130243807, which describe mutant fHBP proteins, including, among others, A22 fHBP, A56 fHBP, B24 fHBP, and B44 fHBP. Each of these references is incorporated herein by reference in its entirety. Surprisingly, co-administration also produced an immune response against at least HPV types 6, 11, 16, and / or 18. The immune response against HPV types following co-administration of the rLP2086 composition and the HPV4 composition was comparable to the immune response produced by administering the HPV4 composition in the absence of the rLP2086 composition.

[0017] Additionally, the inventors unexpectedly discovered that co-administration of the rLP2086 composition with immunogenic compositions against diphtheria, tetanus, pertussis, and poliomyelitis resulted in vigorous immune responses against diphtheria, tetanus, pertussis, and poliomyelitis, as well as against N. meningitidis serotype B. For example, co-administration of the rLP2086 composition with a REPEVAX composition generated an immune response against at least a test N. meningitidis serotype B strain expressing an fHBP that is non-homologous to the fHBP in the rLP2086 composition. Co-administration also unexpectedly generated immune responses against at least nine antigens of REPEVAX: diphtheria, tetanus, pertussis toxoid, pertussis filamentous hemagglutinin, pertussis pertactin, pertussis fimbria agglutinogen 2+3, poliovirus type 1, poliovirus type 2, and poliovirus type 3. The immune response to the REPEVAX antigen following co-administration of the rLP2086 and REPEVAX compositions was not inferior to the immune response generated by administration of the REPEVAX composition in the absence of the rLP2086 composition.

[0018] Furthermore, the present inventors have unexpectedly discovered that the rLP2086 composition elicits a bactericidal immune response against ST409 N. meningitidis strains expressing the fHBP B153 mutant, e.g., strains expressing the fHBP B153 mutant were found to be susceptible to killing when contacted with bivalent human rLP2086 composition antisera in a serum bactericidal assay (hSBA) using human complement.

[0019] Compositions and vaccines In one aspect, the present invention relates to a composition against Neisseria meningitidis, the composition comprising a first lipidated polypeptide having the amino acid sequence set forth in SEQ ID NO:1 and a second lipidated polypeptide having the amino acid sequence set forth in SEQ ID NO:2.

[0020] The present inventors have surprisingly discovered a single N. meningitidis polypeptide component that elicits a broadly protective immune response effective against multiple strains of N. meningitidis serogroup B. Thus, in one embodiment, the composition does not comprise a fusion protein. In one embodiment, the composition does not comprise a chimeric protein. In one embodiment, the composition does not comprise a hybrid protein. In one embodiment, the composition does not comprise a further peptide fragment. In another embodiment, the composition does not comprise a further Neisserial polypeptide that is not fHBP. For example, in one embodiment, the composition does not comprise a PorA protein. In another embodiment, the composition does not comprise a NadA protein. In another embodiment, the composition does not comprise a Neisserial heparin-binding antigen (NHBA). In another embodiment, the composition does not comprise a Neisserial outer membrane vesicle (OMV). In a preferred embodiment, the composition does not comprise any further antigens other than the first and second polypeptides.

[0021] In another aspect, the inventors have surprisingly discovered that polypeptide antigens from at most two N. meningitidis serogroup B strains elicit a broadly protective immune response that is effective against multiple strains of N. meningitidis serogroup B. Accordingly, in one embodiment, the composition does not further comprise a polypeptide that is not from N. meningitidis serogroup B subfamily A strain M98250771 and / or N. meningitidis serogroup B subfamily B strain CDC1573.

[0022] In one embodiment, the composition does not further comprise a polypeptide that shares less than 100% sequence identity with SEQ ID NO: 1. In another embodiment, the composition does not further comprise a polypeptide that shares less than 100% sequence identity with SEQ ID NO: 2. For example, the composition does not further comprise a polypeptide that shares less than 100% sequence identity with the full length of SEQ ID NO: 1 and / or SEQ ID NO: 2.

[0023] In one embodiment, the composition further comprises polysorbate 80, aluminum, histidine, and sodium chloride. In one embodiment, the composition comprises about 60 μg of a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1, about 60 μg of a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2, polysorbate 80 at a molar ratio of 2.8 to each polypeptide, 0.5 mg aluminum / ml as aluminum phosphate, 10 mM histidine, and 150 mM sodium chloride, preferably in a total volume of about 0.5 ml.

[0024] In another embodiment, the composition comprises about 120 μg / ml of a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1, about 120 μg / ml of a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2, polysorbate 80 at a molar ratio of 2.8 to each polypeptide, 0.5 mg aluminum / ml as aluminum phosphate, 10 mM histidine, and 150 mM sodium chloride.

[0025] In another embodiment, the composition comprises: a) 60 μg of a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1; b) 60 μg of a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2; c) 18 μg of polysorbate 80; d) 250 μg of aluminum; e) 780 μg of histidine; and f) 4380 μg of sodium chloride.

[0026] In one exemplary embodiment, the composition comprises about 60 μg of a first lipidated polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1, about 60 μg of a second lipidated polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:2, polysorbate 80 at a molar ratio of 2.8 to the first lipidated polypeptide and to the second lipidated polypeptide, 0.5 mg / ml aluminum phosphate, 10 mM histidine, and 150 mM sodium chloride, the composition having a total volume of about 0.5 ml. In this exemplary embodiment, the composition is a buffered, isotonic, sterile liquid suspension. In this exemplary embodiment, the composition has a pH of 6.0. In this exemplary embodiment, the first polypeptide and the second polypeptide are adsorbed to aluminum.

[0027] In one embodiment, the composition has a total volume of about 0.5 ml. In one embodiment, the first dose of the composition has a total volume of about 0.5 ml. "First dose" refers to the dose of the composition administered on day 0. "Second dose" or "third dose" refers to a dose of the composition administered subsequent to the first dose, which may or may not be the same amount as the first dose.

[0028] The composition is immunogenic after an initial dose is administered to a human. In one embodiment, the initial dose is about 0.5 ml in total volume.

[0029] The composition induces a serum immunoglobulin bactericidal titer in a human after receiving the first dose that is at least one-fold stronger, and preferably at least two-fold stronger, than the serum immunoglobulin bactericidal titer in a human before receiving the first dose, when measured under identical conditions in a serum bactericidal assay (hSBA) using human complement.

[0030] The bactericidal titer or bactericidal immune response is against N. meningitidis serotype B. In preferred embodiments, the bactericidal titer or bactericidal immune response is against N. meningitidis serotype B subfamily A strains and N. meningitidis serotype B subfamily B strains. Most preferably, the bactericidal titer or bactericidal immune response is against at least N. meningitidis serotype B, subfamily B, B01 strains.

[0031] In one embodiment, the composition induces a bactericidal titer of serum immunoglobulin in a human after receiving a dose of the composition that is at least 1-fold stronger, e.g., at least 1.01-fold, 1.1-fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, or 16-fold stronger, when measured under identical conditions in a serum bactericidal assay using human complement, than the bactericidal titer of serum immunoglobulin in a human before receiving said dose.

[0032] In one embodiment, the composition is an immunogenic composition. In one embodiment, the composition is a human immunogenic composition. In another embodiment, the composition is a vaccine. "Vaccine" refers to a composition comprising an antigen comprising at least one epitope that elicits an immune response that is specific for that antigen. Vaccines can be administered directly to a subject by subcutaneous, oral, oronasal, or intranasal routes of administration. Vaccines are preferably administered intramuscularly. In one embodiment, the composition is a human vaccine. In one embodiment, the composition is an immunogenic composition against N. meningitidis.

[0033] In one embodiment, the composition is a liquid composition. In a preferred embodiment, the composition is a liquid suspension composition. In another preferred embodiment, the composition is not lyophilized.

[0034] First Polypeptide In one embodiment, the composition comprises a first polypeptide having the amino acid sequence set forth in SEQ ID NO:1. In a preferred embodiment, the composition comprises approximately 60 μg of the first polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1, and the composition preferably has a total volume of 0.5 ml. In another embodiment, the composition comprises approximately 120 μg / ml of the first polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1. The polypeptide is a modified factor H binding protein (fHBP) from N. meningitidis strain M98250771. fHBP is described in WO2012032489 and U.S. Patent Publication US2012 / 0093852, each of which is incorporated herein by reference in its entirety. The polypeptide is N-terminally lipidated with three major fatty acids, C16:0, C16:1, and C18:1, covalently linked at three positions in the polypeptide. The first polypeptide comprises a total of 258 amino acids.

[0035] The first polypeptide comprises two alterations introduced into the N-terminal region of the polypeptide compared to the corresponding wild-type sequence from N. meningitidis strain M98250771. A glycine at the second position is added as a result of introducing a cloning site. The second alteration comprises a deletion of four amino acids. Thus, in one embodiment, the first polypeptide comprises the CGSS sequence (SEQ ID NO:3) at the N-terminus. See the first four amino acid residues of SEQ ID NO:1.

[0036] The N-terminal differences between the first polypeptide sequence and the wild-type Neisseria sequence are as follows: Thus, in one embodiment, the first polypeptide comprises at least the first 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or more amino acid residues of the amino acid sequence set forth in SEQ ID NO: 1. Preferably, the first polypeptide comprises at least the first 4, more preferably at least the first 6, and most preferably at least the first 8 amino acid residues of SEQ ID NO: 1.

[0037] Comparison of recombinant and predicted N-terminal sequences of the Neisseria subfamily A LP2086 polypeptide. rLP2086 M98250771 CGSS-----GGGGVAAD (SEQ ID NO: 4) Neisseria LP2086 M98250771 C-SSGS-GSGGGGVAAD (SEQ ID NO: 5) >A05 (SEQ ID NO: 1) CGSSGGGGVAADIGTGLADALTAPLDHKDKGLKSLTLEDSISQNGTLTLSAQGAEKTFKVGDKDNSLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQDHSAVVALQIEKINNPDKIDSLIN QRSFLVSGLGGEHTAFNQLPSGKAEYHGKAFSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQ

[0038] In one embodiment, the first polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 1. In one embodiment, the first polypeptide has a total of 258 amino acids. In one embodiment, the first polypeptide does not comprise an amino acid sequence that shares less than 100% sequence identity with SEQ ID NO: 1. In another embodiment, the first polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 1. In another embodiment, the first polypeptide comprises the amino acid sequence KDN. See, for example, amino acid residues 73-75 of SEQ ID NO: 1. In another embodiment, the first polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 3 at the N-terminus of the polypeptide. In another embodiment, the first polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 4 at the N-terminus of the polypeptide.

[0039] In a preferred embodiment, the first polypeptide is readily expressed in a recombinant host cell using standard techniques known in the art. In another preferred embodiment, the first polypeptide comprises a bactericidal epitope on the N and / or C domain of SEQ ID NO: 1. In one embodiment, the first polypeptide comprises at least the first 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 1 Preferably, the first polypeptide comprises 8, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 amino acid residues. Preferably, the first polypeptide comprises at least the first two, more preferably at least the first four, and most preferably at least the first eight amino acid residues of SEQ ID NO:1.

[0040] In another embodiment, the first polypeptide comprises at least the last 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 20, 21, 22, 23, 24, 8, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 amino acid residues.

[0041] Second Polypeptide In one embodiment, the composition comprises a second polypeptide having the amino acid sequence set forth in SEQ ID NO:2. In a preferred embodiment, the composition comprises approximately 60 μg of the second polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2, and the composition preferably has a total volume of 0.5 ml. In another embodiment, the composition comprises 120 μg / ml of the second polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2. The polypeptide is factor H binding protein (fHBP) from N. meningitidis strain CDC1573. fHBP is described in WO2012032489 and U.S. Patent Publication US2012 / 0093852, each of which is incorporated herein by reference in its entirety. The polypeptide is N-terminally lipidated with three major fatty acids, C16:0, C16:1, and C18:1, covalently linked at three positions in the polypeptide. The second polypeptide comprises a total of 261 amino acids. In one embodiment, the second polypeptide comprises the CGSS sequence (SEQ ID NO:3) at its N-terminus. See the first four amino acid residues of SEQ ID NO:2. >B01 (SEQ ID NO: 2) CGSGGGGSGGGGVTADIGTGLADALTAPLDHKDKGLKSLTLEDSISQNGTLTLSAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQTEQEQDPEHSEKMV AKRRFRIGDIAGEHTSFDKLPKDVMATYRGTAFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAVAYIKPDEKHHAVISGSVLYNQDEKGSYSLGIFGEKAQEVAGSAEVETANGIHHIGLAAKQ

[0042] In one embodiment, the second polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 2. In one embodiment, the second polypeptide has a total of 261 amino acids. In one embodiment, the second polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 2. In another embodiment, the second polypeptide does not further comprise a polypeptide having less than 100% sequence identity with SEQ ID NO: 2. In a preferred embodiment, the first polypeptide and the second polypeptide comprise a CGSS (SEQ ID NO: 3) sequence at the N-terminus of each polypeptide.

[0043] In a preferred embodiment, the second polypeptide is readily expressed in a recombinant host cell using standard techniques known in the art. In another preferred embodiment, the second polypeptide comprises a bactericidal epitope on the N and / or C domain of SEQ ID NO: 2. In one embodiment, the second polypeptide comprises at least the first 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, , 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 amino acid residues. Preferably, the second polypeptide comprises at least the first two, more preferably at least the first four, and most preferably at least the first eight amino acid residues of SEQ ID NO:2.

[0044] In another embodiment, the second polypeptide comprises at least the last 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 20, 21, 22, 23, 24, 8, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 amino acid residues.

[0045] Polysorbate 80 Polysorbate 80 (PS-80) is a nonionic surfactant. Accelerated stability studies using a monoclonal antibody-based in vitro potency assay demonstrated instability of subfamily B proteins at higher PS-80 to MnB rLP2086 protein molar ratios in the final formulation. Separate experiments using various ratios of PS-80 indicated that the optimal PS-80 to MnB rLP2086 protein molar ratio for maintaining potency was approximately 2.8 ± 1.4.

[0046] The concentration of PS-80 in the composition depends on the molar ratio of PS-80 to the polypeptide. In one embodiment, the composition comprises a molar ratio of PS-80 to the first polypeptide and to the second polypeptide of 2.8±1.4. In one embodiment, the composition comprises a molar ratio of PS-80 to the first polypeptide and to the second polypeptide of 2.8±1.1. In one embodiment, the composition comprises a molar ratio of PS-80 to the polypeptide of at least 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, or 3.3. Preferably, the composition comprises a molar ratio of PS-80 to the polypeptide of 2.8.

[0047] The molar ratio of PS-80 to polypeptide is determined by calculation from the measured concentration of PS-80 and the measured concentration of total polypeptide, both values ​​expressed in moles. For example, the molar ratio of PS-80 to protein is determined by calculating the measured concentration of PS-80 (e.g., by reverse-phase high-pressure liquid chromatography (RP-HPLC)) to the measured concentration of total protein in the final drug substance (e.g., by ion-exchange high-pressure liquid chromatography (IEX-HPLC)), both values ​​expressed in moles.

[0048] RP-HPLC is used to quantify the concentration of polysorbate 80 in vaccine formulations. The surfactant concentration is determined by saponification of the fatty acid moiety, and polysorbate 80 is converted to free oleic acid by alkaline hydrolysis at 40°C. Samples are separated by RP-HPLC using a C18 column and quantified using a UV detector at a wavelength of 200 nm.

[0049] The first and second polypeptides are resolved by anion-exchange HPLC. The rLP2086 (fHBP) subfamily A and B proteins elute at different retention times and are quantified using calibration curves generated against the respective rLP2086 protein reference materials.

