Method for determining response to cancer immunotherapy

Abstract

A composition containing nucleic acids encoding CD3-half-BiTE, CXCL9, CTLA-4 scFv, and IL-12 is described for use in cancer treatment. A method for analyzing CXCR3 expression in tumors to identify subjects likely to respond to the composition is also described. Cancer immune reorganization plays a role in tumor elimination, tumor escape from immune destruction, and ultimately shaping the immunogenic phenotype of tumors formed in immunocompetent hosts. Immune system-tumor interactions are hypothesized to occur in three sequential phases: elimination, equilibrium, and evasion.

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of U.S. Provisional Patent Application No. 63 / 041,493, filed June 19, 2020, which is incorporated herein by reference.

[0002] Sequence Listing The sequence listing set forth in file 560207_SeqListing_CXCR3_ST25 is 144 kilobytes in size, was created on June 18, 2021, and is incorporated herein by reference. [Background technology]

[0003] background Cancer immune reorganization plays a role in tumor elimination, tumor escape from immune destruction, and ultimately the immunogenic phenotype of tumors formed in immunocompetent hosts. Immune system-tumor interactions are hypothesized to occur in three sequential phases: elimination, equilibrium, and evasion. Elimination involves the destruction of tumor cells by T lymphocytes. During equilibrium, a population of immune-resistant tumor cells emerges. During evasion, tumors develop strategies to evade immune detection or destruction. Evasion can occur through the loss or ineffective presentation of tumor antigens, the secretion of inhibitory cytokines, or the downregulation of major histocompatibility complex molecules.

[0004] Cancer immunotherapy aims to elicit successful T cell responses that result in cancer regression. Various efforts have been made to activate effector T cell responses, including the presentation of tumor antigens by antigen-presenting cells (APCs), priming T cells to successfully target and infiltrate tumors, and enhancing infiltrating T cells to bind to MHCI-peptide complexes to activate cytotoxic T cell responses.

[0005] Studies have demonstrated a survival benefit associated with the presence of tumor-infiltrating lymphocytes (TILs). There is evidence that immunostimulatory cytokines, such as IL-12, can increase immune cell infiltration in solid tumors. However, systemic administration of IL-12 has a narrow therapeutic index and is often associated with unacceptable levels of adverse events. The limitations of systemic administration of IL-12 can be overcome by treatments that result in localized expression of IL-12, such as intratumoral electroporation of IL-12-encoding plasmids.

[0006] Identifying patients who are likely to respond to cancer immunotherapy would be useful for targeting treatment to patients most likely to benefit from it. Additionally, it would be useful to identify treatments that convert non-responders into responders.

[0007] Although IL-12 can increase the number of TILs, there is still a need to increase the presence and number of tumor-specific T cells within the tumor. The CD3 (cluster of differentiation 3) T cell co-receptor mediates the expression of cytotoxic T cells (CD8 + naive T cells) and T helper cells (CD4 + Anti-CD3 antibodies have been investigated for use as immunosuppressive therapy due to their role in activating T cell responses. Bispecific antibodies, including bispecific T cell engagers (BiTEs) that target CD3 and cancer antigens (tumor markers), have been developed to target T cells to cancer cells. Summary of the Invention [Means for solving the problem]

[0008] overview Disclosed are methods of treating cancer in a subject, the methods comprising: (a) administering to the subject at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine; (b) obtaining a tumor sample from the subject; (c) measuring CXCR3 expression in the tumor sample; (d) determining whether CXCR3 expression is increased in the tumor sample compared to CXCR3 expression in a predetermined control; and (e) if CXCR3 expression is increased in the tumor sample compared to CXCR3 expression in a predetermined control, administering to the subject at least one additional dose of a checkpoint inhibitor and / or an immunostimulatory cytokine; or if CXCR3 expression is not increased in the tumor sample compared to CXCR3 expression in a predetermined control, administering to the subject at least one pharmaceutically effective dose of a CXCL9 and / or CD3 half-BiTE and at least one additional dose of a checkpoint inhibitor and / or an immunostimulatory cytokine. In some embodiments, the CXCL9 and / or CD3 half-BiTE is administered in combination with IL-12. CXCL9 and / or CD3 half-BiTEs can be administered before, simultaneously with, or after administration of IL-12. CXCL9, CD3 half-BiTEs, and / or IL-12 can be administered by intratumoral electroporation (IT-EP) of nucleic acids encoding CXCL9, CD3 half-BiTEs, and / or IL-12. In some embodiments, the checkpoint inhibitor therapy comprises anti-PD-1 / anti-PD-L1 therapy. The checkpoint inhibitor therapy may be administered systemically. In some embodiments, the immunostimulatory cytokine comprises IL-12 or a nucleic acid encoding IL-12. In some embodiments, at least one dose of the checkpoint inhibitor and / or immunostimulatory cytokine comprises a dose that would typically be considered pharmaceutically effective in a responsive subject.

[0009] Disclosed are methods for treating cancer in a subject, the methods comprising: (a) administering to the subject at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine; (b) measuring the level of CXCR3 in a tumor sample obtained from the subject after administering the checkpoint inhibitor and / or the immunostimulatory cytokine; and (c) administering to the subject at least one pharmaceutically effective dose of CXCL9 and / or CD3 half-BiTE if the level of CXCR3 in the tumor sample is not increased compared to the level of CXCR3 in a predetermined control. In some embodiments, CXCL9 and / or CD3 half-BiTE are administered in combination with IL-12. CXCL9 and / or CD3 half-BiTE can be administered before, simultaneously with, or after administration of IL-12. CXCL9, CD3 half-BiTE, and / or IL-12 can be administered by intratumoral electroporation (IT-EP) of nucleic acids encoding CXCL9, CD3 half-BiTE, and / or IL-12. In some embodiments, the checkpoint inhibitor therapy comprises anti-PD-1 / anti-PD-L1 therapy. The checkpoint inhibitor therapy may be administered systemically. In some embodiments, the immunostimulatory cytokine comprises IL-12 or a nucleic acid encoding IL-12. In some embodiments, at least one dose of the checkpoint inhibitor and / or immunostimulatory cytokine comprises a dose that would typically be considered pharmaceutically effective in a responsive subject.

[0010] Methods for determining whether a subject with cancer is at risk of not responding to checkpoint inhibitor and / or immunostimulatory cytokine treatment are described. The methods include measuring the level of CXCR3 in a tumor sample obtained from the subject who has been administered at least one dose of a checkpoint inhibitor and / or immunostimulatory cytokine, and a CXCR3 level in the tumor sample below a predetermined control indicates that the subject is at risk of not responding to checkpoint inhibitor and / or immunostimulatory cytokine treatment. In some embodiments, the subject determined to be at risk of not responding to checkpoint inhibitor and / or immunostimulatory cytokine treatment is administered at least one pharmaceutically effective dose of CXCL9 and / or CD3 half-BiTE. In some embodiments, the CXCL9 and / or CD3 half-BiTE is administered in combination with IL-12. The CXCL9 and / or CD3 half-BiTE can be administered before, simultaneously with, or after administration of IL-12. CXCL9, CD3 half-BiTE and / or IL-12 can be administered by intratumoral electroporation (IT-EP) of a nucleic acid encoding CXCL9, CD3 half-BiTE and / or IL-12. In some embodiments, the checkpoint inhibitor therapy comprises anti-PD-1 / anti-PD-L1 therapy. The checkpoint inhibitor therapy may be administered systemically. In some embodiments, the immunostimulatory cytokine therapy comprises intratumoral electroporation of a nucleic acid encoding IL-12. In some embodiments, at least one dose of the checkpoint inhibitor and / or immunostimulatory cytokine comprises a dose that would typically be considered pharmaceutically effective in a responsive subject.

[0011] Methods for treating a patient with cancer are described, comprising: (a) obtaining a tumor sample from the patient; (b) measuring the CXCR3 expression level in the tumor sample; (c) correlating the CXCR3 expression level in the tumor sample with a reference level obtained from a predetermined control or standard derived from a population of known responders and / or known non-responders to determine whether the patient is at risk of progression on checkpoint inhibitor therapy; and (d) administering at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine if the expression level is greater than the reference level; or administering at least one pharmaceutically effective dose of a CXCL9 and / or CD3 half-BiTE and at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine if the expression level is less than the reference level. In some embodiments, the CXCL9 and / or CD3 half-BiTE is administered in combination with IL-12. The CXCL9 and / or CD3 half-BiTE can be administered before, simultaneously with, or after administration of IL-12. CXCL9, CD3 half-BiTE and / or IL-12 can be administered by intratumoral electroporation (IT-EP) of a nucleic acid encoding CXCL9, CD3 half-BiTE and / or IL-12. In some embodiments, the checkpoint inhibitor comprises an anti-PD-1 / anti-PD-L1 antibody. Checkpoint inhibitor therapy may be administered systemically. In some embodiments, the immunostimulatory cytokine comprises IL-12 or a nucleic acid encoding IL-12. In some embodiments, at least one dose of the checkpoint inhibitor and / or immunostimulatory cytokine comprises a dose that would typically be considered pharmaceutically effective in a responsive subject.

[0012] Disclosed are methods of treating cancer in a subject, comprising: (a) obtaining a tumor sample from the subject; (b) measuring CXCR3 expression in the tumor sample; (c) determining whether CXCR3 expression is increased in the tumor sample compared to CXCR3 expression in a predetermined control; and (d) administering to the subject at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine if CXCR3 expression in the tumor sample is increased compared to CXCR3 expression in a predetermined control; or administering to the subject at least one pharmaceutically effective dose of CXCL9 and / or CD3 half-BiTE and at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine if CXCR3 expression in the tumor sample is not increased compared to CXCR3 expression in a predetermined control. In some embodiments, the CXCL9 and / or CD3 half-BiTE is administered in combination with IL-12. The CXCL9 and / or CD3 half-BiTE can be administered before, simultaneously with, or after administration of IL-12. CXCL9, CD3 half-BiTE, and / or IL-12 can be administered by intratumoral electroporation (IT-EP) of a nucleic acid encoding CXCL9, CD3 half-BiTE, and / or IL-12. In some embodiments, the checkpoint inhibitor comprises anti-PD-1 / anti-PD-L1 therapy. The checkpoint inhibitor therapy may be administered systemically. In some embodiments, the administration of the immunostimulatory cytokine therapy comprises intratumoral electroporation of a nucleic acid encoding IL-12. In some embodiments, the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor and / or immunostimulatory cytokine therapy. In some embodiments, the predetermined control comprises a tumor sample obtained prior to administration of one or more therapies to the subject. The prior therapy can be, but is not limited to, IL-12 therapy, checkpoint inhibitor therapy, or a combination thereof.In some embodiments, at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine comprises a dose that would typically be considered pharmaceutically effective in a responsive subject.

[0013] A method for identifying a subject having cancer at risk of not responding to checkpoint inhibitor and / or immunostimulatory cytokine treatment is described, comprising measuring the level of CXCR3 in a tumor sample obtained from the subject, wherein a level of CXCR3 in the tumor sample lower than a predetermined control indicates that the subject is at risk of not responding to checkpoint inhibitor and / or immunostimulatory cytokine treatment. Measuring the level of CXCR3 expression in the tumor sample can be by measuring CXCR3 mRNA in the tumor sample, measuring CXCR3 protein in the tumor sample, or measuring CXCR3 in the tumor sample. + and measuring the number of T cells. In some embodiments, the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor and / or immune stimulatory cytokine treatment. In some embodiments, the predetermined control comprises a tumor sample obtained prior to administration of one or more treatments to the subject. The prior treatment can be, but is not limited to, IL-12 treatment, checkpoint inhibitor treatment, or a combination thereof.

[0014] Expression cassettes (e.g., nucleic acids) encoding CXCL9, CXCL9+IL-12, anti-CTLA-4 scFv, anti-CTLA-4 scFv+IL-12, CD3 half-BiTE, and CD3 half-BiTE+IL-12 are described. The described expression cassettes are useful for treating cancer. In some embodiments, the expression cassettes are useful for treating cancer in subjects who have failed to respond to at least one course of anti-PD-1 / anti-PD-L1 therapy, subjects predicted to be at risk for not responding to anti-PD-1 / anti-PD-L1 therapy, subjects progressing on anti-PD-1 / anti-PD-L1 therapy, or subjects who have progressed on anti-PD-1 / anti-PD-L1 therapy. Methods of treating tumors, including cancer and metastatic cancer, using the described expression cassettes are also described. When delivered to a tumor, such as by electroporation, the described expression cassettes result in local tumor expression of the encoded proteins, resulting in T cell recruitment and anti-tumor activity. In some embodiments, the methods also result in an abscopal effect, i.e., regression of one or more untreated tumors. In some embodiments, regression includes debulking of solid tumors.

[0015] An expression cassette encoding CXCL9 is described. In some embodiments, the expression cassette encoding CXCL9 further encodes IL-12. The described CXCL9 expression cassette can be delivered intratumorally, peritumorally, intralymph node, intradermally, and / or intramuscularly. In some embodiments, the CXCL9 and IL12 coding sequences are expressed on a multicistronic expression cassette from a single promoter and separated by an IRES or 2A translational modification element. In some embodiments, the 2A element is a P2A element. IL-12 is a heterodimeric cytokine having both the IL-12A (p35) subunit and the IL-12B (p40) subunit. The encoded IL-12 can comprise a fusion construct encoding an IL-12 p35-IL-12 p40 fusion protein (IL12 p70). In some embodiments, the IL-12 p35 and p40 coding sequences are expressed from a multicistronic expression cassette from a single promoter and separated by an IRES or 2A element. In some embodiments, the 2A element is a P2A element. In some embodiments, a multicistronic expression cassette is described that includes CXCL9, IL12 p35, and IL-12 p40 coding regions separated by an IRES or 2A element. In some embodiments, the 2A element is a P2A element.

[0016] An expression cassette encoding an anti-CTLA-4 scFv is described. The anti-CTLA-4 scFv comprises an anti-CTLA-4 single-chain variable fragment. The described anti-CTLA-4 scFv expression cassette can be delivered intratumorally, peritumorally, intralymph node, intradermally, and / or intramuscularly. The lymph node can be a draining lymph node. The anti-CTLA-4 scFv expression cassette can also be delivered to the peritumoral area between the tumor and the draining lymph node. For intratumoral, peritumoral, lymph node, intradermal, and / or intramuscular delivery of the anti-CTLA-4 scFv expression cassette, delivery can be facilitated by electroporation. Direct expression of the anti-CTLA-4 scFv expression cassette can result in fewer side effects and / or toxicity compared to systemic administration of an anti-CTLA-4 antibody. The described anti-CTLA-4 scFv expression cassette facilitates the delivery of a localized yet effective dose of anti-CTLA-4.

[0017] CD3 half-BiTEs and expression cassettes encoding CD3 half-BiTEs are described. The CD3 half-BiTEs comprise an anti-CD3 single-chain variable fragment (scFv) fused to a transmembrane domain (TM). In some embodiments, the expression cassette encoding the CD3 half-BiTE further encodes a signal peptide. The encoded signal peptide can be operably linked to the 5' end of the coding sequence for the anti-CD3 single-chain variable fragment. In some embodiments, the expression cassette encoding the CD3 half-BiTE further encodes IL-12. The described CD3 half-BiTE expression cassettes can be delivered intratumorally, peritumorally, intralymph node, intradermally, and / or intramuscularly. In some embodiments, the CD3 half-BiTE and IL12 coding sequences are expressed on a multicistronic expression cassette from a single promoter and separated by an IRES or 2A translational modification element. In some embodiments, the 2A element is a P2A element. IL-12 is a heterodimeric cytokine containing both the IL-12A (p35) and IL-12B (p40) subunits. The encoded IL-12 can comprise a fusion construct encoding an IL-12 p35-IL-12 p40 fusion protein (IL12 p70). In some embodiments, the IL-12 p35 and p40 coding sequences are expressed from a multicistronic expression cassette from a single promoter and separated by an IRES or 2A translational modification element. In some embodiments, the 2A element is a P2A element. In some embodiments, a multicistronic expression cassette is described that includes CD3 half-BiTE, IL12 p35, and IL-12 p40 coding regions separated by an IRES or 2A translational modification element. In some embodiments, the 2A element is a P2A element.

[0018] Methods for treating cancer are described, including administering to a subject a therapeutically effective amount of a composition comprising one or more of the described expression cassettes by intratumoral electroporation (IT-EP). The composition is injected into the tumor, tumor microenvironment, and / or tumor-surrounding tissue, and electroporation treatment is applied to the tumor, tumor microenvironment, and / or tumor-surrounding tissue. The electroporation treatment can be applied by any suitable electroporation system known in the art. In some embodiments, the electroporation is at a field strength of about 60 V / cm to about 1500 V / cm and for a duration of about 10 microseconds to about 20 milliseconds. In some embodiments, the electroporation incorporates electrochemical impedance spectroscopy (EIS). The subject can be a mammal. The mammal can be, but is not limited to, a human, dog, cat, or horse.

[0019] In some embodiments, the method further comprises administering a therapeutically effective amount of an immunostimulatory cytokine to the subject. The immunostimulatory cytokine may be an expression cassette encoding the immunostimulatory cytokine delivered by IT-EP. The immunostimulatory cytokine may be, but is not limited to, IL-12. The immunostimulatory cytokine may be delivered before, after, or simultaneously with one or more of the described CXCL9, CTLA-4 scFv, and CD3 half-BiTE expression cassettes.