[0050] The term "molar ratio" and a description of immunogenic compositions comprising fHBP and PS-80 are further disclosed in WO2012025873 and U.S. Patent Publication US2013 / 0171194, each of which is incorporated by reference in its entirety.

[0051] The term "molar ratio" used herein refers to the ratio of moles of two different elements in a composition.In some embodiments, the molar ratio is the ratio of surfactant moles to polypeptide moles.In some embodiments, the molar ratio is the ratio of PS-80 moles to protein moles.In one embodiment, the molar ratio can be calculated based on protein concentration and polysorbate 80 concentration using the following formula:

[0052]

number

[0053] In one embodiment, the composition comprises about 0.0015, 0.0017, 0.0019, 0.0021, 0.0023, 0.0025, 0.0027, 0.0029, 0.0031, 0.0033, 0.0035, 0.0037, 0.0039, 0.0041, 0.0043, 0.0045, 0.0047, 0.0049, 0.0051 mg / mL of PS-80. Preferably, the composition comprises about 0.0035 mg / mL of PS-80.

[0054] In another embodiment, the composition contains about 10 μg, 11 μg, 12 μg, 13 μg, 14 μg, 15 μg, 16 μg, 17 μg, 18 μg, 19 μg, 20 μg, 21 μg, 22 μg, 23 μg, 24 μg, or 25 μg of PS-80. In a preferred embodiment, the composition contains about 18 μg of PS-80.

[0055] In another embodiment, the composition comprises a PS-80 concentration ranging from 0.0005% to 1%. For example, the PS-80 concentration in the composition may be at least 0.0005%, 0.005%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.10%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, or 1.1% PS-80. In a preferred embodiment, the composition comprises about 0.07% PS-80.

[0056] Any minimum value may be combined with any maximum value described herein to define a range.

[0057] aluminum The composition preferably contains about 0.5 mg / ml aluminum phosphate. In one embodiment, the composition contains about 0.5 mg aluminum / ml as aluminum phosphate. The addition of 0.50 mg / ml AlPO4 as a stabilizer improves ease of manufacture and stability. This concentration maintains the binding of subfamily A and B proteins to aluminum (90% or greater binding).

[0058] A method for making aluminum phosphate is described in US Patent Publication US2009 / 0016946, which is incorporated by reference in its entirety.

[0059] In one embodiment, the composition does not further comprise a multivalent cation other than aluminum. In one embodiment, the composition does not further comprise Al(OH) or Al(SO).

[0060] additives In one embodiment, the composition comprises histidine. In one embodiment, the composition comprises sodium chloride. Preferably, the composition comprises about 10 mM histidine and about 150 mM sodium chloride. In one embodiment, the composition comprises 10 mM histidine and 150 mM sodium chloride.

[0061] In another embodiment, the composition contains about 650 μg, 660 μg, 670 μg, 680 μg, 690 μg, 700 μg, 710 μg, 720 μg, 730 μg, 740 μg, 750 μg, 760 μg, 770 μg, 780 μg, 790 μg, 800 μg, 810 μg, 820 μg, 830 μg, 840 μg, or 850 μg of histidine. Preferably, the composition contains about 780 μg of histidine. Any minimum value may be combined with any maximum value described herein to define a range.

[0062] In one embodiment, the composition comprises a Tris, phosphate, or succinate buffer. In a preferred embodiment, the composition does not comprise a Tris buffer. Preferably, the composition does not comprise a phosphate buffer. In a preferred embodiment, the composition does not comprise a succinate buffer. In a preferred embodiment, the composition comprises a histidine buffer.

[0063] In a preferred embodiment, the pH of the composition is between 6.0 and 7.0, with pH 6.0 being most preferred. In one embodiment, the pH of the composition is at most 6.1.

[0064] Bactericidal activity The immune response elicited by administering the composition to humans was demonstrated using a human complement serum bactericidal assay (hSBA) against four N. meningitidis serogroup B (MnB) strains. The four MnB strains used in the hSBA were selected from a strain pool, a systematic collection of clinically relevant N. meningitidis serogroup B strains from the United States and Europe. Two of the four strains for the SBA were from N. meningitidis serogroup B LP2086 (fHBP) subfamily A, and two of the four strains were from N. meningitidis serogroup B LP2086 (fHBP) subfamily B.

[0065] The high percentage of hSBA responses to all test strains, especially strains expressing lipoprotein 2086 variants with sequences non-homologous to the first polypeptide, suggests that the composition is a broadly protective vaccine and that two doses are sufficient to confer high seroprotection, at least against N. meningitidis serogroup B subfamily A strains.

[0066] The high percentage of hSBA responses to all test strains, particularly strains expressing lipoprotein 2086 variants with sequences non-homologous to both the first and second polypeptides, suggests that the composition is a broadly protective vaccine and that at most three doses within a period of approximately six months are sufficient to confer high seroprotection against N. meningitidis serogroup B strains expressing rLP2086 (FHBP) subfamily A and / or subfamily B.

[0067] In one embodiment, the hSBA strain is an LP2086(fHBP) subfamily A strain. In one embodiment, the hSBA strain is an LP2086(fHBP) subfamily A strain expressing a lipoprotein 2086 variant that is heterologous to the N. meningitidis strain expressing A05. For example, in one embodiment, the hSBA strain is an LP2086(fHBP) subfamily A strain expressing a lipoprotein 2086 variant that is heterologous to strain M98250771. In one embodiment, the hSBA strain is the LP2086(fHBP)A22 strain. In another embodiment, the hSBA strain is the LP2086(fHBP)A56 strain. In another embodiment, the hSBA strain is an LP2086(fHBP)A22 and an LP2086(fHBP)A56 strain. In another embodiment, the hSBA strain is strain LP2086A04. In one embodiment, the hSBA strain is strain LP2086 A05. In one embodiment, the hSBA strain is strain LP2086 A12. In one embodiment, the hSBA strain is strain LP2086 A22. In one embodiment, the hSBA strain is strain LP2086 A12. In one embodiment, the hSBA strain is strain LP2086 A04. In one embodiment, the hSBA strain is strain LP2086 A19. In one embodiment, the hSBA strain is strain LP2086 A07. In another embodiment, the hSBA strain includes A22, A12, A19, A05, and A07, or any combination thereof. In one embodiment, the hSBA strain includes A06, A15, and A29, or any combination thereof.

[0068] In one embodiment, the immune response is bactericidal against a N. meningitidis serogroup B subfamily A strain that is heterologous to the A05-expressing N. meningitidis strain. In one embodiment, the immune response is against a N. meningitidis serogroup B A22 strain. In one embodiment, the immune response is against a N. meningitidis serogroup B A56 strain. In one embodiment, the immune response is against a N. meningitidis serogroup B A06 strain. In one embodiment, the immune response is against a N. meningitidis serogroup B A15 strain. In one embodiment, the immune response is against a N. meningitidis serogroup B A29 strain. In one embodiment, the immune response is against a N. meningitidis serogroup B A62 strain. In one embodiment, the immune response is bactericidal against a N. meningitidis serogroup B subfamily A strain that is heterologous to N. meningitidis strain M98250771. In one embodiment, the immune response is bactericidal against a N. meningitidis serogroup B subfamily A strain that expresses a factor H binding protein comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the first polypeptide. In another embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily A strains expressing a factor H binding protein comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the factor H binding protein expressed by N. meningitidis strain M98250771.In a preferred embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily A strains expressing a factor H binding protein comprising an amino acid sequence that is at least 80%, more preferably at least 84%, identical to the factor H binding protein expressed by N. meningitidis strain M98250771.

[0069] In another embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily A strains expressing a factor H binding protein comprising an amino acid sequence that is at most 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the first polypeptide. In another embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily A strains expressing a factor H binding protein comprising an amino acid sequence that is at most 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the factor H binding protein expressed by N. meningitidis strain M98250771. In a preferred embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily A strains expressing a factor H binding protein comprising an amino acid sequence that is at most 85%, and more preferably at most 99%, identical to the factor H binding protein expressed by N. meningitidis strain M98250771. Any minimum value may be combined with any maximum value described herein to define a range.

[0070] In one embodiment, the hSBA strain is an LP2086 (fHBP) subfamily B strain. In one embodiment, the hSBA strain is an LP2086 (fHBP) subfamily B strain expressing a lipoprotein 2086 variant that is heterologous to a N. meningitidis strain expressing B01. For example, in one embodiment, the hSBA strain is an LP2086 (fHBP) subfamily B strain expressing a lipoprotein 2086 variant that is heterologous to strain CDC1127. In a preferred embodiment, the hSBA strain is an LP2086 (fHBP) subfamily B strain expressing a lipoprotein 2086 variant that is heterologous to strain CDC1573.

[0071] In one embodiment, the immune response is bactericidal against a N. meningitidis serotype B subfamily B strain that is heterologous to the N. meningitidis strain expressing B01. In one embodiment, the immune response is against a N. meningitidis serotype B B24 strain. In one embodiment, the immune response is against a N. meningitidis serotype B B44 strain. In one embodiment, the immune response is against a N. meningitidis serotype B B16 strain. In one embodiment, the immune response is against a N. meningitidis serotype B B03 strain. In one embodiment, the immune response is against a N. meningitidis serotype B B09 strain. In one embodiment, the immune response is against a N. meningitidis serotype B B15 strain. In one embodiment, the immune response is against N. meningitidis serogroup B strain B153. In one embodiment, the immune response is bactericidal against a N. meningitidis serogroup B subfamily B strain that is heterologous to N. meningitidis strain CDC1573. In one embodiment, the immune response is bactericidal against a N. meningitidis serogroup B subfamily B strain that expresses a factor H binding protein comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a second polypeptide. In another embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily B strains expressing a factor H binding protein comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the factor H binding protein expressed by N. meningitidis strain CDC1573.In a preferred embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily B strains expressing a factor H binding protein comprising an amino acid sequence that is at least 80%, more preferably at least 87%, identical to the factor H binding protein expressed by N. meningitidis strain CDC 1573. In another preferred embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily B strains expressing a factor H binding protein comprising an amino acid sequence that is 100% identical to the factor H binding protein expressed by N. meningitidis strain CDC 1573.

[0072] In another embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily B strains expressing a factor H binding protein comprising an amino acid sequence that is at most 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the second polypeptide. In another embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily B strains expressing a factor H binding protein comprising an amino acid sequence that is at most 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the factor H binding protein expressed by N. meningitidis strain CDC 1573. In a preferred embodiment, the immune response is bactericidal against N. meningitidis serogroup B subfamily B strains expressing a factor H binding protein comprising an amino acid sequence that is at most 88%, and more preferably at least 99%, identical to the factor H binding protein expressed by N. meningitidis strain CDC 1573. Any minimum value may be combined with any maximum value described herein to define a range.

[0073] In one embodiment, the hSBA strain is strain LP2086(fHBP)B24. In another embodiment, the hSBA strain is strain LP2086(fHBP)B44. In another embodiment, the hSBA strain includes strains LP2086(fHBP)B24 and LP2086(fHBP)B44. In one embodiment, the hSBA strain includes strains LP2086(fHBP)A22, LP2086(fHBP)A56, LP2086(fHBP)B24, and LP2086(fHBP)B44. In one embodiment, the hSBA strain includes strain B15. In one embodiment, the hSBA strain includes strain B153. In another embodiment, the hSBA strain is strain LP2086 B16. In one embodiment, the hSBA strain is strain LP2086 B03. In one embodiment, the hSBA strain is LP2086 B09 strain. In another embodiment, the hSBA strain includes B24, B16, B44, B03, and B09, or any combination thereof. In another embodiment, the hSBA strain includes B24, B16, B44, A22, B03, B09, A12, A19, A05, and A07, or any combination thereof. In another embodiment, the hSBA strain includes A06, A07, A12, A15, A19, A29, B03, B09, B15, and B16, or any combination thereof.

[0074] In one embodiment, the method elicits an immune response against N. meningitidis serogroup B subfamily A strains and against N. meningitidis serogroup B subfamily B strains. Preferably, the immune response is bactericidal against N. meningitidis serogroup B subfamily A strains and against N. meningitidis serogroup B subfamily B strains.

[0075] In one embodiment, the immune response against N. meningitidis serogroup B subfamily A strains is stronger than the immune response against N. meningitidis serogroup B subfamily B strains. For example, in one embodiment, the immunogenic composition elicits higher bactericidal titers against N. meningitidis serogroup B subfamily A strains than against N. meningitidis serogroup B subfamily B strains when tested under identical conditions. In one embodiment, the higher bactericidal titers against N. meningitidis serogroup B subfamily A strains occur within 30 days after a second dose of the immunogenic composition against N. meningitidis. In one embodiment, the higher bactericidal titers against N. meningitidis serogroup B subfamily A strains occur without a third dose of the immunogenic composition against N. meningitidis.

[0076] In another embodiment, the immune response against N. meningitidis serogroup B subfamily B strains is stronger than the immune response against N. meningitidis serogroup B subfamily A strains. For example, in one embodiment, the immunogenic composition elicits a higher bactericidal titer against N. meningitidis serogroup B subfamily B strains than against N. meningitidis serogroup B subfamily A strains when tested under identical conditions. In one embodiment, the higher bactericidal titer against N. meningitidis serogroup B subfamily B strains occurs within 30 days after a second dose of the immunogenic composition against N. meningitidis. In one embodiment, the higher bactericidal titer against N. meningitidis serogroup B subfamily B strains occurs without a third dose of the immunogenic composition against N. meningitidis.

[0077] Titer In one embodiment, the composition increases the bactericidal titer in a human compared to the bactericidal titer in the human before a dose of the composition was administered, when measured under the same conditions in an hSBA. In one embodiment, the increase in bactericidal titer is compared to the bactericidal titer in a human before a first dose of the composition was administered, when measured under the same conditions in an hSBA. In one embodiment, the increase in titer is observed after a second dose of the composition compared to the bactericidal titer in a human before a second dose of the composition was administered, when measured under the same conditions in an hSBA. In another embodiment, the increase in bactericidal titer is observed after a third dose of the composition compared to the bactericidal titer in a human before a third dose of the composition, when measured under the same conditions in an hSBA.

[0078] In one embodiment, the composition induces a bactericidal titer in a human after the dose is administered that is at least 1-fold stronger than the bactericidal titer in the human before the dose is administered, when measured under the same conditions in an hSBA. For example, the bactericidal titer can be at least 1.01-fold, 1.1-fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, or 16-fold higher in a human after the dose of the composition than the bactericidal titer in the human before the dose is administered, when measured under the same conditions in an hSBA.

[0079] In one embodiment, a "responder" refers to a human in which the composition induces a bactericidal titer in the human after administration of the dose, the bactericidal titer being at least one-fold stronger than the bactericidal titer in the human before administration of the dose. In a preferred embodiment, the responder achieves an increase in hSBA titer of at least four-fold or more compared to the bactericidal titer in the human before administration of the dose. Such a responder can be said to have a protective titer.

[0080] In one embodiment, the hSBA titer is the reciprocal of the highest dilution of a serum sample that produces a measurable effect. For example, in one embodiment, the hSBA titer is the reciprocal of the highest 2-fold dilution of test serum that produces at least a 50% reduction in MnB bacteria (50% bacterial survival) compared to the T30 CFU value (i.e., the number of bacteria surviving after incubation in an assay well containing all assay components except test serum; 100% bacterial survival).