[0020] In some embodiments, the method further comprises administering one or more additional therapies. The one or more additional therapies can be, but are not limited to, immune checkpoint therapies. The immune checkpoint therapy can be, but is not limited to, the administration of one or more immune checkpoint inhibitors. "Immune checkpoint" molecules refer to a group of immune cell surface receptors / ligands that induce T cell dysfunction or apoptosis. These immunoinhibitory targets attenuate excessive immune responses and ensure self-tolerance. Tumor cells exploit the inhibitory effects of these checkpoint molecules. Immune checkpoint target molecules include, but are not limited to, cytotoxic T-lymphocyte antigen-4 (CTLA-4), programmed death 1 (PD-1), programmed death-ligand 1 (PD-L1), lymphocyte activation gene 3 (LAG-3), T-cell immunoglobulin mucin-3 (TIM3), killer cell immunoglobulin-like receptor (MR), B- and T-lymphocyte attenuator (BTLA), adenosine A2a receptor (A2aR), and herpes virus entry mediator (HVEM). "Immune checkpoint inhibitors" include molecules that prevent immunosuppression by blocking the effects of immune checkpoint molecules. Checkpoint inhibitors include, but are not limited to, antibodies and antibody fragments, nanobodies, diabodies, soluble binding partners of checkpoint molecules, small molecule therapeutics, and peptide antagonists. Immune checkpoint inhibitors may be, but are not limited to, PD-1 and / or PD-L1 antagonists. The PD-1 and / or PD-L1 antagonist may be, but is not limited to, an anti-PD-1 or anti-PD-L1 antibody. Anti-PD-1 / anti-PD-L1 antibodies include, but are not limited to, nivolumab, pembrolizumab, pidilizumab, and atezolizumab. Immune checkpoint (checkpoint inhibitor) therapy may be administered systemically.

[0021] Methods of treating a tumor in a subject are described, comprising administering to the subject at least one treatment cycle, the cycle comprising administering to the tumor via IT-EP a therapeutically effective amount of a composition comprising one or more of the described CXCL9, CXCL9+IL-12 (i.e., IL12 to CXCL9), anti-CTLA-4 scFv, anti-CTLA-4 scFv+IL-12, CD3 half-BiTE, or CD3 half-BiTE+IL-12 (i.e., CD3 half-BiTE to IL12) expression cassettes. In some embodiments, the cycle is a 3-week cycle. In some embodiments, the cycle is a 4-, 5-, or 6-week cycle. The composition can be administered via IT-EP on days 1, 2, 3, 4, 5, or 6 of the cycle. In some embodiments, the composition is administered via IT-EP on day 1 of each cycle. In some embodiments, the composition is administered via IT-EP on days 1 and 5±2 of each cycle. In some embodiments, the composition is administered via IT-EP on days 1 and 8±2 of each cycle. In some embodiments, the composition is administered by IT-EP on days 1, 5±2, and 8±2 of each cycle. The cycle can be repeated as frequently as necessary to treat the subject. In some embodiments, the cycle further includes administration of an additional therapeutic agent. The additional therapeutic agent can be, but is not limited to, an immune checkpoint therapy. In some embodiments, the immune checkpoint therapy is administered to the subject on days 1, 2, or 3 of the cycle.

[0022] In some embodiments, subjects are treated with one or more IT-EP therapies using one or more of the described expression cassettes. Any of the above cycles can be repeated in subsequent cycles. Subsequent cycles can be consecutive or alternating cycles. Alternating cycles can have one or more intervening cycles of no treatment or alternative treatment (e.g., immune checkpoint therapy). For example, any of the described expression cassettes can be administered on days 1, 5±2, and 8±2 of alternating cycles (e.g., cycles 1, 3, 5, etc., as needed), and the alternative treatment can be administered, for example, on days 1, 2, or 3 of consecutive cycles (e.g., cycles 1, 2, 3, 4, 5, etc., as needed).

[0023] In some embodiments, subjects are administered alternating cycles of IT-EP of a described CXCL9, CTLA-4 scFv, and / or CD3 half-BiTE expression cassette (with or without immune checkpoint inhibitor therapy) and any of the immune checkpoint inhibitor therapies. In other words, a subject can be administered a therapeutically effective amount of a composition comprising one or more of the described CXCL9, CXCL9 + IL-12, anti-CTLA-4 scFv, anti-CTLA-4 scFv + IL-12, CD3 half-BiTE, or CD3 half-BiTE + IL-12 expression cassettes via IT-EP, and optionally, immune checkpoint inhibitor therapy can be administered on odd-numbered cycles (e.g., cycles 1, 3) and immune checkpoint inhibitor therapy on even-numbered cycles (e.g., cycles 2, 4). Alternatively, a patient can receive immune checkpoint inhibitor therapy on odd-numbered cycles (e.g., cycles 1, 3) and a composition comprising a therapeutically effective amount of one or more of the described CXCL9, CXCL9+IL-12, anti-CTLA-4 scFv, anti-CTLA-4 scFv+IL-12, CD3 half-BiTE, or CD3 half-BiTE+IL-12 expression cassettes via IT-EP, and optionally, immune checkpoint inhibitor therapy on even-numbered cycles (e.g., cycles 2, 4).

[0024] The expression cassettes and methods can be used to treat subjects with progressive, metastatic, and / or treatment-refractory tumors. Treatment-refractory tumors can be, but are not limited to, immune checkpoint inhibitor-refractory tumors, hormone-refractory tumors, radiation-refractory tumors, or chemotherapy-refractory tumors. In some embodiments, the subject has failed to respond to at least one course of immune checkpoint inhibitor therapy. In some embodiments, the subject is progressing or has progressed on one or more anti-cancer therapies (such as, but not limited to, checkpoint inhibitor therapy). In some embodiments, the subject is a subject who has failed to respond to at least one course of anti-PD-1 / anti-PD-L1 therapy, a subject predicted to be at risk of not responding to anti-PD-1 / anti-PD-L1 therapy, a subject who is progressing on anti-PD-1 / anti-PD-L1 therapy, or a subject who has progressed on anti-PD-1 / anti-PD-L1 therapy.

[0025] The expression cassettes and methods can be used to treat subjects with tumors predicted to be refractory or non-responsive to one or more anti-cancer therapies. In some embodiments, the subject has low tumor-infiltrating lymphocytes, low partially cytotoxic lymphocytes, or exhausted T cells. In some embodiments, the described expression cassettes and methods are used to treat subjects in whom CXCR3 levels in a tumor sample obtained from the subject do not increase in response to checkpoint inhibitor and / or immunostimulatory cytokine therapy. In some embodiments, the described expression cassettes and methods are used to treat subjects in whom CXCR3 levels in a tumor sample obtained from the subject do not increase in response to anti-PD-1 / anti-PD-L1 and / or IL-12 therapy. In some embodiments, the described expression cassettes and methods are used to treat subjects in whom CXCR3 levels in a tumor sample obtained from the subject are lower than standards derived from known responder and / or known non-responder populations. In some embodiments, the subject has progressed on one or more previous cancer therapies. [Brief explanation of the drawings]

[0026] [Figure 1A] Diagram of expression constructs for mCXCL9~mCherry (mCXCL9-P2A-mCherry), mCXCL9, mIL12-2A (mIL-12 p35-P2A-mIL-12 p40), and mIL12~mCXCL9 (mIL-12 p35-P2A-mIL-12 p40-P2A-mCXCL9).

[0027] [Figure 1B] Diagram of expression constructs for hCXCL9, hIL12-2A (hIL-12 p35-P2A-hIL-12 p40), and hIL12~hCXCL9 (hIL-12 p35-P2A-hIL-12 p40-P2A-hCXCL9).

[0028] [Figure 2] Graphs showing (A) mIL12p70 protein expression and (B) mCXCL9 protein expression in HEK293 cells after transfection with mIL12-2A, mCXCL9, and mIL12~mCXCL9 expression vectors.

[0029] [Figure 3] Graph showing dose response to mIL-12p70 from HEK293 cells transiently transfected with murine IL-12 or murine IL-12-CXC constructs. Both constructs encode biologically active IL-12.

[0030] [Figure 4A]Graph showing chemotaxis induced by murine CXCL9-derived transfection of SIINFEKL-pulsed (1 μg / mL for 24 hours, with 72-hour recovery) OT-I splenocytes through a polycarbonate membrane (Costar 3421) with 5.0 micron pores. The migration index is defined as the number of chemotactic cells observed after 2.5 hours at 37°C, normalized to the number of cells passively migrated through the membrane in the OptiMEM negative control. Abolition of chemotaxis was observed upon preincubation with an anti-mCXCL9 neutralizing monoclonal antibody (BioXCell BE0309).