[0081] In one embodiment, the composition induces a bactericidal titer in a human after receiving the first dose that is at least twice as strong as the bactericidal titer in the human before receiving the first dose (e.g., the bactericidal titer in the human without the first dose), when measured under the same conditions in an hSBA. In one embodiment, the composition induces a bactericidal titer in a human that is at least four times as strong as the bactericidal titer in the human before receiving the first dose, when measured under the same conditions in a human serum bactericidal assay (hSBA) utilizing human complement. In one embodiment, the composition induces a bactericidal titer in a human that is at least eight times as strong as the bactericidal titer in the human before receiving the first dose, when measured under the same conditions in a human serum bactericidal assay (hSBA) utilizing human complement.

[0082] In a preferred embodiment, the human serum complement is obtained from a human having low intrinsic bactericidal activity for a given SBA test strain. Low intrinsic bactericidal activity refers, for example, to a bactericidal titer of at least less than a 1:4 dilution for a given SBA test strain. In one embodiment, the human complement has an hSBA titer of at least less than a 1:4 dilution, e.g., a 1:2 dilution, for a given SBA test strain, and is obtained from a human to whom the composition was not administered.

[0083] A human may exhibit an hSBA titer of less than 1:4 prior to administration of a composition, such as a bivalent rLP2086 composition, or may exhibit an hSBA titer of 1:4 or greater prior to administration of the composition. Thus, in preferred embodiments and examples, administration of at least one dose of the composition to a human results in an hSBA titer of at least 1:4, e.g., an hSBA titer of 1:8 or greater, an hSBA titer of 1:16 or greater, or an hSBA titer of 1:32 or greater. Each example described herein includes an assessment of the proportion of human subjects with hSBA titers of 1:8 or greater and / or 1:16 or greater, and the bivalent rLP2086 composition was administered to the human. A favorable assessment of an hSBA titer of greater than 1:4 indicates that a protective, i.e., bactericidal, immune response elicited in the human is associated with the composition.

[0084] In one embodiment, the human has an hSBA titer at or above the lower limit of quantitation (LLOQ) for the hSBA after the first dose of the composition is administered. In another embodiment, the human has an hSBA titer at or above the LLOQ for the hSBA after the second dose of the composition is administered. In another embodiment, the human has an hSBA titer at or above the LLOQ for the hSBA after the third dose of the composition is administered.

[0085] Additional immunogenic compositions The present inventors have unexpectedly discovered that an immunogenic composition against N. meningitidis can be administered together with an immunogenic composition against human papillomavirus (HPV) without adversely affecting the bactericidal response to N. meningitidis. As described in Examples 7 and 8, substantial hSBA responses to N. meningitidis test strains were observed in humans who received an immunogenic composition against N. meningitidis and GARDASIL, and in humans who received an immunogenic composition against N. meningitidis and saline. An additional increase in hSBA response was observed approximately one month after the third dose of the immunogenic composition against N. meningitidis.

[0086] Furthermore, the inventors unexpectedly discovered that after administration of both an immunogenic composition against N. meningitidis and an immunogenic composition against HPV, humans developed vigorous immune responses against both N. meningitidis and HPV, compared to the immune response in humans before administration of the compositions. As described in Examples 7 and 8, titers against HPV increased in humans after administration of an immunogenic composition against N. meningitidis and GARDASIL, compared to the titers in humans before administration of the immunogenic compositions. The increase in titers against HPV was at least one-fold, at least two-fold, at least three-fold, at least four-fold, or more.

[0087] Thus, in one embodiment, a method comprises eliciting an immune response in a human against N. meningitidis, and further comprises administering to the human an immunogenic composition against human papillomavirus. Preferably, the immune response is bactericidal against N. meningitidis. In one embodiment, the method further comprises eliciting an immune response against HPV. In a preferred embodiment, the method further comprises eliciting an immune response against any one of human papillomavirus types 6, 11, 16, and 18, or any combination thereof. In one embodiment, the immunogenic composition against HPV is administered to the human within 24 hours of administering the composition against N. meningitidis.

[0088] In one embodiment, the method comprises eliciting an immune response in a human against N. meningitidis and further comprises administering to the human an immunogenic composition against HPV. Preferably, the immune response is bactericidal against N. meningitidis. In one embodiment, the method further comprises eliciting an immune response against HPV. In a preferred embodiment, the method further comprises eliciting an immune response against any one of human papillomavirus types 6, 11, 16, and 18, or any combination thereof. In one embodiment, the immunogenic composition against human papillomavirus is administered to the human within 24 hours of administering the composition against N. meningitidis.

[0089] In another embodiment, the present inventors unexpectedly discovered that immunogenic compositions against N. meningitidis can be administered together with immunogenic compositions against diphtheria, tetanus, acellular pertussis, and inactivated poliomyelitis virus (dTaP) without adversely affecting the bactericidal response to N. meningitidis. As described in Example 4, substantial hSBA responses to N. meningitidis test strains were observed in humans administered an immunogenic composition against N. meningitidis and REPEVAX. An additional increase in hSBA response was observed approximately one month after the third dose of the immunogenic composition against N. meningitidis.

[0090] Furthermore, the inventors unexpectedly discovered that after administration of both an immunogenic composition against N. meningitidis and an immunogenic composition against dTaP, humans developed vigorous immune responses against both N. meningitidis and dTaP, compared to the immune response in humans before administration of the compositions. As described in Example 4, titers against dTaP increased in humans after administration of an immunogenic composition against N. meningitidis and REPEVAX, compared to the titers in humans before administration of the immunogenic compositions. The increase in titers against dTaP was at least 1-fold, at least 2-fold, at least 3-fold, at least 4-fold, or more.

[0091] Methods and Administration In one aspect, the invention relates to a method of inducing an immune response against N. meningitidis in a human. In another aspect, the invention relates to a method of vaccinating a human. In one embodiment, the method comprises administering to the human at least one dose of the composition described above. In another embodiment, the method comprises administering to the human at least a first dose and a second dose of the composition described above.

[0092] Surprisingly, the inventors discovered that a two-dose schedule of the composition induces bactericidal titers in humans against diverse heterogeneous subfamily A strains and diverse heterogeneous subfamily B strains. For example, following the two-dose schedule of the composition described above, the percentage of humans with hSBA titers of 1:8 or greater was 90% or greater with SBA test strains expressing LP2086(fHBP)A22 or LP2086(fHBP)A56. See Example 1.

[0093] In one embodiment, the second dose is administered at least 20, 30, 50, 60, 100, 120, 160, 170, or 180 days after the first dose, and at most 250, 210, 200, or 190 days after the first dose. Any minimum value may be combined with any maximum value described herein to define a range.

[0094] In another embodiment, the second dose is administered about 30 days after the first dose. In another embodiment, the second dose is administered about 60 days after the first dose, e.g., in a 0.2 month immunization schedule. In another embodiment, the second dose is administered about 180 days after the first dose, e.g., in a 0.6 month immunization schedule. In yet another embodiment, the second dose is administered about 120 days after the first dose, e.g., in a 2.6 month immunization schedule.

[0095] In one embodiment, the method comprises administering two doses, at most two doses, of the composition to the human. In one embodiment, the two doses are administered within a period of about six months after the first dose. In one embodiment, the method does not include further administration of a booster to the human. As used herein, "boost" refers to administering an additional dose of the composition to the human. It may be advantageous to administer at most two doses of the composition to the human. Advantages include, for example, making it easier for the human to comply with the complete dosing schedule and facilitating cost-effectiveness of the schedule.

[0096] In one embodiment, the first dose and the second dose are administered to a human over a period of about 25, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 days after the first dose, or over a period of 400, 390, 380, 370, 365, 350, 340, 330, 320, 310, 300, 290, 280, 270, 260, 250, 240, 230, 220, 210, or 200 days. Any minimum value may be combined with any maximum value described herein to define a range.

[0097] In one embodiment, the first and second doses are administered to the human over a period of about 30 days. In another embodiment, the first and second doses are administered to the human over a period of about 60 days. In another embodiment, the first and second doses are administered to the human over a period of about 180 days.

[0098] 3 doses The inventors further unexpectedly discovered that a three-dose schedule of the composition induced broader bactericidal titers against strains expressing heterologous LP2086(fHBP) in a higher percentage of humans than a two-dose schedule. For example, following the two-dose schedule of the composition described above, the percentage of humans with hSBA titers of 1:8 or greater was 65% or greater for SBA test strains LP2086(fHBP)B24 and LP2086(fHBP)B44. Following the three-dose schedule of the composition described above, the percentage of humans with hSBA titers of 1:8 or greater was 86% or greater for SBA test strains B24 and B44. See Example 1.

[0099] Thus, in one embodiment, a three-dose schedule of the composition induces bactericidal titers against multiple strains expressing LP2086 (fHBP) that is heterologous to the first and / or second polypeptide in a higher percentage of humans than a two-dose schedule.

[0100] In one embodiment, the method comprises administering three doses of the composition to the human. In another embodiment, the method comprises administering at most three doses of the composition. In one embodiment, the three doses are administered within a period of about six months after the initial dose. In one embodiment, the method comprises administering a booster dose to the human after the third dose. In another embodiment, the method does not comprise administering a booster dose to the human after the third dose. In another embodiment, the method does not further comprise administering a fourth or booster dose of the composition to the human. In another embodiment, at most three doses are administered to the human within a period of about six months.

[0101] In an exemplary embodiment, the second dose is administered about 30 days after the first dose and the third dose is administered about 150 days after the second dose, e.g., in a 0, 1, or 6 month immunization schedule. In another exemplary embodiment, the second dose is administered about 60 days after the first dose and the third dose is administered about 120 days after the second dose, e.g., in a 0, 2, or 6 month immunization schedule.

[0102] In one embodiment, the first dose, the second dose, and the third dose are administered to a human over a period of about 150, 160, 170, or 180 days, or at most 240, 210, 200, or 190 days. Any minimum value may be combined with any maximum value described herein to define a range. Preferably, the first dose, the second dose, and the third dose are administered to a human over a period of about 180 days or 6 months. For example, the second dose can be administered to a human about 60 days after the first dose, and the third dose can be administered to a human about 120 days after the second dose. Thus, an exemplary administration schedule includes administering doses to a human at about 0, 2, and 6 months.

[0103] As noted above, multiple doses of the immunogenic composition can be administered to a human, and the number of days between doses can vary. Advantages of this approach include, for example, flexibility in the human's adherence to the administration schedule.

[0104] Example The following examples illustrate embodiments of the present invention. Unless otherwise indicated herein, the following examples comprise a 0.5 mL dose of 60 μg of a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1, 60 μg of a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2, a 2.8 molar ratio of polysorbate 80 to the first polypeptide, a 2.8 molar ratio of polysorbate 80 to the second polypeptide, 0.5 mg Al of the composition, and a 0.5 mL dose of 60 μg of a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2. 3+Reference is made to an investigational bivalent recombinant vaccine (rLP2086), which is a preferred exemplary embodiment of a composition comprising 100 μg / ml of rLP2086, 10 mM histidine, and 150 mM sodium chloride. More specifically, the investigational bivalent recombinant rLP2086 vaccine comprises (a) 60 μg of a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1, (b) 60 μg of a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2, (c) 18 μg of polysorbate 80, (d) 250 μg of aluminum, (e) 780 μg of histidine, and (f) 4380 μg of sodium chloride. Each dose was 0.5 mL. [Example]

[0105] Example 1: Safety, tolerability, and immunogenicity in healthy adolescents of the investigational meningococcal serogroup B bivalent (MnB) rLP2086 vaccine when administered in a 2- or 3-dose regimen in healthy subjects 11-18 years of age BACKGROUND:The safety, tolerability, and immunogenicity of an investigational bivalent recombinant vaccine (rLP2086) was tested in healthy adolescents aged 11–18 years using five dose regimens (Table 1) involving two or three vaccine treatments.

[0106] The vaccine contained 60 μg each of purified subfamily A and purified subfamily B rLP2086 protein, polysorbate 80 at a molar ratio of 2.8, and 0.25 mg Al as AlPO4. 3+ , formulated in 0.5 ml doses to contain saline, pH 6.0, buffered with 10 mM histidine.

[0107] Saline will be used as a placebo because there are no known vaccines against MnB with proven safety, immunogenicity, and efficacy that can serve as an active control. Normal saline contains 0.9% sodium chloride in a 0.5 ml dose.

[0108] Methods: All subjects in this phase 2, randomized, placebo-controlled, single-blind study participated in vaccine treatment visits at 0, 1, 2, and 6 months. For blinding, subjects received a saline control when no vaccine was scheduled. Human complement serum bactericidal assays (hSBAs) were performed using four MnB test strains expressing LP2086 (fHBP) fHBP variants A22, A56, B24, and B44 (i.e., the four "primary hSBA test strains" in the primary endpoint analysis), all distinct from the variants in the vaccine. Unwanted adverse events (AEs), required local and systemic responses, and antipyretic use were assessed.

[0109] Geometric mean hSBA titers, along with two-sided 95% confidence intervals (CI), were calculated for each major strain at each blood draw. Geometric mean fold increases were calculated along with 95% CI.

[0110] Responders were defined as subjects with hSBA titers equal to or greater than the lower limit of quantitation (LLOQ) of the hSBA assay. The LLOQ for each of the four hSBA test strains in the primary endpoint analysis was an hSBA titer equivalent to 1:8. The limit of detection (LOD) for each lead test strain was a titer equivalent to 1:4 (widely considered a correlate of protection against meningococcal disease).

[0111] Results: One month after the last vaccine dose, 86–99% of subjects (after 3 doses, P < 0.001) and 69–100% of subjects (after 2 doses) had hSBA titers ≥ 8 against each MnB test strain. After test dose 1, collectively, 19–27% (severe, 1.1–4.3%) and 23–27% (severe, 0.0–1.0%) of rLP2086 recipients experienced redness and swelling, respectively. Injection site pain was the most common local reaction after test dose 1 (severe, 7.6–13.1%). After the first test dose of bivalent rLP2086 vaccine, fever of ≥ 38°C was experienced by collectively 3.3–6.5% compared with 2.1% of saline recipients. Local and systemic reactions generally occurred more frequently after dose 1 than after subsequent doses. Forty-three of 1712 subjects (2.5%) reported 51 serious AEs, two of which were considered related (one case of dizziness, chills, and headache and one case of fever and vomiting). No deaths were reported.

[0112] [Table 1]

[0113] Conclusions: Bivalent rLP2086 demonstrated an acceptable safety profile. All five dosing regimens produced hSBA titers of 8 or greater against all four test strains in a high proportion of subjects. The higher rates after three doses compared with two doses for some test strains suggest that three doses may provide the broadest protection against diverse MnB clinical strains. Global phase 3 clinical trials are ongoing with the bivalent rLP2086 vaccine.

[0114] One of the objectives of this study was to evaluate immune responses, as measured by hSBA performed with MnB strains expressing LP2086 subfamily A and B proteins, in subjects in Group 1 (randomized 0-, 1-, and 6-month schedule) and Group 2 (randomized 0-, 2-, and 6-month schedule), 1 month after the third vaccination with bivalent rLP2086. The immunogenicity analysis endpoint was the proportion of subjects in Groups 1 and 2 achieving hSBA titers equal to or greater than the LLOQ at month 7 (or 1 month after the third dose of bivalent rLP2086) for each of the four major MnB test strains (A22, A56, B24, and B44). The LLOQ was 1:8 for the four major MnB test strains.

[0115] For the evaluable immunogenicity population, the percentage of subjects in Group 1 achieving hSBA titers of 1:8 or greater after three doses of bivalent rLP2086 was 91.7% for A22, 99.4% for A56, 89% for B24, and 88.5% for B44 (see Table 1 above). The study objective was met for subjects in Group 1, as the lower limit of the 97.5% CI was above 50% for all strains (87.8%, p<0.001; 97.8%, p<0.001; 84.7%, p<0.001; and 84.1%, p<0.001 for strains A22, A56, B24, and B44, respectively).

[0116] For Group 2, the percentage of subjects achieving hSBA titers of 1:8 or greater after three doses of bivalent rLP2086 was 95.0% for A22, 98.9% for A56, 88.4% for B24, and 86.1% for B44 (see Table 1 above). As was found for Group 1, the lower limit of the 97.5% CI was greater than 50% for all strains (91.7%, p<0.001; 96.9%, p<0.001; 84.1%, p<0.001; and 81.4%, p<0.001 for strains A22, A56, B24, and B44, respectively), indicating that the objective was met for subjects in Group 2.

[0117] The secondary objective was to evaluate the immune response, as measured by hSBA performed with MnB strains expressing LP2086 subfamily A and B proteins, one month after the second dose of bivalent rLP2086 in three groups of subjects (randomized 0- and 6-month schedules). This secondary objective was the proportion of subjects in the three groups achieving hSBA titers equal to or greater than the LLOQ (1:8) at month 7 (or one month after the second dose of bivalent rLP2086) for each of the four major MnB test strains.

[0118] This second objective was also achieved, as the proportion of subjects in the three groups achieving hSBA titers of 1:8 or greater after two doses of bivalent rLP2086 was 93.5%, 98.4%, 81.1%, and 77.5% for the major MnB test strains, with the lower limit of the 97.5% CI exceeding 50% for all strains (90.0%, p<0.001; 96.2%, p<0.001; 76.0%, p<0.001; and 72.2%, p<0.001 for strains A22, A56, B24, and B44, respectively; see Table 1 above).

[0119] Another secondary objective was the proportion of subjects in Groups 1-5 with hSBA titers equal to or greater than the LLOQ for each of the four major MnB test strains at each blood collection time point. The LLOQ for each of the four major hSBA test strains was a titer of 1:8. For the evaluable immunogenicity population, the proportion of subjects with hSBA titers equal to or greater than 1:8 by the time of testing is shown in Table 1 above.

[0120] The proportion of subjects with hSBA titers ≥1:8 after one dose of bivalent rLP2086 (5 groups [2- and 6-month schedules] at 1 month after injection 3) was 55.9% for A22, 67.6% for A56, 56.9% for B24, and 23.8% for B44.

[0121] The percentage of subjects with hSBA titers ≥1:8 1 month after two doses of bivalent rLP2086 ranged from 74.6% to 100% for subfamily A strains and from 54.0% to 81.1% for subfamily B strains. After three doses, the percentages increased and ranged from 91.7% to 99.4% and 86.1% to 89.0% for subfamily A and B strains, respectively. [Example]

[0122] Example 2: Serum Bactericidal Assay Using Human Complement (HSBA) MnB clearance from the human bloodstream is primarily achieved by complement-mediated lysis, and an intact complement system is critical for resistance to MnB-mediated infection. Complement-mediated lysis of MnB in vivo is mimicked in vitro by the human complement serum bactericidal assay (hSBA), a functional serological assay shown to be a surrogate for protection against meningococcal disease. Demonstration of bacterial killing in the human complement serum bactericidal assay (hSBA) correlates with protection against meningococcal disease. Vaccine-induced immunity is characterized using hSBA against four MnB strains (fHBP variants A22, A56, B24, and B44).

[0123] The hSBA described in the Examples used four major MnB test strains for endpoint assessment and thus for estimating vaccine efficacy using the hSBA immunogenicity endpoints. These test strains represent four of the six phylogenetic fHBP subgroups that account for over 90% of disease isolates circulating in the United States and Europe.

[0124] [Table 2]

[0125] The selection of four major MnB test strains from invasive disease isolates utilized an approach that took into account the population distribution of LP2086 surface expression in vitro. Furthermore, because populations at risk for meningococcal disease are characterized by absent or low baseline bactericidal activity against most strains, hSBA test strains were required to demonstrate low baseline hSBA positivity. Additionally, each of the four major MnB test strains expresses an LP2086 variant that is distinct from the LP2086 variant in the vaccine, thus enabling targeted assessment of functional immunogenicity and efficacy against invasive meningococcal disease (IMD) strains circulating in the population.

[0126] The hSBA measures the amount of anti-meningococcal serogroup B (MnB) antibodies in serum that are capable of initiating complement-mediated bactericidal activity. Briefly, test serum is serially diluted two-fold and added to a 96-well assay plate. The bactericidal reaction is initiated by the addition of the MnB SBA test strain and human serum complement. The assay plate is incubated at 37°C for 30–60 minutes (referred to as T30, depending on the SBA test strain), after which the reaction mixture containing the bacteria that survive this incubation is diluted and transferred to a microfilter plate. After overnight incubation, the surviving bacteria, expressed as colony-forming units (CFU), are enumerated using an Immunospot analyzer. The raw CFU data are electronically recorded and transferred to a data analysis application that calculates the hSBA titer. The hSBA titer is the reciprocal of the highest two-fold dilution of test serum that reduces MnB bacteria by at least 50% (50% bacterial survival) compared to the T30 CFU value (i.e., the number of bacteria surviving after incubation in assay wells containing all assay components except test serum; 100% bacterial survival). Titers can be reported as serial titers, i.e., 1:4, 1:8, 1:16, etc. Serum samples are tested in duplicate and repeated in the same assay. The final titer reported for samples with non-identical replicates is the lower of the two replicates when system suitability and sample suitability criteria are met (e.g., replicate titers must agree within one two-fold dilution).

[0127] hSBA assays were performed after serial dilution of test serum in Dulbecco's phosphate-buffered saline. Bacteria (approximately 2,000 colony-forming units) and human serum complement (final concentration 20% by weight) were added to the serially diluted serum in a 96-well plate and incubated at 37°C and 700 rpm for 30–40 minutes (depending on the hSBA test strain) in a small-radius orbital shaker. After incubation, a portion of the reaction mixture was transferred to a microfilter plate. After overnight incubation, viable bacteria were counted using an Immunospot analyzer (Cellular Technology Limited, Shaker Heights, OH, USA), and hSBA titers were analyzed using SAS (version 9.2). hSBA titers were calculated as the reciprocal of the interpolated test serum dilution that resulted in a 50% reduction in bacteria compared to a control not exposed to test serum (i.e., viable bacteria at the end of the hSBA reaction). Based on hSBA titers that were equal to or greater than the lower limit of quantitation of the hSBA assay, established during assay qualification using the strains listed in Table 1 of Example 1, a per-protocol hSBA was performed.

[0128] Human serum is the complement source for SBAs. However, hSBA titers can vary depending on the human complement lot used. Therefore, human complement is preferably controlled through rigorous screening and qualification to ensure consistent performance in hSBAs. For hSBAs, human serum complement can be pooled from several healthy adults or used from individual donors (i.e., not pooled). [Example]

[0129] Example 3 - Polysorbate 80 Three parameters, namely, pH, aluminum concentration, and polysorbate 80 (PS-80) to protein molar ratio, are optimized for drug formulation. For a dose composition with a total volume of 0.5 ml, optimal protein-to-aluminum binding is achieved at a pH of approximately 6.0 and an aluminum concentration of 0.5 mg / ml as aluminum phosphate (AlPO4) (equivalent to 0.25 mg of aluminum per dose). To stabilize the formulation for in vitro efficacy, the PS-80 to protein molar ratio is maintained at 2.8±1.4. Polysorbate 80 (PS-80) is added to the drug substance to achieve a target PS-80 to protein molar ratio of 2.8. Therefore, it is preferable not to add PS-80 during drug formulation. [Example]

[0130] Example 4 A randomized, placebo-controlled, phase 2 study of the immunogenicity and safety of REPEVAX® co-administered with bivalent rLP2086 vaccine in healthy adolescents Background / Intent: The investigational bivalent rLP2086 vaccine, being developed to prevent Neisseria meningitidis serogroup B (MnB) disease in adolescents, was evaluated with co-administration of REPEVAX® (which may be as described in U.S. Pat. No. 7,479,283, WO 1990 / 013313, and EP 1666057 B1, and UK Marketing Authorisation PL 06745 / 0121), a dTaP inactivated polio vaccine currently used in this population.

[0131] Methods: Adolescents randomized to REPEVAX + rLP2086 or REPEVAX + saline (1:1) were vaccinated at 0, 2, and 6 months. Thirty days after the first vaccination, subjects were identified who achieved predefined antibody levels against nine REPEVAX antigens. Immune responses (hSBA) against four MnB test strains were measured 30 days after vaccination 2 and 3. Adverse events (AEs) and local / systemic responses were assessed.

[0132] REPEVAX (Sanofi Pasteur MSD limited) is a low-dose combination vaccine of diphtheria, tetanus, acellular pertussis, and inactivated poliomyelitis viruses containing at least 2 IU of diphtheria toxoid, at least 20 IU of tetanus toxoid, pertussis antigens (pertussis toxoid (2.5 micrograms), filamentous hemagglutinin (5 micrograms), pertactin (3 micrograms), and fimbriae types 2 and 3 (5 micrograms), poliovirus (inactivated) type 1 (40 D antigen units), poliovirus (inactivated) type 2 (8 D antigen units), and poliovirus (inactivated) type 3 (32 D antigen units) adsorbed to aluminum phosphate (1.5 mg (0.33 mg aluminum)) per 0.5 mL dose.

[0133] Immune responses to the diphtheria, tetanus, and pertussis components of REPEVAX (diphtheria toxoid, tetanus toxoid, pertussis toxoid, pertactin, fimbriae types 2 and 3, and filamentous hemagglutinin) were assessed using a multiplex LUMINEX assay. Immune responses to poliovirus types 1, 2, and 3 were measured in virus neutralization assays. Sera from all subjects in both groups were used in these assays.

[0134] To evaluate the immune response to bivalent rLP2086, functional antibodies were analyzed in hSBAs using the four major MnB test strains described below. Four major MnB hSBA test strains (A22, A56, B44, and B24) were selected; two express LP2086 subfamily A variants and the other two express LP2086 subfamily B variants. These four major hSBA test strains (from four of the six fHBP phylogenetic subgroups, representing over 90% of disease isolates circulating in the United States and Europe) were used to determine the primary immunogenicity endpoint in this study. Additionally, the A22, B24, and B44 variants are epidemiologically relevant variants in Europe, and in the United States, A22 and B24 are the most prevalent variants found expressed on disease-causing MnB strains. The MnB hSBA was validated prior to testing of samples used in primary and secondary analyses.

[0135] Serum samples from 50% of randomly selected subjects in both groups were subjected to hSBA performed at A22 and B24, and the other 50% were tested at A56 and B44. These tests were performed on blood samples taken before vaccine treatment 1, after vaccine treatment 2, and after vaccine treatment 3.

[0136] The immunogenicity of REPEVAX will be assessed using predefined criteria for each antigen established in the pivotal Phase 3 clinical trial in adolescents that led to REPEVAX's licensing. REPEVAX co-existing antigens include diphtheria, tetanus, and pertussis toxoid, pertussis filamentous hemagglutinin, pertussis pertactin, pertussis fimbriae agglutinogens 2+3, poliovirus type 1, poliovirus type 2, and poliovirus type 3. The exception is pertussis fimbriae agglutinogens (FIM) 2+3, which required a titer of ≥5 EU / mL in the assay used to license REPEVAX. In this study, the lower limit of quantitation (LLOQ) for the pertussis FIM 2+3 assay was ≥10.6 EU / mL, which is higher and therefore more stringent than the REPEVAX licensing criteria.

[0137] The LLOQs for the coexisting antigens were 0.037 IU / mL for diphtheria toxoid, 0.05 IU / mL for tetanus toxoid, 0.9 EU / mL for pertussis toxoid, 2.9 EU / mL for pertussis filamentous hemagglutinin, 3.0 EU / mL for pertussis pertactin, 10.6 EU / mL for pertussis fimbria agglutinin type 2+3, and 1:8 for poliovirus type 1, poliovirus type 2, and poliovirus type 3.

[0138] Additional descriptive endpoints for the primary objective were antibodies to concomitant vaccine antigens measured as geometric mean titers (GMTs) or geometric mean concentrations (GMCs) after vaccine treatment 1 (at visit 2).

[0139] Additional endpoints were the proportion of subjects with hSBA titers equal to or greater than the LLOQ after vaccine treatment 3 (visit 6) for each of the four major MnB test strains.

[0140] Concomitant vaccine antigens. One month after vaccination with diphtheria, tetanus, and acellular pertussis (dTaP)-IPV (REPEVAX), the proportion of subjects reaching predefined criteria for concomitant vaccine antigens was calculated for Groups 1 and 2, with two-sided 95% exact (or Clopper-Pearson) confidence limits. The difference in proportions (bivalent rLP2086 / dTaP-IPV-dTaP-IPV, or Group 1 minus Group 2) was also calculated, along with the two-sided 95% exact CI for the difference. Noninferiority was declared if the lower limit of the two-sided 95% CI for the difference was greater than -0.10 (-10%) for all nine antigens in the dTaP-IPV vaccine.

[0141] hSBA with Primary Test Strains. For each primary MnB hSBA test strain, the number and percentage of subjects achieving hSBA titers ≥ LLOQ, ≥ 1:4, ≥ 1:8, ≥ 1:16, and ≥ 1:128 at each blood collection time point were summarized descriptively, along with exact two-sided 95% CIs (or Clopper-Pearson confidence limits) for the proportions.

[0142] Results: Of 749 randomized subjects, 685 (91.5%) were included in the evaluable immunogenicity population. Immune responses following REPEVAX + rLP2086 or REPEVAX + saline were noninferior for all nine REPEVAX antigens. The immune response to the bivalent rLP2086 vaccine was substantial after two doses and further enhanced after three doses (Table 2). Mild to moderate injection site pain was the most common local reaction, and headache and fatigue were the most common systemic events. The proportions of subjects reporting AEs within 30 days of vaccine treatment were similar (8.8% and 11.4% for REPEVAX + rLP2086 and REPEVAX + saline, respectively).

[0143] For the evaluable coexisting vaccine immunogenicity population, the percentages of subjects achieving predetermined antibody levels (threshold response) to coexisting vaccine antigens 1 month after the REPEVAX dose were similar in the bivalent rLP2086 + REPEVAX group and the REPEVAX-alone group for the following coexisting vaccine antigens: diphtheria toxoid (99.4% in each group), tetanus toxoid (100% in each group), pertussis toxoid (94.7% and 96.0%, respectively), pertussis filamentous hemagglutinin (100% in each group), pertussis pertactin (100% in each group), pertussis fimbria agglutinin types 2 and 3 (97.6% and 98.9%, respectively), poliovirus type 1 (100% in each group), poliovirus type 2 (100% in each group), and poliovirus type 3 (100% in each group).

[0144] Noninferiority was achieved because the lower bound of the two-sided 95% CI for the difference in responder rates between the bivalent rLP2086 + REPEVAX group (Group 1) and the REPEVAX-alone group (Group 2) 1 month after the REPEVAX dose was higher than -0.10 (-10%) for nine antigens in REPEVAX (i.e., the lowest lower bound of the 95% CI for the difference in rates was -4.7% (pertussis toxoid)). Thus, the immune response induced by REPEVAX given with bivalent rLP2086 was not inferior to the immune response induced by REPEVAX alone.