[0031] [Figure 4B] Graph showing chemotaxis induced by human CXCL9 derived from transfected (HEK293) OT-I splenocytes pulsed with SIINFEKL (1 μg / mL for 24 hours, with 72-hour recovery) through a polycarbonate membrane (Costar 3421) with 5.0 micron pores. The migration index is defined as the number of chemotactic cells observed after 2 hours at 37°C, normalized to the number of cells that passively migrated through the membrane toward the OptiMEM negative control.

[0032] [Figure 4C] Graph showing chemotaxis of transfected (HEK293) human peripheral mononuclear cells (thawed from cryopreservation and placed in X-VIVO15 medium for 24 hours) induced by human CXCL9 through a 5.0 micron pore polycarbonate membrane (Costar 3421). The migration index is defined as the number of chemotactic cells observed after 2 hours at 37°C, normalized to the number of cells that passively migrated through the membrane toward the OptiMEM negative control.

[0033] [Figure 5] Graph showing intratumoral expression of mCXCL9 using ELISA for mCXCL9 (DuoSet ELISA DY392) 48 hours after electroporation in tumor lysates from mice bearing CT26 tumors (n=3; *P<0.05; T-test with Welch's correction).

[0034] [Figure 6] Graph showing Kaplan-Meir curves for untreated mice and mice treated with control vector, IT-EP IL12-2A alone, or IT-EP IL12-2A in combination with IT-EP CXCL9 (**P<0.005; log-rank (Mantel-Cox) test).

[0035] [Figure 7] Graphs showing (A) reduction in tumor volume and (B) reduction in contralateral (untreated) tumor volume in tumor-bearing mice treated with IT-EP treatment with mIL12-2A+mCXCL9 compared with IL-12 treatment alone with control plasmid.

[0036] [Figure 8] Flow cytometry analysis of splenocytes from mice treated with IT-EP pUMCV3 or IL12-2A on day 0 and IT-EP pUMVC3 or mCXCL9 on days 4 and 7

[0037] [Figure 9] Graph showing the fold increase in the number of AH1+CD8+ T cells in tumors of mice treated with control vector (pUMVC3), IT-EP IL12 (IL-12 p35-P2A-IL-12 p40), or IT-EP IL12 + IT-EP CXCL9. N = 2 independent experiments with 3-5 animals per group; *P < 0.05, **P < 0.005; one-way ANOVA.

[0038] [Figure 10] Graphs showing (A) hIL-12 protein expression in HEK293 cells transfected with hIL12-2A and hIL12~hCXCL9 expression vectors, and (B) hCXCL9 protein expression in HEK293 cells transfected with hCXCL9 and hIL12~hCXCL9 expression vectors.

[0039] [Figure 11] Graph showing activation of the STAT4 pathway in HEK-Blue IL-12 cells with recombinant human IL-12 (rhIL12, positive control) or hIL12 produced from cells expressing the hIL12-2A expression vector.

[0040] [Figure 12A] Diagram of the mouse CD3 half-BiTE expression cassettes for HA-2C11-Myc scFv, HA-2C11 scFv, 2C11 scFv, and 2C11 scFv~hIL12.

[0041] [Figure 12B] Diagram of human CD3 half-BiTE expression cassettes for HA-OKT3-Myc scFv, HA-OKT3 scFv, OKT3 scFv, HA-OKT3 scFv~hIL12, and OKT3 scFv~hIL12.

[0042] [Figure 13] Western blots showing: (A) expression of anti-CD3 scFv in HEK293 cells transfected with HA-OKT3 scFv and HA-2C11 scFv CD3 half-BiTE expression vectors, and (B) expression of CD3 half-BiTE in B16-F10 cells transfected with HA-2C11 scFv and HA-2C11 scFv~mIL12 expression vectors.

[0043] [Figure 14-1] Flow cytometry showing surface expression of anti-CD3 scFv in HEK293 cells transfected with HA-OKT3 scFv and HA-OKT3 scFv~hIL12 expression vector.

[0044] [Figure 14-2](D) Flow cytometry showing surface expression of anti-CD3 scFv in B16-F10 cells transfected with HA-2C11 scFv and HA-2C11 scFv~mIL12 expression vector. (E) Graph showing IL12p70 expression in B16-F10 cells after transfection with mIL12-2A and HA-2C11 scFv~mIL12 expression vector.

[0045] [Figure 15] Graph showing IL12p70 expression in HEK293 cells after transfection with hIL12-2A, HA-OKT3 scFv~hIL12, and OKT3 scFv~hIL12 expression vectors.

[0046] [Figure 16-1] (A) Western blot showing the expression of CD3 scFv on B16F10 melanoma cells or 4T1 breast cancer cells in vivo after intratumoral electroporation of HA-2C11 scFv. (B) Flow analysis of the surface expression of CD3 scFv on 4T1 breast cancer cells in vivo after intratumoral electroporation of HA-2C11 scFv.

[0047] [Figure 16-2] Graph showing IL12p70 expression in B16-F10 cells after intratumoral electroporation of mIL12-2A and HA-2C11 scFv~mIL12 expression vectors.

[0048] [Figure 17] Graph showing induction of IFNγ expression after coculture of naive mouse splenocytes with B16F10 cells transfected in vitro with a control vector (EV control), 2C11 scFv expression vector (with or without recombinant mouse IL12), or plate-bound anti-CD3 (positive control).

[0049] [Figure 18]Graph showing FACS analysis of proliferation of CFSE-labeled CD3+CD45+ T cells after coculture of naive mouse splenocytes with B16F10 cells transfected in vitro with control vector (Tfx control), 2C11 scFv expression vector (with or without recombinant mouse IL12), or plate-bound anti-CD3 (positive control).

[0050] [Figure 19] Graph showing in vivo OT-1 and polyclonal T cell proliferation in DLN in B16-OVA tumor model mice treated with 2C11 scFv IT-EP or negative control.

[0051] [Figure 20] Graph showing an increase in CD8+ T cells among live CD45.1+ cells in TILs in B16-OVA tumor model mice treated with 2C11 scFv IT-EP or negative control.

[0052] [Figure 21] Graph showing an increase in antigen-specific (SIINFEKL+) CD8+ T cells among TILs in B16-OVA tumor model mice treated with 2C11 scFv IT-EP or negative control.

[0053] [Figure 22] FACS analysis of scanned CFSE cells presenting (Hi) or not (Lo) the OVA257-264 peptide, showing increased lysis of CFSE cells presenting the OVA257-264 peptide in B16-OVA tumor-bearing mice treated with 2C11 scFv IT-EP compared to negative transfected controls.

[0054] [Figure 23] Figure 10: Increased lysis of adoptively transferred OVA257-264-presenting CFSE cells in B16-OVA tumor-bearing mice treated with IT-EP CD3 half-BiTE. Increased T cell killing capacity observed in both the spleen and draining lymph nodes.

[0055] [Figure 24] FACS analysis of CFSE cells showing increased tumor-specific killing of OVA-expressing cells in mice treated with IT-EP CD3 half-BiTE.

[0056] [Figure 25] Graph showing tumor progression of treated tumors in melanoma model mice treated with control, IL-12, or IL-12+CD3 half-BiTE IT-EP therapy.

[0057] [Figure 26-1] (A) Graph showing tumor progression in breast cancer model mice treated with control, IL-12, or IL-12+2C11 IT-EP treatment.

[0058] [Figure 26-2] (B) Graph showing lung metastasis nodules in 4T1 breast cancer model mice treated with control, IL12-2A, or IL12-2A + 2C11 IT-EP therapy. (C) Graph showing absolute numbers of effector T cells (CD127-CD62L-CD3+) per μL of peripheral blood in 4T1 breast cancer model mice treated with control, IL12-2A, or IL12-2A + 2C11 IT-EP therapy.

[0059] [Figure 27] Graphs showing (A) hIL12p70 protein secretion and (B) hCXCL9 protein secretion in HEK293 cells after transfection with hIL12-2A, hCXCL9, and hIL12-hCXCL9 expression vectors. Proteins detected by ELISA, n=5.

[0060] [Figure 28A]Volcano plot showing p-values ​​and log2 fold changes for the indicated genes. Differential gene expression was examined in mice treated with mCXCL9 alone (top panel) and in combination with IL12 (bottom panel). The horizontal line indicates the false discovery rate (FDR) threshold.

[0061] [Figure 28B] Graph showing cell type scores for "cytotoxic immune cells." The scores (Log2 scale) for each cell type are centered to have a mean of 0.