[0145] The proportion of subjects with hSBA titers equal to or greater than the LLOQ for each of the four major MnB test strains was assessed for the evaluable immunogenic population after vaccine treatment 3. The LLOQ for A22 was an hSBA titer equivalent to 1:16, and the LLOQ for all other MnB test strains was an hSBA titer equivalent to 1:8.

[0146] For group 1, the percentage of subjects with hSBA titers equal to or greater than the LLOQ at baseline (before vaccine treatment 1) was 14.4% for the major MnB strains A22, 18.2% for A56, 12.7% for B24, and 6.2% for B44. For group 2, the percentage of subjects with hSBA titers equal to or greater than the LLOQ at baseline (before vaccine treatment 1) was 23.0% for the major MnB strains A22, 21.8% for A56, 12.9% for B24, and 6.3% for B44.

[0147] Substantial hSBA responses were observed among Group 1 subjects after dose 2 of bivalent rLP2086, with an additional increase observed after dose 3, 1 month after vaccine treatment 3. For Group 1 (bivalent rLP2086 + REPEVAX), the percentage of subjects achieving hSBA titers at or above the LLOQ 1 month after vaccine treatment 2 and 1 month after vaccine treatment 3 were 81.1% and 95.6% for A22, 97.3% and 100% for A56, 81.0% and 96.8% for B24, and 55.5% and 81.5% for B44. Although substantial hSBA responses were achieved after only two doses of bivalent rLP2086, the increased percentage of subjects with hSBA titers at or above the LLOQ after dose 3 (1 month after vaccine treatment 3) compared with dose 2 (1 month after vaccine treatment 2) exemplifies the enhanced immune response after dose 3. In the control group (Group 2), the proportion of subjects with hSBA titers equal to or greater than the LLOQ for each of the four major MnB test strains 1 month after vaccine treatment 2 and 1 month after vaccine treatment 3 was similar to the baseline hSBA results (before vaccine treatment 1) for each MnB test strain.

[0148] For the four major MnB test strains, the percentage of subjects in Group 1 who demonstrated the defined hSBA titers was greater after the third dose than after the second dose. Subjects who achieved hSBA titers of 1:16 or greater are listed because this represents a fourfold increase over a 1:4 titer (titers of 1:4 or greater are widely accepted as a correlate of protection against IMD). For Group 1, the percentage of subjects with hSBA titers of 1:16 one month after vaccine treatment 2 was 81.8% for A22, 97.3% for A56, 68.0% for B24, and 53.4% ​​for B44. One month after vaccine treatment 3, the percentage of subjects with hSBA titers of 1:16 was 95.6% for A22, 100% for A56, 87.3% for B24, and 79.5% for B44.

[0149] In the control group (Group 2), the proportion of subjects with established hSBA titers for each of the four major MnB test strains 1 month after vaccine treatment 2 and 1 month after vaccine treatment 3 was similar to the proportion of subjects with established hSBA titers at baseline (before vaccine treatment 1).

[0150] For Group 1, the proportion of subjects with an hSBA titer of 1:16 after three doses of bivalent rLP2086 demonstrated that the vaccine elicited a vigorous immune response when three doses of bivalent rLP2086 were administered.

[0151] hSBA Geometric Mean Titers (GMT). Generally, baseline GMTs were below the hSBA LLOQ for both groups. For Group 1, hSBA GMTs 1 month after vaccine treatment 2 were 35.5 for A22, 91.1 for A56, 15.9 for B24, and 14.6 for B44. hSBA GMTs 1 month after vaccine treatment 3 were 63.4 for A22, 151.5 for A56, 28.3 for B24, and 36.5 for B44.

[0152] In group 1, GMTs observed after two doses for subfamily A strains and after three doses for subfamily B strains indicated a vigorous immune response.

[0153] Reverse cumulative distribution curves (RCDC) showing the distribution of hSBA titers for A22, A56, B24, and B44 were evaluated. Results from the RCDC in Group 1 indicated that substantial immune responses were observed among Group 1 subjects after vaccine treatment 2 of bivalent rLP2086; however, the figures also showed a benefit of the third dose of bivalent rLP2086, with a higher percentage of subjects achieving higher titers against the four MnB test strains. The effect was most pronounced for strain B44.

[0154] Conclusions: When given concomitantly with bivalent rLP2086, REPEVAX elicited immune responses comparable to those elicited by REPEVAX alone. The bivalent rLP2086 vaccine elicited vigorous bactericidal responses against four diverse MnB test strains, particularly those representing subfamily B, that were stronger after three doses than after two doses. Coadministration was generally safe and well tolerated.

[0155] [Table 3] [Example]

[0156] Example 5 Immunogenicity of the investigational meningococcal serogroup B bivalent rLP2086 vaccine in healthy adolescents Background and Objective: Neisseria meningitidis serogroup B (MnB) causes invasive disease in children, adolescents, and adults. LP2086 (factor H-binding protein [fHBP]), a conserved surface-exposed lipoprotein, is a potential MnB vaccine target. The safety and immunogenicity of an investigational bivalent recombinant vaccine (rLP2086) were investigated in healthy adolescents (11-18 years of age).

[0157] Methods: Subjects in this placebo-controlled, single-blind study were randomized to two 3-dose schedules and three 2-dose schedules. Each 120 μg dose contained two rLP2086 antigens, one from each LP2086 subfamily (A and B). When no vaccine was scheduled, saline was given. Serum bactericidal assays (hSBA) using human complement were performed with four MnB test strains (heterologous to the vaccine fHBP).

[0158] Results: 1,713 subjects (mean age 14.4 years) were randomized. One month after three doses of vaccine, hSBA titers of 8 or greater against subfamily A and B strains were observed in 95-99% and 86-89% of subjects, respectively. After two doses, these numbers ranged from 91-100% and 69-77% of subjects, respectively. Of the two-dose schedules, months 0 and 6 induced the highest antibody responses (Table 1 in Example 5). hSBA GMTs after two doses ranged from 6.2 to 125.6 across the four MnB heterologous test strains and from 25.6 to 155.6 after three doses. Mild to moderate injection site pain was the most common local reaction. Fever of 38°C or greater was experienced after dose 1 in 3.3-6.5% and 2.1% of rLP2086 and saline recipients, respectively.

[0159] [Table 4]

[0160] Conclusions: rLP2086 was well tolerated. All dosing regimens produced vigorous bactericidal responses that were most pronounced after the third dose.

[0161] Table 1 in Example 5 is the same as Table 1 in Example 1 above. Table 2 summarizes the hSBA GMTs and corresponding CIs by study time for the evaluable immunogenicity population. GMTs increased from baseline (before injection 1) and continued to increase with each subsequent dose of bivalent rLP2086.

[0162] For the four major MnB strains, GMTs were higher after three doses of bivalent rLP2086 (groups 1 and 2) than after two doses (groups 3, 4, and 5). GMTs were similar between the two sets of three dose groups and between the three sets of two dose groups.

[0163] Before injection 1 (baseline), the hSBA GMTs for groups 1, 2, 3, 4, and 5 were as follows: 7.1, 6.3, 6.4, 6.4, and 6.8, respectively, for A22; 6.8, 6.1, 6.7, 6.3, and 6.2, respectively, for A56; 5.3, 5.1, 5.0, 4.9, and 5.1, respectively, for B24; and 4.4, 4.5, 4.5, 4.6, and 4.4, respectively, for B44.

[0164] For Group 1 (0, 1, and 6 months), substantial increases in GMT were observed 1 month after dose 2 for all four major MnB strains (24.4, 77.3, 13.8, and 13.1 for A22, A56, B24, and B44, respectively). GMTs further increased after three doses of bivalent rLP2086 for the four major MnB test strains in Group 1 subjects: 55.1 (A22), 152.96 (A56), 29.1 (B24), and 40.3 (B44).

[0165] For Group 2, similar increases in GMT were observed after two and three doses of bivalent rLP2086. After two doses of bivalent rLP2086, the GMTs for Group 2 subjects were 32.9 for A22, 94.6 for A56, 14.9 for B24, and 15.5 for B44. After three doses, the GMTs increased to 56.3 for A22, 155.6 for A56, 25.6 for B24, and 35.0 for B44.

[0166] For groups 1 and 2, GMTs observed after two doses for subfamily A strains and after three doses for subfamily B strains indicate a vigorous immune response.

[0167] For group 3, after one dose of bivalent rLP2086, a slight increase in GMT was observed: 12.0 for A22, 18.5 for A56, 9.2 for B24, and 5.7 for B44. After two doses, GMT increased to 48.4 for A22, 125.6 for A56, 20.6 for B24, and 22.5 for B44.

[0168] For the four groups, GMTs were 13.3 for A22, 17.7 for A56, 9.8 for B24, and 5.9 for B44 after one dose of bivalent rLP2086. After two doses of bivalent rLP2086, GMTs were 37.1 for A22, 104.9 for A56, 17.7 for B24, and 19.1 for B44.

[0169] For the five groups, the GMT after one dose of bivalent rLP2086 was 16.0 in A22, 26.8 in A56, 12.6 in B24, and 6.8 in B44. After two doses of bivalent rLP2086, the GMT increased to 39.6 in A22, 111.8 in A56, 14.7 in B24, and 17.8 in B44.

[0170] Taken together, for groups 3, 4 and 5, the observed GMTs indicate an immune response for subfamily A and B strains after two doses of bivalent rLP2086.

[0171] In summary, three doses of bivalent rLP2086 produced the most vigorous and broadest immune responses based on hSBA titers against the four major MnB test strains. Compared with two doses, a higher proportion of subjects receiving three doses of bivalent rLP2086 achieved hSBA titers of 1:8 or greater against the four major MnB test strains.

[0172] Results after the 0-, 1-, and 6-month dose schedule (Group 1) were similar to those after the 0-, 2-, and 6-month dose schedule (Group 2). For Groups 1 and 2, GMT values ​​achieved after Dose 3 were higher than those after Dose 2. For Groups 1 and 2, GMT values ​​after Dose 2 ranged from 24.4 to 94.6 for subfamily A strains and 13.1 to 15.5 for subfamily B strains. GMT values ​​after Dose 3 ranged from 55.1 to 155.6 for subfamily A strains and 25.6 to 40.3 for subfamily B strains. For Groups 1 and 2, a higher percentage of subjects achieved hSBA titers of 1:8 or greater against the four major MnB test strains after three doses of bivalent rLP2086 compared with the percentage of subjects achieving hSBA titers of 1:8 or greater against the four major MnB test strains after two doses of bivalent rLP2086.

[0173] Subjects who achieved hSBA titers of 1:16 or greater were also evaluated. For Group 1, the percentage of subjects who achieved hSBA titers of 1:16 or greater 1 month after two doses of bivalent rLP2086 was 73.5% for A22, 96.3% for A56, 57.6% for B24, and 47.2% for B44. After three doses of bivalent rLP2086, the percentage of subjects in Group 1 who achieved hSBA titers of 1:16 or greater was 91.4% for A22, 99.2% for A56, 82.8% for B24, and 84.8% for B44.

[0174] For group 2, the percentage of subjects who achieved hSBA titers of 1:16 or greater 1 month after two doses of bivalent rLP2086 was 88.1% for A22, 97.9% for A56, 63.5% for B24, and 58.6% for B44. After three doses of bivalent rLP2086, the percentage of subjects in group 2 who achieved hSBA titers of 1:16 or greater was 95.0% for A22, 98.9% for A56, 83.6% for B24, and 83.8% for B44.

[0175] For Groups 1 and 2, the percentage of subjects achieving hSBA titers of 1:16 or greater after three doses of bivalent rLP2086 demonstrated that the vaccine elicited a vigorous immune response.

[0176] For the three groups, the percentage of subjects who achieved hSBA titers of 1:16 or greater after two doses of bivalent rLP2086 was 93.2% for A22, 98.4% for A56, 73.8% for B24, and 70.8% for B44.

[0177] For the four groups, the percentage of subjects achieving hSBA titers of 1:16 or greater 1 month after two doses of bivalent rLP2086 was 90.8% for A22, 99.2% for A56, 67.1% for B24, and 64.5% for B44.

[0178] For the five groups, the percentage of subjects who achieved hSBA titers of 1:16 or greater after two doses of bivalent rLP2086 was 91.0% for A22, 99.1% for A56, 64.5% for B24, and 66.7% for B44.

[0179] For groups 3, 4, and 5, the percentage of subjects achieving hSBA titers of 1:16 or greater demonstrated that the vaccine elicited a vigorous immune response against subfamily A strains after only two doses, but three doses increased the vigorousness of the response against subfamily B strains.

[0180] The percentage of subjects achieving hSBA titers of 1:16 or greater after three doses of bivalent rLP2086 indicates that the vaccine elicits a vigorous and broad immune response against MnB strains expressing LP2086 variants distinct from the vaccine components.

[0181] For each strain's evaluable immunogenic population, inverse cumulative distribution curves (RCDC), showing the distribution of hSBA titers over time, were also assessed. RCDC indicates a robust immune response after two doses of bivalent rLP2086 subfamily A strains. After the third dose of bivalent rLP2086, the area under the response curve increased for all four major MnB test strains, demonstrating an enhanced immune response after three doses of bivalent rLP2086.

[0182] Results from primary and secondary immunogenicity endpoint analyses indicate that the vaccine can generate antibodies with significant hSBA activity against heterologous subfamily A and subfamily B variants of MnB. Although the proportion of subjects achieving hSBA titers of 1:8 or greater was higher after two or three doses of bivalent rLP2086, the majority of subjects achieved hSBA titers of 1:8 or greater one month after one dose of bivalent rLP2086. See, e.g., group 5.

[0183] For the four major MnB test strains, GMTs were higher with three doses of bivalent rLP2086 (groups 1 and 2) than with two doses (groups 3, 4, and 5). GMTs were similar in the two sets of three dose groups. GMTs were also similar among the three sets of two dose groups. These data also demonstrate a vigorous hSBA response after three doses of bivalent rLP2086, based on the percentage of subjects achieving hSBA titers of 1:16 or greater.

[0184] These data demonstrate that the final formulation of bivalent rLP2086, when given in two or three doses, produces a vigorous immune response and is safe and well-tolerated. Even a single dose of bivalent rLP2086 produces a substantial immune response above baseline and is similarly safe and well-tolerated. Overall, no clinically meaningful differences were observed in the safety profile after two or three doses of bivalent rLP2086. [Example]

[0185] Example 6 Safety, tolerability, and immunogenicity of the meningococcal serogroup B bivalent rLP2086 vaccine in healthy adolescents aged 11 to 18 years in three phase 2 randomized controlled trials. Background: Neisseria meningitidis serogroup B (MnB) is the leading cause of invasive meningococcal disease in adolescents. LP2086 (factor H-binding protein [fHBP]), a conserved surface-exposed lipoprotein, is a promising vaccine target for protection against invasive disease caused by MnB. The safety, tolerability, and immunogenicity of an investigational bivalent recombinant MnB vaccine (containing SEQ ID NO: 1 and SEQ ID NO: 2, a 2.8 molar ratio of polysorbate 80, 0.5 mg / ml aluminum, 10 mM histidine, and 150 mM sodium chloride; referred to herein throughout the Examples as "bivalent rLP2086") were investigated in three phase 2 randomized controlled trials in healthy adolescents aged 11 to 18 years.

[0186] Methods: Study 1012 examined five bivalent rLP2086 vaccine regimens, while studies 1010 and 1011 evaluated three dose schedules of bivalent rLP2086 vaccine given concomitantly with TdaP-IPV and HPV vaccines, respectively. Each dose of bivalent rLP2086 contained 60 μg of rLP2086 subfamily A variant A05 and 60 μg of rLP2086 subfamily B variant B01. To examine the immunogenicity of bivalent rLP2086 in each of the three studies, human complement serum bactericidal assays (hSBA) were performed using four MnB test strains expressing heterologous fHBP variants A22, A56, B24, and B44, which were selected to represent a reasonable diversity of fHBP variability and to provide insight into the breadth of vaccine-induced immune responses against strains expressing epidemiologically dominant fHBP variants. Adverse events and desired local and systemic responses were assessed.

[0187] Results: Between 82 and 100% of subjects in all three studies achieved hSBA titers above the lower limit of quantitation (LLOQ) for each of the four MnB test strains 1 month after dose 3 (Table). Across all three studies, the majority of systemic events and local reactions were mild to moderate in severity, and adverse events were generally not serious or related to the study vaccine.

[0188] Conclusions: Serum bactericidal antibody titers greater than 1:4 confer protection against invasive meningococcal disease. The demonstration of hSBA titers at or above the LLOQ against four MnB test strains, each heterologous to the vaccine antigen, in each of these adolescent phase II studies suggests that the bivalent rLP2086 vaccine elicited broad and potentially vigorous functional antibody responses against diverse strains associated with MnB disease. Vaccine treatment with bivalent rLP2086 was generally well tolerated.

[0189] [Table 5] [Example]

[0190] Example 7 Immunogenicity of meningococcal serogroup B bivalent rLP2086 vaccine in healthy adolescents aged 11 to 18 years when coadministered with human papillomavirus vaccine This phase 2, randomized, observer-blind, controlled trial evaluated the immunogenicity of bivalent rLP2086 with or without coadministration of GARDASIL®, a quadrivalent vaccine against human papillomavirus (HPV4) (also described in U.S. Patent No. 5,820,870), in healthy adolescents aged 11 to 18 years. GARDASIL contains recombinant antigens of the L1 proteins of HPV types 6, 11, 16, and 18 (i.e., HPV-6, HPV-11, HPV-16, and HPV-18). Endpoints were hSBA GMTs for each of the four major MnB test strains at each applicable blood draw time point.

[0191] Methods: Subjects received bivalent rLP2086 (SEQ ID NO: 1 and SEQ ID NO: 2, containing a 2.8 molar ratio of polysorbate 80, 0.5 mg / ml aluminum, 10 mM histidine, and 150 mM sodium chloride) plus HPV4 (Group 1), bivalent rLP2086 plus saline (Group 2), or HPV4 plus saline (Group 3) at 0, 2, and 6 months. Sera from subjects in Groups 1 and 2 before vaccine treatment 1 and 1 month after vaccine treatments 2 and 3 were tested by human complement serum bactericidal assay (hSBA) using four MnB test strains, each expressing fHBPs (A22, A56, B44, and B24) that are nonhomologous to the vaccine components and represent the epidemiological dominance of fHBPs in addition to the breadth of fHBP diversity. Endpoints evaluated included the proportion of subjects with hSBA titers ≥ the lower limit of quantitation (LLOQ, 1:16 [A22] or 1:8 [A56, B44, B24]) and hSBA geometric mean titers (GMT).

[0192] To demonstrate the non-inferiority of GARDASIL plus bivalent rLP2086 compared to GARDASIL alone, immunogenicity evaluation was performed in two hSBAs using one lead test strain (A22) representing subfamily A variants and one lead test strain (B24) representing subfamily B variants. However, all four lead MnB test strains were used to assess the additional bivalent rLP2086 immunogenicity / efficacy study endpoints.

[0193] To assess the immune response to bivalent rLP2086, functional antibodies were analyzed in an hSBA using meningococcal serogroup B strains randomly selected from Pfizer's representative MnB SBA strain pool as described in Example 2. This hSBA measured functional antibodies in human sera that caused complement-dependent killing of the target meningococcal strains.

[0194] Results: 814 and 812 subjects comprised the evaluable immunogenic population for Groups 1 and 2, respectively. The proportion of subjects with hSBA titers at or above the LLOQ for all four test strains was higher after vaccine treatments 2 (55%-99%) and 3 (83%-99%, Figure 1) compared with before vaccine treatment 1. Table A in Example 7 shows the hSBA GMTs and corresponding CIs for each of the four major MnB strains by time of sample collection for the evaluable immunogenic population. Baseline GMTs were below the hSBA LLOQ for both groups. GMTs ranged from 11.1-70.6 and 11.9-76.3 after vaccine treatment 1 and 25.8-117.2 and 28.0-128.2 after vaccine treatment 2, respectively, in Groups 1 and 2 (Table A below).

[0195] For the evaluable immunogenicity population, hSBA GMTs against the two major MnB strains for groups 1 and 2 one month after vaccine treatment with the 3 bivalent rLP2086 dose were as follows: 53.3 and 57.8, respectively, for A22, and 25.8 and 28.0, respectively, for B24.

[0196] For group 2 (bivalent rLP2086 + saline), hSBA GMTs 1 month after vaccine treatment 2 were 33.7 for A22, 76.3 for A56, 16.3 for B24, and 11.9 for B44. hSBA GMTs 1 month after vaccine treatment 3 were 57.8 for A22, 128.2 for A56, 28.0 for B24, and 31.9 for B44.

[0197] For group 1 (bivalent rLP2086 + GARDASIL), hSBA GMTs 1 month after vaccine treatment 2 were 31.9 for A22, 70.6 for A56, 15.0 for B24, and 11.1 for B44. hSBA GMTs 1 month after vaccine treatment 3 were 53.3 for A22, 117.2 for A56, 25.8 for B24, and 27.2 for B44.

[0198] For the evaluable immunogenic population, inverse cumulative distribution curves (RCDC) showing the distribution of hSBA titers for A22, A56, B24, and B44 were assessed for groups 1 and 2 at all sample collection time points. RCDC showed that the majority of subjects responded after vaccine treatment 2, with further increases in titers for the four major MnB test strains after vaccine treatment 3. The immune responses to the antigens were similar in groups 1 and 2.

[0199] Conclusions: Bivalent rLP2086 can be administered with HPV4 without affecting hSBA seroresponses or bactericidal responses as assessed by GMT. Because hSBA titers of 1:4 or greater correlate with protection against meningococcal disease, these data suggest that bivalent rLP2086 may protect adolescents against a broad range of MnB strains after administration in the setting of coadministration of an HPV vaccine.

[0200] [Table 6] [Example]

[0201] Example 8 Immunogenicity of human papillomavirus vaccine co-administered with bivalent rLP2086 vaccine against meningococcal serogroup B in healthy adolescents BACKGROUND:This phase 2 randomized trial evaluated coadministration of a quadrivalent vaccine against human papillomavirus (HPV4) with bivalent rLP2086, an investigational vaccine against invasive disease caused by Neisseria meningitidis serogroup B (MnB), in healthy adolescents aged 11 to 18 years.

[0202] Methods: Subjects received HPV4 plus bivalent rLP2086 (group 1), bivalent rLP2086 plus saline (group 2), or saline plus HPV4 (group 3) at 0, 2, and 6 months. Serum was collected at baseline and after doses 2 and 3 in all groups. Immune responses to HPV4 antigens (HPV-6, 11, 16, and 18) were determined by competitive LUMINEX immunoassay (cLIA). Bivalent rLP2086 immunogenicity was measured by human complement-based serum bactericidal assay (hSBA) using two MnB test strains expressing the vaccine-heterologous fHBP variants (A22 and B24). Immunogenicity endpoints, all after dose 3, included geometric mean titers (GMTs) to HPV antigens in groups 1 and 3, hSBA GMTs for strains expressing variants A22 and B24 in groups 1 and 2, and seroconversion rates to HPV antigens in baseline seronegative subjects in groups 1 and 3. Safety of bivalent rLP2086 was also assessed following coadministration of HPV4 or saline.

[0203] Immune responses to GARDASIL (HPV types 6, 11, 16, and 18 L1 proteins) were assessed using a fluorescently labeled microsphere-based cLIA (LUMINEX). Sera from all subjects in groups 1 and 3, obtained before the first GARDASIL vaccination (Visit 1) and 1 month after the third GARDASIL vaccination (Visit 5), were used in these assays.

[0204] A comparison of the GMTs for the four HPV antigens for Groups 1 and 3, along with the corresponding GMT ratios (GMRs) of Group 1 to Group 3 and the two-sided 95% CIs of those ratios, is shown in Table A following this Example. The non-inferiority margin criterion was 1.5-fold, corresponding to a value of 0.67 for the lower limit of the two-sided 95% CI of the GMR. The 1.5-fold criterion of 0.67 was met for all MnB test strains and HPV antigens except for HPV-18, for which the lower 95% confidence interval (CI) was 0.62. In a separate analysis, more than 99% of subjects in both the saline + HPV4 and rLP2086 + HPV4 groups seroconverted to all four HPV antigens.

[0205] Another objective of this study was to describe the immune responses elicited by bivalent rLP2086 + GARDASIL (Group 1) and saline + GARDASIL (Group 3) as measured by seroconversion in an HPV immunogenicity assay after three doses of GARDASIL vaccination (Visit 5) in both groups.

[0206] For subjects in groups 1 and 3 who were HPV-seronegative at baseline, seroconversion rates for each of the four HPV antigens one month after the last dose of GARDASIL were calculated as the proportion of subjects with anti-HPV serum cLIA levels ≥ 20mMU / ml for HPV-6, ≥ 16mMU / ml for HPV-11, ≥ 20mMU / ml for HPV-16, and ≥ 24mMU / ml for HPV-18.

[0207] For the evaluable baseline HPV-seronegative immunogenic population, the number and proportion of baseline HPV-seronegative subjects who reach the predetermined seroconversion criteria for the four HPV antigens are shown in Table B of Example 8, along with the corresponding 95% CI for each group, the percent difference in proportion (Group 1-Group 3), and the 95% CI for that difference.

[0208] Results: The pre-specified non-inferiority criterion, set at 1.5 (lower limit of the 95% CI of the GMR, 0.67), was met for three of the four HPV antigens (but not HPV-18) and both MnB test strains (Table A). Seroconversion rates in groups 1 and 3 were 99% or greater for all HPV antigens (Table B). Greater local reactogenicity occurred after rLP2086 compared with saline, but this did not increase with subsequent doses, and injection-site pain was the most common local reaction. Systemic events in all three groups were generally mild and moderate in severity.

[0209] For the evaluable immunogenicity population, 1 month after the GARDASIL dose of vaccine treatment 3, the GMTs for antibodies to the four HPV antigens for groups 1 and 3 were as follows: 451.8 and 550.3, respectively (HPV-6), 892.9 and 1084.3, respectively (HPV-11), 3695.4 and 4763.4, respectively (HPV-16), and 744.0 and 1047.4, respectively (HPV-18). One month after the GARDASIL dose for vaccine treatment 3, the GMRs for the three groups in group 1 were 0.82 (95% CI: 0.72, 0.94) for HPV-6, 0.82 (95% CI: 0.74, 0.91) for HPV-11, 0.78 (95% CI: 0.68, 0.88) for HPV-16, and 0.71 (95% CI: 0.62, 0.81) for HPV-18. Thus, the lower limits of the two-sided 95% CIs for the anti-HPV GMRs for the three groups in group 1 were 0.72 for HPV-6, 0.74 for HPV-11, 0.68 for HPV-16, and 0.62 for HPV-18. The 1.5-fold criterion of 0.67 (lower limit of the two-sided 95% CI of the GMR) was met for all HPV antigens except for HPV-18, for which the lower limit of the 95% CI was 0.62.

[0210] One month after the bivalent rLP2086 dose in vaccine treatment 3, the GMR for the bivalent rLP2086 + GARDASIL group relative to the bivalent rLP2086 + saline group was 0.92 (95% CI: 0.85, 1.00) for A22 and 0.92 (95% CI: 0.84, 1.01) for B24. The lower limits of the two-sided 95% CIs for the hSBA GMR for group 1 relative to group 2 were 0.85 for A22 and 0.84 for B24, both greater than 0.67 and therefore met the 1.5-fold noninferiority limit.

[0211] Data from bivalent rLP2086 + GARDASIL (Group 1) administration were compared with data from bivalent rLP2086 + saline (Group 2) administration by analyzing the hSBA titer 4-fold response rate for the two major MnB strains (A22 and B24) 1 month after vaccine treatment 3. The proportion of subjects achieving a 4-fold or greater increase in hSBA titer for the two major MnB strains from baseline to 1 month after vaccine treatment 3 was measured for both Group 1 subjects receiving bivalent rLP2086 + GARDASIL and Group 2 subjects receiving bivalent rLP2086 + saline. Of Group 1 subjects, 85.3% demonstrated a 4-fold or greater increase in hSBA titer to B24. Of Group 2 subjects, 86.4% demonstrated a 4-fold or greater increase in hSBA titer to A22 and 84.8% demonstrated a 4-fold or greater increase in hSBA titer to B24.

[0212] The difference in responder rates between groups 1 and 2 one month after vaccine treatment 3 was -1.1% (95% CI: -4.6, 2.3) for A22 and -1.4% (95% CI: -5.1, 2.3) for B24. The differences in quadruple response rates were all close to 1%, with the lower limits of the 95% CIs for the difference in rates being -4.6% for A22 and -5.1% for B24.

[0213] Noninferiority criteria comparing bivalent rLP2086 plus GARDASIL with saline plus GARDASIL or bivalent rLP2086 plus saline required the lower limit of the two-sided 95% CI for GMR of antibodies to HPV for all four HPV antigens (HPV-6, HPV-11, HPV-16, and HPV-18) and hSBA titers using the two major MnB test strains (A22 and B24) to be greater than 0.67 at 1 month after vaccine treatment 3. This pre-determined criterion was met for both MnB test strains and at least three of the four HPV antigens. For HPV-18, the lower limit of the two-sided CI for GMR was 0.62, just below the pre-determined threshold of 0.67.

[0214] The fourfold elevated responses to the two major MnB test strains (A22 and B24) were similar (ranging from 83.4% to 86.4%) in the groups given bivalent rLP2086 + GARDASIL and bivalent rLP2086 + saline.

[0215] The percentage of subjects in Groups 1 and 2 with prevaccination (i.e., before vaccine treatment 1) hSBA titers of 1:4 or greater was 15.2% and 18.8%, respectively, for strain A22, 10.4% and 10.5%, respectively, for strain A56, 6.1% and 8.4%, respectively, for strain B24, and 1.7% and 3.2%, respectively, for strain B44. Additionally, the percentage of subjects in Groups 2 and 1 with prevaccination hSBA titers of 1:16 or greater was 13.7% and 16.4%, respectively, for strain A22, 9.0% and 9.1%, respectively, for strain A56, 4.1% and 5.4%, respectively, for strain B24, and 1.2% and 2.1%, respectively, for strain B44.

[0216] In group 2 (bivalent rLP2086 + saline), the percentage of subjects with hSBA titers ≥1:4 1 month after vaccine treatment 2 was 86.3% for A22, 98.7% for A56, 77.1% for B24, and 60.1% for B44. One month after vaccine treatment 3, the percentage of subjects with hSBA titers ≥1:4 was 96.4% for A22, 99.4% for A56, 92.8% for B24, and 86.5% for B44. In group 1 (bivalent rLP2086 + GARDASIL), the percentage of subjects with hSBA titers ≥1:4 1 month after vaccine treatment 2 was 83.8% for A22, 97.8% for A56, 71.9% for B24, and 57.7% for B44. One month after vaccine treatment 3, the percentage of subjects with hSBA titers ≥1:4 was 94.3% for A22, 99.1% for A56, 91.1% for B24, and 84.4% for B44.