[0062] [Figure 29-1] Graph showing IL12 p70 expression 48 hours after electroporation in tumor lysates from mice bearing B16.F10 tumors after treatment with 10 μg or 100 μg of IL12-2A (TAVO) on days 1, 5, and 8, or after treatment with 100 μg of IL12~CXCL9 or CD3 half-BiTE~IL12 (SPARK) on days 1, 5, and 8, respectively (n=8 animals; DuoSet ELISA DY419).

[0063] [Figure 29-2] Graphs showing primary (B) and secondary (C) tumor growth in mice bearing B16.F10 tumors after treatment with 10 μg or 100 μg of IL12-2A (TAVO) on days 1, 5, and 8, or with 100 μg of IL12~CXCL9 or CD3 half-BiTE~IL12 (SPARK) on days 1, 5, and 8, respectively. (From left to right, for days 0 and 12, respectively: 10 μg IL12-2A, SPARK, 100 μg IL12-2A).

[0064] [Figure 30] Graphs showing: (A) anti-CTLA-4 scFv transfection supernatant binding to recombinant mCTLA-4 / Fc, and (B) detection of anti-CTLA-4 scFv on RENCA tumor lysates.

[0065] [Figure 31] Graphical representation of treatment schedule. TAVO = nucleic acid-expressing IL-12 administered by IT-EP. P = pembrolizumab.

[0066] [Figure 32] Graph showing Ki-67+CD8+ T cells in PBMCs in responders and non-responders before and after treatment with IL-12 and pembrolizumab.

[0067] [Figure 33] Graph showing intratumoral CXCR3 transcript levels in responders and non-responders before and after treatment with IL-12 and pembrolizumab.

[0068] [Figure 34] Graph showing CD8+CXCR3+ T cells in PBMCs 24 hours after IT-EP with either 50 μg of IL-12 (TAVO+(TAVO(P2A)) or 50 μg of control (empty) vector (EV).

[0069] [Figure 35] Graph showing the number of migratory cells isolated from draining lymph nodes of mice treated with IT-EP IL-12 (TAVO+) empty vector (EV) in the presence or absence of anti-CXCR3 antibody.

[0070] [Figure 36] Graph showing primary and contralateral tumor regression in mice treated with IT-EP IL-12 (TAVO+) in the presence or absence of anti-CXCR3 antibody.

[0071] [Figure 37] Graph showing survival in tumor model mice treated with IT-EP IL-12 (TAVO+) in the presence or absence of anti-CXCR3 antibody.

[0072] [Figure 38]Graph showing IFN-γ in CD8+ T cells from mice treated with IT-EP with either 2 μg or 50 μg of empty vector (EV) or IL-12 (TAVO+).

[0073] [Figure 39] Graph showing transcriptome analysis in tumor model mice treated with IT-EP empty vector (EV), IL-12 (TAVO+), or IL-12+CXCL9.

[0074] [Figure 40] FACS analysis of CD8 T cells in tumor model mice treated with IT-EP empty vector (EV), IL-12 (TAVO+), or IL-12+CXCL9.

[0075] [Figure 41] Graph showing enhanced primary and contralateral tumor regression in tumor model mice treated sequentially with IT-EP IL-12 (TAVO+) and IT-EP CXCL9 (left bar of each pair = TAVO++EV+EV; right bar of each pair = TAVO++pCXCL9+pCXCL9).

[0076] [Figure 42] Graph showing survival in tumor model mice treated sequentially with IT-EP IL-12 (TAVO+) and IT-EP CXCL9.

[0077] [Figure 43] Graph showing CXCR3+ expression on CD8+ T cells derived from tumors in mice treated with IT-EP empty vector (EV), IL-12 (TAVO+), or IL-12~CXCL9.

[0078] [Figure 44] Graph showing enhanced primary and contralateral tumor suppression in tumor model mice treated with IT-EP IL-12 (TAVO+) or IL-12~CXCL9 (left bar, each pair = TAVO+; right bar, each pair = TAVO++CXC).

[0079] [Figure 45] Graph showing survival of tumor model mice treated with IT-EP empty vector (EV), IL-12 (TAVO+), or IL-12~CXCL9.

[0080] [Figure 46] Graph showing survival of tumor model mice treated with IT-EP empty vector (EV) with or without anti-PD-1 therapy, IT-EP IL-12 (TAVO+) with or without anti-PD-1 therapy, sequential IT-EP IL-12 + IT-EP CXCL9, or sequential IT-EP IL-12 + IT-EP CXCL9 with or without anti-PD-1 therapy. In each group, increased survival was observed in mice treated with anti-PD-1 therapy.

[0081] [Figure 47] Graph showing the percentage of proliferating CD3+ T cells after 4 days of coculture with B16-F10 cells transfected with EV or anti-CD3 scFv plasmid, with or without 100 ng / mL mIL-12. Cocultures were initiated using similar numbers of CD3+ T cells and B16-F10 cells. CD3+ T cells were cultured with plate-bound anti-CD3 as a positive control (n=3).

[0082] [Figure 48] Graphs showing flow cytometry analysis of intracellular (A) IFNγ and (B) granzyme B expression in CD8+ and CD4+ T cells after 3 days of coculture with B16-F10 cells transfected under various conditions as described in the graphs above (n=3).

[0083] [Figure 49-1]Graph showing (A) tumor volume and (B) spontaneous metastatic lung modules in 4T1 tumors treated with IT-EP with 50 μg of empty vector (EV) or IL-12 (TAVO(P2A)) on day 0, followed by IT-EP with 50 μg of EV or CD3 half-BiTE on days 3 and 5. T cell populations were measured 6 days after IT-EP treatment. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001.

[0084] [Figure 49-2] Graph showing (C) CD3+CD8+ T cells, (D) CD8+CXCR3+ T cells, and (E) CD45+CD3+ T cells in 4T1 tumors treated with IT-EP with 50 μg of empty vector (EV) or IL-12 (TAVO(P2A)) on day 0, followed by IT-EP with 50 μg of EV or CD3 half-BiTE on days 3 and 5. T cell populations were measured 6 days after IT-EP treatment. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001.

[0085] [Figure 49-3] Graph showing (F) effector T cells and (G) effector memory T cells in 4T1 tumors treated with IT-EP with 50 μg of empty vector (EV) or IL-12 (TAVO(P2A)) on day 0, followed by IT-EP with 50 μg of EV or CD3 half-BiTE on days 3 and 5. T cell populations were measured 6 days after IT-EP treatment. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001.

[0086] [Figure 50-1](A) Graph showing the percentage of TILs (from melanoma patients actively progressing on anti-PD-1 therapy) expanded after 3 days of coculture with HEK293T cells transfected with empty vector or CD3 half-BiTE (αCD3) with or without IL-12 (tumor-infiltrating T cells were cultured with plate-bound anti-CD3 antibody as a positive control) (n=3); (B) Percentage of PD-1 expression on CD8+ TILs after 3 days of coculture with HEK293T cells transfected as in (A); #=below detection, *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001, statistical significance determined by one-way ANOVA.

[0087] [Figure 50-2] Graph showing ELISA measuring IFNγ in conditioned medium from cocultures of TILs and HEK293T cells transfected as in (A). #=below detection, *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001. Statistical significance determined by one-way ANOVA. (Each set of five bars, in order: EVs without pIL-12, EVs with pIL-12, anti-CD3 half-BiTEs without pIL-1-2, anti-CD3 half-BiTEs with pIL-12, plate-bound anti-CD3 antibody) DETAILED DESCRIPTION OF THE INVENTION

[0088] Detailed Description I. Definition " Nucleic acid " includes both RNA and DNA. RNA and DNA include but are not limited to cDNA, genomic DNA, plasmid DNA, condensed nucleic acid, nucleic acid formulated with delivery vector, nucleic acid formulated with cationic lipid, nucleic acid formulated with peptide or cationic polymer, RNA and mRNA. Nucleic acid also includes modified RNA or DNA.

[0089] An "expression cassette" refers to a nucleic acid (RNA or DNA) coding sequence or a segment of RNA or DNA that encodes an expression product (e.g., a peptide (i.e., polypeptide or protein) or RNA). An expression cassette may be present in a plasmid. An expression cassette is capable of expressing one or more polypeptides in a cell, such as a mammalian cell. An expression cassette may contain one or more sequences necessary for expression of the encoded expression product. An expression cassette may include one or more of an enhancer, promoter, terminator, and polyA signal operably linked to the DNA coding sequence.

[0090] The term "plasmid" refers to a nucleic acid containing at least one sequence encoding a polypeptide (such as one of the described expression cassettes) capable of being expressed in a mammalian cell. A plasmid can be a closed circular DNA molecule. Various sequences can be incorporated into a plasmid to alter expression of the coding sequence and facilitate replication of the plasmid within the cell. Sequences that affect the efficiency of transcription, messenger RNA (mRNA) stability, RNA processing, or translation can be used. Such sequences include, but are not limited to, 5' untranslated regions (5' UTRs), promoters, introns, and 3' untranslated regions (3' UTRs). Plasmids can be manufactured in large quantities and / or at high yields. Plasmids can be further manufactured using cGMP manufacturing. Plasmids can be transformed into bacteria, such as E. coli. DNA plasmids can be formulated to be safe and effective for injection into mammalian subjects.