[0217] In group 2 (bivalent rLP2086 + saline), the percentage of subjects with hSBA titers ≥ 1:16 1 month after vaccine treatment 2 was 85.8% for A22, 98.4% for A56, 68.8% for B24, and 49.9% for B44. One month after vaccine treatment 3, the percentage of subjects with hSBA titers ≥ 1:16 was 96.3% for A22, 99.4% for A56, 89.2% for B24, and 82.4% for B44. In group 1 (bivalent rLP2086 + GARDASIL), the percentage of subjects with hSBA titers ≥ 1:16 1 month after vaccine treatment 2 was 83.0% for A22, 97.2% for A56, 65.2% for B24, and 46.4% for B44. One month after vaccine treatment 3, the percentage of subjects with hSBA titers of 1:16 or greater was 94.0% for A22, 98.9% for A56, 86.3% for B24, and 78.0% for B44.

[0218] For both Groups 1 and 2, after two or three doses of bivalent rLP2086, a high proportion of subjects achieved hSBA titers of 1:16 or greater, but the majority of subjects did not have measurable hSBA titers to any of the major MnB test strains at pre-vaccine Visit 1.

[0219] For the evaluable baseline HPV-seronegative immunogenic population, the proportions of subjects reaching the predefined criteria for HPV seroconversion for HPV antigens 1 month after the GARDASIL dose of vaccine treatment 3 were as follows for the bivalent rLP2086 + GARDASIL group (Group 1) and the saline + GARDASIL group (Group 3): HPV-6 (99.4% and 99.3%, respectively), HPV-11 (99.6% and 99.5%, respectively), HPV-16 (99.6% and 99.5%, respectively), and HPV-18 (99.5% and 99.0%, respectively).

[0220] One month after the GARDASIL dose, the differences in the proportion of responders between the bivalent rLP2086 plus GARDASIL group (group 1) and the saline plus GARDASIL group (group 3) were 0.1% (95% CI: -0.9, 1.5) for HPV-6, 0.1% (95% CI: -0.7, 1.3) for HPV-11, 0.1% (95% CI: -0.7, 1.3) for HPV-16, and 0.5% (95% CI: -0.6, 1.9) for HPV-18.

[0221] For the bivalent rLP2086 + GARDASIL group (Group 1) and the saline + GARDASIL group (Group 3), the difference in seroconversion rates was within 0.1% and 0.5% across all four HPV antigens, and seroconversion rates were very similar across groups, with over 99% of subjects seroconverting for all four HPV antigens.

[0222] As an additional evaluation, bivalent rLP2086 plus GARDASIL (Group 1) was compared with bivalent rLP2086 plus saline (Group 2) by analyzing the hSBA titer 4-fold response rate for the two major MnB strains (A22 and B24) 1 month after vaccine treatment 3. The percentage of subjects achieving a 4-fold or greater increase in hSBA titer for the two major MnB strains from baseline to 1 month after vaccine treatment 3 was as follows: 85.3% of subjects in Group 1 demonstrated a 4-fold or greater increase in hSBA titer to test strain A22, and 83.4% demonstrated a 4-fold or greater increase in hSBA titer to test strain B24. 86.4% of subjects in Group 2 demonstrated a 4-fold or greater increase in hSBA titer to test strain A22, and 84.8% demonstrated a 4-fold or greater increase in hSBA titer to test strain B24.

[0223] The difference in responder rates between groups 1 and 2 1 month after vaccine treatment 3 was -1.1% (95% CI: -4.6, 2.3) for A22 and -1.4% (95% CI: -5.1, 2.3) for B24. The differences in quadruple response rates were all close to 1%, with the lower limits of the 95% CIs for the difference in rates being -4.6% (A22) and -5.1% (B24).

[0224] Immune Responses to Bivalent rLP2086. Another objective of this study was to describe the immune responses measured one month after the second visit (Visit 3) and one month after the third vaccination with bivalent rLP2086 (Visit 5) as measured by hSBA performed with four major MnB test strains, two expressing LP2086 subfamily A proteins (A22 and A56) and two expressing LP2086 subfamily B proteins (B24 and B44).

[0225] One endpoint for this purpose was the proportion of subjects with hSBA titers equal to or greater than the LLOQ for each of the four major MnB test strains one month after vaccine treatment 2 (Visit 3) and one month after vaccine treatment 3 (Visit 5). For the evaluable immunogenic population, the proportion of subjects with hSBA titers equal to or greater than the LLOQ for each of the four major MnB test strains was assessed. The LLOQ for A22 was an hSBA titer equivalent to 1:16, and the LLOQ for all other MnB test strains was an hSBA titer equivalent to 1:8.

[0226] For group 2 (bivalent rLP2086 + saline), the percentage of subjects with hSBA titers equal to or greater than the LLOQ at baseline (before vaccine treatment 1) was 16.4% for A22, 9.3% for A56, 6.9% for B24, and 2.5% for B44. For group 2, the percentage of subjects achieving hSBA titers equal to or greater than the LLOQ 1 month after vaccine treatment 2 and 1 month after vaccine treatment 3 was 85.8% and 96.3%, respectively, for A22, 98.5% and 99.4%, respectively, for A56, 74.2% and 92.6%, respectively, for B24, and 57.1% and 85.7%, respectively, for B44.

[0227] For group 1 (bivalent rLP2086 + GARDASIL), the percentage of subjects with hSBA titers equal to or greater than the LLOQ at baseline (before vaccine treatment 1) was 13.7% for A22, 9.2% for A56, 5.1% for B24, and 1.4% for B44. For group 1, the percentage of subjects achieving hSBA titers equal to or greater than the LLOQ 1 month after vaccine treatment 2 and 1 month after vaccine treatment 3 was 83.0% and 94.0%, respectively, for A22, 97.5% and 98.9%, respectively, for A56, 70.6% and 90.5%, respectively, for B24, and 54.5% and 82.7%, respectively, for B44.

[0228] Substantial hSBA responses were observed against the four major MnB test strains among subjects in both groups 1 and 2 one month after vaccine treatment 2, with an additional increase observed one month after vaccine treatment 3.

[0229] For the evaluable immunogenic population, the proportion of subjects achieving a 4-fold or greater increase in hSBA titer for each of the four major MnB test strains and the proportion of subjects achieving a combined response were assessed. The proportion of subjects with hSBA titers at or above the LLOQ for all four MnB strains in the mix at baseline (before vaccine treatment 1) was similar between Group 1 (0.3%) and Group 2 (0.7%).

[0230] For group 2 (bivalent rLP2086 + saline), the percentage of subjects achieving a 4-fold or greater increase in hSBA titer from baseline to 1 month after vaccine treatment 3 was 86.4% for A22, 95.3% for A56, 84.8% for B24, and 80.7% for B44, with 83.9% achieving a combined hSBA response (hSBA at or above the LLOQ for all four major strains in the mix). One month after vaccine treatment 2, the percentage of subjects achieving a 4-fold or greater increase in hSBA titer from baseline was 74.2% for A22, 92.6% for A56, 63.4% for B24, and 47.4% for B44, with 51.9% achieving a combined hSBA response.

[0231] For group 1 (bivalent rLP2086 + saline), the percentage of subjects achieving a 4-fold or greater increase in hSBA titer from baseline to 1 month after vaccine treatment 3 was 86.4% for A22, 95.3% for A56, 84.8% for B24, and 80.7% for B44, with 83.9% achieving a combined hSBA response (hSBA at or above the LLOQ for all four major strains in the mix). One month after vaccine treatment 2, the percentage of subjects achieving a 4-fold or greater increase in hSBA titer from baseline was 74.2% for A22, 92.6% for A56, 63.4% for B24, and 47.4% for B44, with 51.9% achieving a combined hSBA response.

[0232] Additional hSBA fold response. Other endpoints were the proportion of subjects achieving at least a 2-fold and 3-fold increase in hSBA titer for each of the four major MnB strains from baseline to each post-vaccine treatment blood collection visit. Note that the LLOQ for A22 was an hSBA titer equivalent to 1:16, and the LLOQ for all other MnB test strains was an hSBA titer equivalent to 1:8.

[0233] For groups 1 and 2, the percentages of subjects achieving a 2-fold or greater increase in hSBA titer for the MnB strain from baseline to 1 month after vaccine treatment 2 were 77.3% and 81.1% for A22, 94.4% and 95.3% for A56, 63.0% and 66.0% for B24, and 46.1% and 48.6% for B44. For groups 1 and 2, the percentages of subjects achieving a 2-fold or greater increase in hSBA titer for the MnB strain from baseline to 1 month after vaccine treatment 3 were 90.2% and 92.8% for A22, 97.2% and 97.9% for A56, 84.6% and 87.2% for B24, and 77.7% and 81.7% for B44.

[0234] For groups 1 and 2, the percentages of subjects achieving a 3-fold or greater increase in hSBA titer for the MnB strain from baseline to 1 month after vaccine treatment 2 were 73.1% and 74.2% for A22, 92.5% and 92.6% for A56, 61.3% and 63.4% for B24, and 45.7% and 47.4% for B44. For groups 1 and 2, the percentages of subjects achieving a 3-fold or greater increase in hSBA titer for the MnB strain from baseline to 1 month after vaccine treatment 3 were 85.3% and 86.4% for A22, 95.0% and 95.3% for A56, 83.4% and 84.8% for B24, and 77.0% and 80.7% for B44.

[0235] In a summary of objective descriptive endpoints, the majority of subjects achieved hSBA titers at or above the LLOQ for all four major MnB test strains for both Group 1 (bivalent rLP2086 + GARDASIL) and Group 2 (bivalent rLP2086 + saline), with only a very small proportion of subjects having measurable hSBA titers at or above the LLOQ at baseline (pre-vaccine visit 1). For subjects in both Groups 1 and 2, substantial immune responses were observed with the four MnB strains one month after vaccine treatment 2, with an additional increase observed one month after vaccine treatment 3. This conclusion was confirmed by the proportion of subjects with hSBA titers at or above 1:16 after three doses, the GMT measurements obtained after doses two and three in both groups, and the RCDC for the four major MnB test strains.

[0236] For both Groups 1 and 2, a high percentage of subjects achieved a 4-fold or greater increase in hSBA titer for each of the major MnB test strains and a combined hSBA response at or above the LLOQ for all four major MnB strains after the third study vaccine treatment.

[0237] Additionally, for both Group 1 (bivalent rLP2086 + GARDASIL) and Group 2 (bivalent rLP2086 + saline), the majority of subjects achieved a ≥3-fold increase in hSBA titer and a ≥2-fold increase in hSBA titer for the four major MnB strains at all sample collection time points. A higher proportion of subjects met these criteria after three vaccine treatments compared with two vaccine treatments.

[0238] These results support evidence that the immune response to bivalent rLP2086 when co-administered with the HPV vaccine GARDASIL results in a vigorous immune response comparable to that to bivalent rLP2086 plus saline.

[0239] HPV GMTs. Table B in Example 8 shows the GMTs and corresponding CIs for each of the four HPV antigens at 1 month after vaccine treatment 3 for Groups 1 (bivalent rLP2086 + GARDASIL) and 3 (saline + GARDASIL) of the evaluable immunogenicity population.

[0240] For group 3, the HPV GMTs at baseline (before vaccine treatment 1) and 1 month after vaccine treatment 3 were 6.0 and 550.3 for HPV-6, 4.3 and 1084.3 for HPV-11, 6.1 and 4763.4 for HPV-16, and 5.3 and 1047.4 for HPV-18. For group 1 (bivalent rLP2086 + GARDASIL), the HPV GMTs at baseline (before vaccine treatment 1) and 1 month after vaccine treatment 3 were 5.8 and 451.8 for HPV-6, 4.2 and 892.9 for HPV-11, 5.8 and 3695.4 for HPV-16, and 5.2 and 744.0 for HPV-18. Overall, GMTs were higher in group 3 compared with group 1. Reverse cumulative distribution curves (RCDC) showing the distribution of titers for HPV-6, HPV-11, HPV-16, and HPV-18 were evaluated for Groups 1 (bivalent rLP2086 + GARDASIL) and 3 (saline + GARDASIL) at all sample collection time points for the evaluable immunogenic population. RCDC demonstrated vigorous immune responses among subjects after vaccine treatment 3 for both Groups 1 and 3.

[0241] Summary of immune response to GARDASIL. GMTs to HPV antigens were higher in Group 3 (saline + GARDASIL) compared with Group 1 (bivalent rLP2086 + GARDASIL), and HPV GMTs observed after vaccine treatment 3 indicated a robust immune response for both groups. RCDC also supported a robust immune response after vaccine treatment 3 for both Groups 1 and 3. This was supported by the proportion of subjects seropositive for four HPV antigens being greater than 99% for both groups 1 month after vaccine treatment 3. The younger subgroup had higher HPV GMTs than the older subgroup in Group 3 (saline + GARDASIL). This difference was maintained when GARDASIL was given concomitantly with bivalent rLP2086.

[0242] Immunogenicity Conclusions. Non-inferiority criteria comparing bivalent rLP2086_GARDASIL to saline + GARDASIL or bivalent rLP2086 + saline required the lower limit of the two-sided 95% CI to exceed 0.67 for titer geometric mean ratios (GMRs) of antibodies to HPV for all four HPV antigens (HPV-6, HPV-11, HPV-16, and HPV-18) and hSBA titers using the two major MnB test strains (A22 and B24) at 1 month after vaccine treatment 3. This pre-determined threshold was met for both MnB strains and three of the four HPV antigens. For HPV-18, the lower limit of the two-sided 95% CI for GMR was 0.62, slightly below the pre-determined threshold of 0.67.

[0243] More than 99% of subjects in the groups receiving GARDASIL concomitantly with bivalent rLP2086 or saline achieved seroconversion for all four HPV antigens. RCDC for all four HPV antigens indicates that the majority of subjects achieved a response above the seroconversion threshold one month after vaccine treatment 3. GMTs stronger than baseline were observed for both groups receiving GARDASIL.

[0244] The fourfold elevated responses to the two major MnB test strains (A22 and B24) were similar (ranging from 83.4% to 86.4%) in the groups given bivalent rLP2086 plus GARDASIL (85.3% and 83.4%, respectively) and bivalent rLP2086 plus saline (86.4% and 84.8%, respectively).

[0245] Another descriptive analysis of responses to bivalent rLP2086 was performed using four major MnB test strains (A22, A56, B24, and B44). For the evaluable immunogenicity population, in both groups receiving bivalent rLP2086 concurrently with either GARDASIL (bivalent rLP2086 + GARDASIL) or saline (bivalent rLP2086 + saline), a high percentage of subjects achieved a 4-fold or greater rise in hSBA titers and combined responses (the same immunogenicity / efficacy endpoint definitions used for all four major MnB test strains and in the Phase 3 clinical program) one month after vaccine treatment 2 or 3. These responses are substantially higher than the 1:4 or greater hSBA titers that have been shown to correlate with protection against meningococcal disease, including serogroup B disease. These results again suggest and support evidence of a vigorous immune response to bivalent rLP2086, whether administered with saline or coadministered with GARDASIL.

[0246] Conclusions: The data demonstrate that coadministration of rLP2086+HPV4 resulted in vigorous immune responses to both vaccines. The predefined non-inferiority criteria were met for five of six antigens. While GMR against HPV-18 narrowly missed the non-inferiority criteria, the high responder rate (>99%) suggests that sustained clinical efficacy is expected after coadministration. Bivalent rLP2086 was well tolerated and elicited vigorous immune responses against test strains expressing fHBP heterologous to that in the vaccine.