[0091] A "protein," "peptide," or "polypeptide" comprises a contiguous string of two or more amino acids. A "protein sequence," "peptide sequence," "polypeptide sequence," or "amino acid sequence" refers to a series of two or more amino acids in a protein, peptide, or polypeptide.

[0092] The terms "express" and "expression" mean to allow or cause the manifestation of information in a gene, RNA, or DNA sequence; for example, to produce a protein by activating the cellular functions involved in the transcription and translation of the corresponding gene. A DNA sequence is expressed in or by a cell to form an expression product, such as an RNA (e.g., mRNA) or a protein. The expression product itself may also be said to be expressed by the cell.

[0093] "Operably linked" refers to the juxtaposition of two or more components (e.g., a promoter and another sequence element) in a manner that allows both components to function normally and mediate the function of at least one component exerted on at least one other component. For example, a promoter operably linked to a coding sequence directs RNA polymerase-mediated transcription of the coding sequence into RNA, including mRNA, which can then be spliced ​​(if it contains introns) and, if necessary, translated into a protein encoded by the coding sequence. A coding sequence can be operably linked to one or more transcriptional or translational control sequences. A terminator / polyA signal operably linked to a gene terminates transcription of the gene into RNA and directs the addition of a polyA signal to the RNA.

[0094] A "promoter" is a DNA regulatory region that can bind RNA polymerase in a cell (e.g., directly or through a protein or substance bound to another promoter) and initiate transcription of a coding sequence. A promoter may contain one or more additional regions or elements (including, but not limited to, enhancers) that affect the rate of transcription initiation. A promoter can be, but is not limited to, a constitutively active promoter, a conditional promoter, an inducible promoter, or a cell-type specific promoter. Examples of promoters can be found, for example, in WO 2013 / 176772. A promoter can be, but is not limited to, a CMV promoter, an Igκ promoter, an mPGK promoter, an SV40 promoter, a β-actin promoter, an α-actin promoter, an SRα promoter, a herpes thymidine kinase promoter, a herpes simplex virus (HSV) promoter, a mouse mammary tumor virus long terminal repeat (LTR) promoter, an adenovirus major late promoter (Ad MLP), a Rous sarcoma virus (RSV) promoter, and an EF1α promoter. The CMV promoter can be, but is not limited to, a CMV immediate early promoter, a human CMV promoter, a mouse CMV promoter, and a monkey CMV promoter.

[0095] "Translational modifier elements" allow for the translation of two or more genes from a single transcript. Translational modifier elements include internal ribosome entry sites (IRES), which allow translation initiation from internal regions of the mRNA, and picornavirus-derived 2A peptides, which cause the ribosome to skip synthesis of a peptide bond at the C-terminus of the element. Incorporation of translational regulatory elements results in the co-expression of two or more polypeptides from a single polycistronic (multicistronic) mRNA. 2A modulators include, but are not limited to, P2A, T2A, E2A, or F2A. 2A modulators contain a PG / P cleavage site.

[0096] A "homologous" sequence (e.g., a nucleic acid sequence or amino acid sequence) refers to a sequence that is identical or substantially similar to a known reference sequence, e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the known reference sequence. "Orthologous" genes (orthologs) include genes from different species that have evolved from a common ancestral gene through speciation. Orthologs typically retain the same function throughout evolution. Sequence identity can be determined by aligning sequences using algorithms such as BESTFIT, FASTA, and TFASTA in Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Dr., Madison, Wis.) using default gap parameters, or by inspection and best alignment (i.e., resulting in the highest percentage of sequence similarity over the comparison window). The percentage of sequence identity is calculated by comparing two optimally aligned sequences over a comparison window, determining the number of positions where identical residues occur in both sequences to obtain the number of matched positions, dividing the number of matched positions by the total number of matched and mismatched positions not counting gaps in the comparison window (i.e., the window size), and multiplying the result by 100 to obtain the percentage of sequence identity. Unless otherwise specified, the comparison window between two sequences is defined by the total length of the shorter of the two sequences.

[0097] "Immunostimulatory cytokines" include cytokines that mediate or enhance immune responses to foreign antigens, including viral, bacterial, or tumor antigens. Immunostimulatory cytokines can include, but are not limited to, TNFα, IL-1, IL-10, IL-12, IL-12 p35, IL-12 p40, IL-15, IL-15Rα, IL-23, IL-27, IFNα, IFNβ, IFNγ, IL-2, IL-4, IL-5, IL-7, IL-9, IL-21, and TGFβ.

[0098] "Cancer immunotherapy" is a therapy used to treat cancer that involves or uses components of the immune system. Cancer immunotherapy can induce, modify, or enhance a subject's immune system to fight cancer. Cancer immunotherapy includes, but is not limited to, antibodies that bind to, inhibit, or modify the function of proteins expressed by cancer cells or immune cells (targeting antibodies), cytokines, interferons, interleukins, and chemokines.

[0099] The term "cancer" generally encompasses a myriad of diseases characterized by inappropriate, or abnormal or excessive, cell proliferation. Examples of cancer include, but are not limited to, breast cancer, triple-negative breast cancer, colon cancer, prostate cancer, pancreatic cancer, melanoma, lung cancer, ovarian cancer, kidney cancer, brain cancer, or sarcoma.

[0100] A "treatment-refractory cancer" (or refractory cancer) is a cancer that does not respond or has not responded to at least one previous medical treatment. In some embodiments, a treatment-refractory cancer, with respect to treatment, exhibits an inadequate response to the treatment or a lack of a partial or complete response to the treatment. For example, a patient may be considered refractory to a treatment (e.g., checkpoint inhibitor therapy, such as PD-1 or PD-L1 inhibitor therapy) if they do not exhibit at least a partial response after receiving at least two doses of the treatment. A refractory cancer may be resistant to the treatment before or at the start of treatment. A refractory cancer may become refractory during the course of treatment.

[0101] A "responder" is a subject who has achieved or is achieving a complete response to anti-cancer treatment. A "non-responder" is a subject who has not achieved or is not achieving an adequate response to anti-cancer treatment. A non-responder may have a partial response, stable disease, progressive disease, an increase in the number of cancer cells, or continued or increased tumor metastasis. Evaluation of a subject to assess disease response, symptoms, and / or severity can be performed by various methods known in the art.

[0102] "Tumor microenvironment" refers to the environment surrounding a tumor, including non-malignant vascular and stromal tissue that aids in tumor growth and / or survival, for example, by providing the tumor with oxygen, growth factors, and nutrients, or by inhibiting immune responses to the tumor. The tumor microenvironment includes the cellular environment in which the tumor resides, including surrounding blood vessels, immune cells, fibroblasts, bone marrow-derived inflammatory cells, lymphocytes, signaling molecules, and the extracellular matrix.

[0103] The "tumor margin" or "margin tissue" is the visually normal tissue immediately adjacent to or surrounding a tumor. Typically, margin tissue is the visually normal tissue within 0.1 to 2 cm of the tumor. Margin tissue is often removed during surgical removal of the tumor.

[0104] The term "treatment" includes, but is not limited to, medicines or therapies for inhibiting or reducing the proliferation of cancer cells, destroying cancer cells, preventing the proliferation of cancer cells, preventing the initiation of malignant cells, halting or reversing the progression of transformed pre-malignant cells to malignant disease, or ameliorating disease.

[0105] The term "electroporation" refers to the use of electroporation pulses to facilitate the entry of biomolecules, such as plasmids, nucleic acids, or drugs, into cells.

[0106] A "draining lymph node" is a lymph node that filters lymph from a particular area or organ. In the context of tumors and tumor treatment, the draining lymph node is immediately downstream of the tumor.

[0107] "Epitope tag" is a short amino acid sequence (or a nucleic acid sequence encoding a short amino acid sequence) that high-affinity antibody binds to.Exemplary epitope tags include, but are not limited to, V5 tag, Myc tag, HA tag, Spot tag, T7 tag and NE tag.Epitope tags can be used to facilitate immunodetection.

[0108] A tumor sample refers to a part, piece, portion, segment, or fraction of a tumor or tumor-infiltrating lymphocytes from a subject. Tumor samples can be obtained from or removed from a subject using methods known in the art. Exemplary methods include, but are not limited to, surgical resection, biopsy, needle biopsy, or other means for obtaining a sample containing a part, piece, portion, segment, or fraction of a tumor or tumor-infiltrating lymphocytes. Tumor samples can be derived from any solid tumor, including primary tumors, invasive tumors, and metastatic tumors. Tumor samples may undergo additional purification and processing, for example, to remove cellular debris and other undesirable molecules. Additional processing may further include amplification, for example, using PCR (RT-PCR). To measure CXCR3 levels or expression in tumor samples, tumor samples can be purified or processed using methods known in the art that are appropriate for the particular quantitative test or assay used for analysis. II. CXCR3

[0109] The chemokine receptor CXCR3 is a Gα receptor of the CXC chemokine receptor family. iCXCR3 is a protein-coupled receptor. Other names for CXCR3 are G protein-coupled receptor 9 (GPR9) and CD183. CXCR3 binds to the CXC chemokines CXCL9, CXCL10, and CXCL11. CXCR3 is primarily expressed on activated T lymphocytes and NK cells. CXCR3 is preferentially expressed on Th1 cells. CXCR3 can regulate leukocyte trafficking. CXCR3-ligand interaction attracts and promotes the maturation of Th1 cells. CXCR3 expression on leukocytes has been reported to mediate their migration to tumors or the tumor environment.

[0110] Methods for predicting response to checkpoint inhibitor therapy and / or immunostimulatory cytokine therapy are described, comprising measuring CXCR3 levels or expression in a tumor sample obtained from a subject. In some embodiments, CXCR3 levels or expression in the tumor or tumor microenvironment are measured after administering at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine to the subject. CXCR3 levels or expression can be measured by measuring CXCR3 mRNA in the tumor sample, measuring CXCR3 protein in the tumor sample, or measuring CXCR3 in the tumor sample. + This can be determined by measuring T cells. In some embodiments, at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine comprises a dose that would typically be considered pharmaceutically effective in a responsive subject.

[0111] CXCR3 level or expression in a tumor sample can be measured using a test or assay known in the art for measuring the amount or level of gene or protein expression. In some embodiments, the test or assay is an FDA-approved test or assay. In some embodiments, the level of CXCR3 expression in a tumor sample is determined by measuring the level of CXCR3 mRNA in the tumor sample. Exemplary methods for measuring CXCR3 mRNA levels in a sample include, but are not limited to, nucleic acid amplification assays, polymerase chain reaction (PCR) assays, real-time PCR, TaqMan-based assays, hybridization assays, and microarray assays. In some embodiments, the level of CXCR3 expression in a tumor sample is determined by measuring the level of CXCR3 protein in the tumor sample. Exemplary methods for measuring the level of CXCR3 protein in a sample include, but are not limited to, immune-based detection assays (immunoassays), such as enzyme-linked immunosorbent assays (ELISAs) and AlphaLISAs. In some embodiments, the level of CXCR3 expression in a tumor sample is determined by measuring the level of CXCR3 in the tumor sample. + Determined by measuring the number of CXCR3 T cells in the sample. + Exemplary methods for measuring the number of T cells include, but are not limited to, cell sorting assays.

[0112] In some embodiments, the tumor sample is obtained from the subject prior to anti-cancer treatment. In some embodiments, the tumor sample is obtained from the subject after at least one round of anti-cancer treatment. In some embodiments, the tumor sample is obtained from the subject after at least one round of checkpoint inhibitor treatment. In some embodiments, the tumor sample is obtained from the subject after at least one round of immunostimulatory cytokine treatment. In some embodiments, the tumor sample is obtained from the subject after at least one round of checkpoint inhibitor + immunostimulatory cytokine treatment. In some embodiments, the tumor sample is obtained from the subject 1 to 30 days after at least one round of checkpoint inhibitor treatment and / or immunostimulatory cytokine treatment. In some embodiments, the tumor sample is obtained from the subject 1 to 21 days after at least one round of checkpoint inhibitor treatment and / or immunostimulatory cytokine treatment. In some embodiments, the tumor sample is obtained from the subject 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21 days after at least one round of checkpoint inhibitor therapy and / or immune stimulatory cytokine therapy. The checkpoint inhibitor therapy may be, but is not limited to, anti-PD-1 / anti-PD-L1 therapy. The anti-PD-1 / anti-PD-L1 therapy may be administered systemically. The immune stimulatory cytokine may be, but is not limited to, IL-12 and / or IL-15 therapy. The IL-12 and / or IL-15 therapy may be administered by intratumoral electroporation of nucleic acids encoding IL-12 and / or IL-15.

[0113] The CXCR3 expression measured in a tumor sample obtained from a subject is compared with the CXCR3 expression measured in a predetermined control. The level of CXCR3 expression determined in a tumor sample obtained from a subject is measured using the same or substantially the same method as that used to measure the level of CXCR3 expression in a predetermined control.

[0114] In some embodiments, the tumor sample is obtained from the subject after administering at least one round of checkpoint inhibitor therapy or immunostimulatory cytokine therapy (treatment), and the predetermined control comprises a tumor sample obtained from the subject before administering the checkpoint inhibitor therapy or immunostimulatory cytokine therapy (treatment). The level of CXCR3 expression measured in the tumor sample from the subject obtained after administering the treatment is compared to the level of CXCR3 expression measured in the predetermined control. In some embodiments, a higher level of CXCR3 expression measured in the tumor sample obtained after treatment compared to the level of CXCR3 expression measured in the predetermined control indicates that the subject is likely to respond to the checkpoint inhibitor therapy and / or immunostimulatory cytokine therapy, and a level of CXCR3 expression measured in the tumor sample obtained after treatment that is the same as or lower than the level of CXCR3 expression measured in the predetermined control indicates that the subject is at risk of not responding to the checkpoint inhibitor therapy and / or immunostimulatory cytokine therapy. In some embodiments, a level of CXCR3 expression measured in a tumor sample obtained after treatment that is more than twice the level of CXCR3 expression measured in a predetermined control indicates that the subject is likely to respond to checkpoint inhibitor therapy and / or immunostimulatory cytokine therapy, and a level of CXCR3 expression measured in a tumor sample obtained after treatment that is less than twice the level of CXCR3 expression measured in a predetermined control indicates that the subject is at risk of not responding to checkpoint inhibitor therapy and / or immunostimulatory cytokine therapy. In some embodiments, a level of CXCR3 expression measured in a tumor sample obtained after treatment that is more than 1.9×, 1.8×, 1.7×, 1.6×, 1.5, 1.4×, 1.3×, 1.2×, or 1.1× the level of CXCR3 expression measured in a predetermined control indicates that the subject is likely to respond to checkpoint inhibitor therapy and / or immunostimulatory cytokine therapy.In some embodiments, a level of CXCR3 expression measured in a tumor sample obtained after treatment that is less than 1.9×, 1.8×, 1.7×, 1.6×, 1.5, 1.4×, 1.3×, 1.2×, or 1.1× the level of CXCR3 expression measured in a predetermined control indicates that the subject is at risk of not responding to checkpoint inhibitor therapy and / or immunostimulatory cytokine therapy.

[0115] In some embodiments, the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor treatment. In some embodiments, the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to immunostimulatory cytokine treatment. In some embodiments, the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor + immunostimulatory cytokine combination treatment. The level of CXCR3 expression determined for the population of known responders and / or known non-responders is measured using the same or substantially the same method as used to measure the level of CXCR3 expression in a tumor sample obtained from the subject. A level of CXCR3 expression in a tumor sample obtained from the subject that is the same as or higher than the level of CXCR3 expression determined for the population of known responders indicates that the subject is likely to respond to checkpoint inhibitor and / or immunostimulatory cytokine treatment. A level of CXCR3 expression in a tumor sample obtained from a subject that is lower than the level of CXCR3 expression determined for a population of known responders, or the same as or lower than the level of CXCR3 expression determined for a population of known non-responders, indicates that the subject is likely at risk of not responding to checkpoint inhibitor and / or immunostimulatory cytokine therapy. In some embodiments, the tumor sample is obtained from the subject before administration of checkpoint inhibitor and / or immunostimulatory cytokine therapy. In some embodiments, the tumor sample is obtained from the subject after administration of at least one round of checkpoint inhibitor and / or immunostimulatory cytokine therapy. In some embodiments, the tumor sample is obtained from the subject simultaneously with administration of at least one round of checkpoint inhibitor and / or immunostimulatory cytokine therapy. The level of CXCR3 expression in a population of known responders and / or known non-responders can be calculated or expressed as the average or mean of the levels of CXCR3 expression measured in known responders and / or known non-responders. III.CXCL9

[0116] C-X-C motif chemokine ligand 9 (CXCL9) is a small cytokine belonging to the C-X-C chemokine family. CXCL9 is also known as monokine induced by gamma interferon (MIG). CXCL9 is a T cell chemoattractant and promotes the chemotactic recruitment of tumor-infiltrating lymphocytes (TILs). The amino acid sequences of mouse and human CXCL9 are represented by SEQ ID NO: 35 and SEQ ID NO: 58, respectively. In some embodiments, CXCL9 comprises (a) the amino acid sequence of SEQ ID NO: 35 or 58, or a functional equivalent thereof; or (b) an amino acid sequence that is at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 35 or 58. IV. Anti-CTLA-4 scFv

[0117] Anti-CTLA-4 scFvs comprise anti-CTLA-4 single-chain variable fragments (scFvs) that have affinity for the extracellular domain of CTLA-4 and / or inhibit CTLA-4 signal transduction. scFvs comprise fusion proteins of the variable regions of immunoglobulin heavy (VH) and light (VL) chains linked by a short linker peptide. Exemplary murine anti-CTLA-4 heavy chain variable region amino acid sequences are represented by SEQ ID NOs: 39 and 43. Exemplary murine anti-CTLA-4 light chain variable region amino acid sequences are represented by SEQ ID NOs: 37 and 41.