[0247] [Table 7]

[0248] [Table 8] [Example]

[0249] Example 9: Efficacy of bivalent RLP2086 vaccine The efficacy of bivalent rLP2086 was inferred using hSBA responses as a surrogate for efficacy and demonstration of serum bactericidal antibody responses against invasive N. meningitidis serogroup B (MnB) strains.

[0250] Four MnB strains representative of strains causing invasive meningococcal disease (IMD) were used in the evaluation. Each MnB test strain expresses a different fHBP protein variant (A22, A56, B24, or B44) that is non-homologous to a vaccine component (A05 and B01).

[0251] The efficacy of bivalent rLP2086 was evaluated in three randomized, controlled Phase II trials conducted in 4,459 adolescents aged 11 to 18 years in the United States and Europe. See also Example 6. A total of 2,293 individuals received at least one dose of 120 μg bivalent rLP2086 using 0-, 2-, and 6-month vaccination schedules. Efficacy was assessed by evaluating hSBA immune responses in subjects vaccinated with bivalent rLP2086.

[0252] Five coprimary immunogenicity endpoints were used to estimate efficacy. Four of the five coprimary endpoints required a defined percentage of subjects to achieve a four-fold increase in hSBA titers against each of the four MnB test strains after three doses of bivalent rLP2086. The fifth coprimary endpoint was a composite endpoint requiring a defined high percentage of subjects to respond to all four hSBAs with each of the four primary MnB test strains after three doses of bivalent rLP2086. Immune responses were also assessed based on the percentage of subjects achieving hSBA titers equal to or greater than the lower limit of quantification (LLOQ) one month after the third dose of vaccine. The LLOQ is defined as the lowest amount of antibody that can be measured in a sample.

[0253] Study 1 (described in Examples 7 and 8) was a Phase II, randomized, active-controlled, observer-blind, multicenter trial in which 2499 US subjects aged 11 to 17 years were randomly assigned (in a 2:2:1 ratio) to one of three groups: group 1 received bivalent rLP2086 + HPV4, group 2 received bivalent rLP2086 + saline, and group 3 received saline + HPV4. All vaccine treatments were administered on a 0-, 2-, and 6-month schedule.

[0254] Study 2 (described in Example 4) was a phase II, randomized, placebo-controlled, single-blind study in which 753 European subjects aged 11 to 18 years were randomly assigned 1:1 to two groups: Group 1 received bivalent rLP2086 at 0, 2, and 6 months and dTaP-IPV (diphtheria, tetanus, acellular pertussis-inactivated poliovirus) at 0 months, and Group 2 received saline at 0, 2, and 6 months and dTaP-IPV at 0 months.

[0255] Study 3 (described in Example 5) was a Phase II, randomized, placebo-controlled, single-blind, multicenter study in which 1713 European subjects aged 11 to 18 years were randomly assigned to five groups in a 3:3:3:2:1 ratio. Subjects received two or three doses of bivalent rLP2086 administered on a 0-, 1-, and 6-month schedule (Group 1), a 0-, 2-, and 6-month schedule (Group 2), a 0- and 6-month schedule (Group 3), a 0- and 2-month schedule (Group 4), or a 0- and 4-month schedule (Group 5). Saline injections (one or two doses depending on the group) were administered in each group to maintain blinding.

[0256] The results of Studies 1, 2, and 3 among subjects receiving a series of three doses of bivalent rLP2086 at 0, 2, and 6 months are described above in Examples 4-8, respectively. Evaluation of quadruple and composite response rates were the investigational endpoints in all studies. The quadruple response rates demonstrated that the lower limits of the 95% confidence intervals (CIs) for all four endpoints were similar across the three studies and consistently reached the limits of the Phase III endpoints. The proportion of subjects achieving hSBA titers at or above the LLOQ was similar across all three studies.

[0257] hSBA data obtained after two vaccine doses given one or two months apart indicate that two doses of vaccine administered at such intervals may be protective for individuals at increased risk due to potential exposure to an instance of meningococcal B serogroup disease. Responses observed after two vaccine doses delivered one or two months apart demonstrated that a proportion of subjects exhibited hSBA levels at or above the LLOQ for each of the four major test strains (see Study 1 results for Groups 1 and 2, Study 2 results for Group 1, and Study 3 results for Group 2). Vaccine-mediated protection can be achieved with a third dose of vaccine administered at six months.

[0258] Concurrent Vaccination. Study 1 (described in Examples 7 and 8) evaluated the concurrent use of bivalent rLP2086 and HPV4 in American adolescents. Study endpoints included non-inferiority assessment of immune responses one month after the third vaccine treatment for four HPV4 antigens (based on geometric mean titers [GMTs]) and bivalent rLP2086 (based on hSBA using two MnB test strains [variants A22 and B24]). HPV4 immune responses were also assessed by seroconversion for each of the four HPV antigens.

[0259] For Study 1, a comparison of the geometric mean titers (GMTs) of antibodies against HPV antigens between Group 1 (bivalent rLP2086 + HPV4) and Group 3 (saline + HPV4) is shown, along with the corresponding GMT ratios (GMRs) for Groups 1 and 3 and the two-sided 95% CI for the ratios. For Study 1, a comparison of the hSBA GMTs against the two major MnB test strains between Groups 1 and 2 is also shown, along with the corresponding GMRs for Groups 1 and 2 and the two-sided 95% CI for the ratios. The non-inferiority margin criterion was 1.5-fold, which corresponds to a value of 0.67 for the lower limit of the two-sided 95% CI for the GMR. The 1.5-fold criterion of 0.67 was met for all MnB test strains and HPV antigens except for HPV-18, for which the lower limit of the 95% confidence interval (CI) was 0.62. While the response to HPV-18 did not meet the specified non-inferiority criterion, the difference was only slight. In a separate analysis, more than 99% of subjects in both the saline + HPV4 and bivalent rLP2086 + HPV4 groups seroconverted to all four HPV antigens. [Example]

[0260] Example 10: Bivalent rLP2086 elicits antibodies in individuals with broad coverage against MnB strains expressing epidemic and outbreak-associated fHBP variants. Bactericidal antibodies, measured in the human complement-based serum bactericidal assay (hSBA), have been correlated with protection from meningococcal disease, and hSBA responses are routinely used as a surrogate for vaccine efficacy. Global epidemiological surveys of fHBP diversity have revealed that approximately 80% of meningococcal disease cases are caused by strains expressing one of 10 epidemic fHBP variants.

[0261] Methods: hSBA responses to Neisseria meningitidis serogroup B (MnB) strains expressing the 10 most prevalent fHBP variants in the United States and Europe (B24, B16, B44, A22, B03, B09, A12, A19, A05, and A07) were assessed in individual human subjects immunized with bivalent rLP2086. These MnB strains expressing the 10 most prevalent variants represent the breadth of fHBP diversity, including five of the six major fHBP subgroups, representing over 98% and 97% of strains (by subgroup) in the MnB SBA strain pool and the U.S. subpopulation of the MnB SBA strain pool, respectively. The 23 MnB test strains were obtained from the Pfizer MnB SBA strain pool (N = 1263), which represents strains systematically collected from the United States and Europe between 2000 and 2006. In addition, isolates from recent MnB disease outbreaks were included in the analysis. Matched pre- and post-vaccine sera (post-dose 2 and post-dose 3) were obtained randomly from adolescent and young adult subjects enrolled in clinical trials B1971005, B1971012, or B1971003.

[0262] To obtain additional information supporting the potential coverage afforded by vaccination with bivalent rLP2086, hSBA was performed using the outbreak strain and serum samples from nine subjects immunized with bivalent rLP2086 (clinical trial B1971012, described in Examples 5 and 6). Subjects (aged 11 to <19 years) had received three doses of bivalent rLP2086 at 0, 2, and 6 months. To ensure conservative hSBA evaluation, the nine subjects were unbiasedly selected from a set of subjects without baseline hSBA activity against the major MnB test strains. Two Princeton University clonal outbreak strains (PMB5021 and PMB5025) and two UCSB outbreak strains (one from each of two genetic clusters, PMB4478 and PMB4479) were tested.

[0263] Genetic characterization of the Princeton University clonal MnB outbreak strains is as follows: Data suggest that the Princeton University outbreak strains are clonal. Each strain was typed CC41 / 44 (ST409) and expressed the fHBP variant B153 (SEQ ID NO: 6). The strains had identical allele assignments for NHBA(2), porA (subtype P1.5-1,2-2), and porB(3-82), all lacked nadA, and all had identical pulsed-field gel electrophoresis (PFGE) profiles (429).

[0264] Genetic characterization of the 2013 University of California, Santa Barbara outbreak strains follows. The UCSB strain, classified as CC32 (ET5, ST32), expresses the fHBP variant B24 and is related to the Oregon clone associated with highly endemic serogroup B disease since 1993. Unlike the Princeton outbreak strains, the UCSB strains genetically separated into two distinct clusters distinguished by their PFGE profiles (468 or 467) and porB types (3-461 or 3-24). Strains shared identical allele assignments for NadA (1), NHBA (5), and porA (subtype P1.7, 16-20).

[0265] For all subjects and all outbreak strains, baseline hSBA titers were less than 4, indicating that subjects did not have protective antibodies against any of the outbreak strains before immunization with bivalent rLP2086.

[0266] Results: All 23 MnB strains were susceptible to hSBA using sera from individual subjects immunized with bivalent rLP2086. Strains representing all 10 epidemic fHBP variants, as well as additional strains, were completely eradicated by hSBA. Baseline hSBA seroprotection rates (the percentage of subjects achieving hSBA titers of 1:4 or greater) were generally low. The lower seroprotection rates observed in subjects prior to immunization with bivalent rLP2086 typify the vulnerability of unvaccinated adolescent or young adult populations to MnB disease. However, robust seroprotection rates were observed in adolescents and young adults with postvaccine sera. Seroprotection rates of greater than 70% were observed for 83% of these strains, depending on the MnB strain and population tested. Postvaccine seroprotection rates for strains expressing the most prevalent subfamily A and B fHBP variants, B24 and A22, ranged from 81.0% to 100% and for recent outbreak strains expressing fHBP variants B24 and B153, ranged from 77.8% to 100%. Furthermore, robust postdose 2 responses (compared to baseline) against all outbreak strains were observed in these subjects, ranging from 56% to 89%, depending on the outbreak strain used in the hSBA. In contrast, prevaccine seroprotection rates were low or undetectable for recent US outbreak strains. hSBA responses against the Princeton and UCSB outbreak strains are shown in Figure 2.

[0267] Conclusions: Bivalent rLP2086 elicits vigorous seroprotective hSBA responses in individuals against diverse invasive MnB strains expressing epidemic fHBP in the United States and Europe, as well as the newly emerging variant (B153) (SEQ ID NO: 6). The proportion of subjects who demonstrated seroprotective responses after immunization with bivalent rLP2086 significantly exceeded the proportion of subjects who were seroprotected at baseline. The data support the potential for bivalent rLP2086 to broadly protect adolescents and young adults from invasive meningococcal B serogroup disease, including disease from recent outbreaks. >B153 (SEQ ID NO: 6) CSSGGGGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQTEQVQDSEDSGKMVAKR QFRIGDIAGEHTSFDKLPKGGSATYRGTAFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAAAYIKPDEKHHAVISGSVLYNQDEKGSYSLGIFGGKAEEVAGSAEVKTVNGIRHIGLAAKQ [Explanation of symbols]

[0268] [Sequence List Free Text]

[0269] SEQ ID NO: 1 shows the amino acid sequence of the recombinant N. meningitidis serotype B, 2086 variant A05 polypeptide antigen. SEQ ID NO: 2 shows the amino acid sequence of the recombinant N. meningitidis serotype B, 2086 variant B01 polypeptide antigen. SEQ ID NO:3 shows the amino acid residues at positions 1 to 4 of SEQ ID NO:1 and SEQ ID NO:2. SEQ ID NO: 4 shows the amino acid sequence of the N-terminus of the recombinant Neisseria subfamily A LP2086 polypeptide (rLP2086) (A05) polypeptide antigen. SEQ ID NO: 5 shows the amino acid sequence of the N-terminus of the Neisseria subfamily A LP2086 M98250771 polypeptide (A05) polypeptide antigen. SEQ ID NO: 6 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant B153. SEQ ID NO: 7 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant A04. SEQ ID NO: 8 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant A05. SEQ ID NO: 9 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant A12. SEQ ID NO: 10 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant A22. SEQ ID NO: 11 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant B02. SEQ ID NO: 12 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant B03. SEQ ID NO: 13 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant B09. SEQ ID NO: 14 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant B22. SEQ ID NO: 15 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant B24. SEQ ID NO: 16 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant B44. SEQ ID NO: 17 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant B16. SEQ ID NO: 18 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant A07. SEQ ID NO: 19 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant A19. SEQ ID NO: 20 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant A06. SEQ ID NO: 21 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant A15. SEQ ID NO: 22 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant A29. SEQ ID NO: 23 shows the amino acid sequence of N. meningitidis serotype B, 2086 variant B15.

Claims

1. used to induce an immune response against N. meningitidis serogroup B subfamily A and B strains; a) a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1; b) a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2; and 1. A liquid composition comprising: wherein the composition does not comprise a fusion protein, and the composition further comprises polysorbate 80 and aluminum.

2. The composition of claim 1 , wherein the composition further comprises histidine and sodium chloride.

3. 3. The composition of claim 2, wherein the composition comprises about 120 μg / ml of a first polypeptide; about 120 μg / ml of a second polypeptide; about 2.8 molar ratio of polysorbate 80; about 0.5 mg / ml of aluminum; about 10 mM histidine; and about 150 mM sodium chloride.

4. 3. The composition of claim 2, wherein the composition comprises, per 0.5 ml dose, about 60 μg / ml of the first polypeptide; about 60 μg / ml of the second polypeptide; about 18 μg of polysorbate 80; about 250 μg of aluminum; about 780 μg of histidine; and about 4380 μg of sodium chloride.

5. The composition of claim 1 , wherein the composition does not further comprise a polypeptide having less than 100% sequence identity with SEQ ID NO:

1.

6. The composition of claim 1 , wherein the first polypeptide has a total of 258 amino acids.

7. The composition of claim 1, wherein the first polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 3 at the N-terminus of the polypeptide.

8. The composition of claim 1 , wherein the composition does not further comprise a polypeptide having less than 100% sequence identity with SEQ ID NO:

2.

9. The composition of claim 1 , wherein the second polypeptide has a total of 261 amino acids.

10. The composition of claim 1, wherein the second polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 3 at the N-terminus of the polypeptide.

11. 10. The composition of claim 1, wherein the composition comprises at most two lipidated polypeptides.

12. The composition of claim 1 , wherein the first polypeptide consists of the amino acid sequence set forth in SEQ ID NO:

1.

13. The composition of claim 1, wherein the second polypeptide consists of the amino acid sequence set forth in SEQ ID NO:

2.

14. used to induce an immune response against N. meningitidis serogroup B subfamily A and B strains; a) a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1; b) a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2; and 1. A liquid composition comprising:

15. used to induce an immune response against N. meningitidis serogroup B subfamily A and B strains; a) a first lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:1; b) a second lipidated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2; and wherein the composition does not comprise a chimeric protein, and the composition further comprises polysorbate 80.

16. 10. The composition of claim 1 for use in eliciting an immune response against N. meningitidis serogroup B subfamily A and B strains, wherein the composition is not lyophilized.

Images