[0118] Anti-CTLA-4 scFvs can be identified by phage display. Anti-CTLA-4 scFvs can also be generated by subcloning VH and VL from known anti-CTLA-4 antibodies, such as hybridomas. Known anti-CTLA-4 antibodies are described, for example, in 20190048096, 20130136749, 20120148597, 20140099325, 20150104409, 20110296546, and 20080233122, among others. Known anti-CTLA-4 antibodies include, but are not limited to, ipilimumab and tremelimumab. In some embodiments, the VH and / or VL domains of anti-CTLA-4 scFvs can be humanized. Humanized antibodies (or antibody fragments or domains) are antibodies derived from non-human species whose protein sequences have been modified to enhance similarity to antibody variants naturally produced in humans. In some embodiments, humanized antibodies can be generated by inserting the relevant complementarity determining regions (CDRs, also called hypervariable regions (HVRs)) of an anti-CTLA-4 antibody into a human VH and VL domain scaffold.

[0119] An anti-CTLA-4 scFv can be formed by linking the C-terminus of the VH chain to the N-terminus of the VL. Alternatively, the C-terminus of the VL can be linked to the N-terminus of the VH. The peptide linker can be about 10 to about 25 amino acids. In some embodiments, the scFv peptide linker is glycine-rich. The scFv peptide linker can be (G4S) xwhere x is an integer between 2 and 5, inclusive. In some embodiments, the linked scFv peptide comprises Gly-Gly-Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Gly-Gly-Gly-Ser (i.e., also referred to as [(Gly)Ser], (G4S) or G4S(x3)). In some embodiments, the scFv peptide linker consists of G4S(x3). In some embodiments, the encoded anti-CTLA-4 scFv polypeptide comprises a signal peptide, such as an Igκ signal peptide. Exemplary anti-CTLA-4 scFv amino acid sequences are represented by SEQ ID NOs: 70 and 72. In some embodiments, the anti-CTLA-4 scFv comprises (a) the amino acid sequence of SEQ ID NO: 70 or 72, or a functional equivalent thereof; or (b) an amino acid sequence that is at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 70 or 72. V.CD3 half-BiTE

[0120] CD3 half-BiTEs contain an anti-CD3 single-chain variable fragment (scFv) fused to a transmembrane domain (TM). The scFv contains a fusion protein of the variable regions of the heavy (VH) and light (VL) chains of immunoglobulins linked by a short linker peptide. Exemplary anti-CD3 heavy chain variable region amino acid sequences are represented by SEQ ID NOs: 8 and 47. Exemplary murine anti-CD3 light chain variable region amino acid sequences are represented by SEQ ID NOs: 11 and 50.

[0121] Anti-CD3 scFvs can be identified by phage display. Anti-CD3 scFvs can also be generated by subcloning VH and VL from known anti-CD3 antibodies, such as hybridomas. Known anti-CD3 antibodies are described, for example, in US20180117152, US20140193399, US20100183554, and US20060177896. Known anti-CD3 antibodies include, but are not limited to, OKT3 (muromonab-CD3), 145-2C11, 17A2, SP7, and UCHT1. In some embodiments, the VH and / or VL domains of anti-CD3 scFvs can be humanized. Humanized antibodies (or antibody fragments or domains) are antibodies derived from non-human species whose protein sequences have been modified to enhance similarity to antibody variants naturally produced in humans. In some embodiments, humanized antibodies can be generated by inserting the relevant complementarity determining regions (CDRs, also called hypervariable regions (HVRs)) of an anti-CD3 antibody into a human VH and VL domain scaffold.

[0122] An anti-CD3 scFv can be formed by linking the C-terminus of the VH chain to the N-terminus of the VL. Alternatively, the C-terminus of the VL can be linked to the N-terminus of the VH. The peptide linker can be about 10 to about 25 amino acids. In some embodiments, the scFv peptide linker is glycine-rich. The scFv peptide linker can be (G4S) x where x is an integer between 2 and 5, inclusive. In some embodiments, the scFv peptide linker comprises Gly-Gly-Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Gly-Gly-Gly-Ser (i.e., also referred to as [(Gly)Ser], (G4S) or G4S(x3)). In some embodiments, the scFv peptide linker consists of G4S(x3).

[0123] The transmembrane domain (TM) comprises a polypeptide that can insert into a biological lipid bilayer (membrane) and anchor the CD3 half-BiTE to the membrane. TMs are known in the art and typically consist primarily of nonpolar amino acids. The transmembrane domain can be, but is not limited to, the PDGFRβ transmembrane domain or the PDGFRα transmembrane domain (PDGFR is the platelet-derived growth factor receptor). In some embodiments, a spacer is included between the anti-CD3 scFv and the transmembrane domain. In some embodiments, the TM domain comprises an amino acid sequence selected from the group including: VGQDTQEVIVVPHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPR (SEQ ID NO: 25), AVGQDTQEVIVVPHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPR (SEQ ID NO: 27), PDGFRβ:VVISAILALVVLTVISLIILI (SEQ ID NO: 83), PDGFRβ:VVISAILALVVLTIISLIILI (SEQ ID NO: 84), PDGFRα:AAVLVLLVIVIISLIVLVVIW (SEQ ID NO: 85), and PDGFRα:AAVLVLLVIVIVSLIVLVVIW (SEQ ID NO: 86).In some embodiments, the TM domain is encoded by a nucleic acid sequence selected from the group including: gtgggccaggacacgcaggaggtcatcgtggtgccacactccttgccctttaaggtggtggtgatctcagccatcctggccctggtggtgctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagccacgt (SEQ ID NO: 24), gctgtgggccaggacacgcaggaggtcatcgtggtgccacactccttgccctttaaggtggtggtgatctcagccatcctggccctggtggtgctc accatcatctcccttatcatcctcatcatgctttggcagaagaagccacgt (SEQ ID NO: 26), PDGFRβ: tggtgatctcagccatcctggccctggtggtgctcaccatcatctcccttatcatcctcatc (SEQ ID NO: 87), PDGFRβ: gtggtgatctcagccatcctggccctggtggtgctcaccatcatctcccttatcatcctcatc (SEQ ID NO: 88), PDGFRα: gctgcagtcctggtgctgttggtgattgtgatcatctcacttattgtcctggttgtcatttggaa (SEQ ID NO: 89).

[0124] In some embodiments, the encoded CD3 half-BiTE polypeptide comprises a signal peptide, such as an Igκ signal peptide.

[0125] Exemplary CD3 half-BiTE amino acid sequences are represented by SEQ ID NOs: 60, 62, 74, and 76. In some embodiments, the CD3 half-BiTE comprises (a) the amino acid sequence of SEQ ID NO: 60, 62, 74, or 76, or a functional equivalent thereof, or (b) an amino acid sequence that is at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 60, 62, 74, or 76. VI. Expression Cassettes

[0126] Any of the described polypeptides, CXCL9, CD3 half-BiTE, anti-CTLA4 scFv, and IL-12, can be encoded on a nucleic acid. The nucleic acid can be, but is not limited to, an expression cassette. The expression cassette can be on a plasmid. The term "plasmid" includes any nucleic acid vector, including a bacterial vector, a viral vector, an episomal plasmid, an integrative plasmid, or a phage vector. Delivery of an expression cassette includes delivery of a plasmid or nucleic acid vector (referred to as an "expression vector" or "vector") containing the expression cassette.

[0127] The encoded polypeptide can be linked to a sequence encoding a second polypeptide in an expression cassette. In some embodiments, the expression cassette encodes a fusion protein. The term "fusion protein" refers to a protein comprising two or more polypeptides linked together by peptide bonds or other chemical bonds. In some embodiments, the fusion protein is recombinantly expressed as a single polypeptide chain comprising two polypeptides. The two or more polypeptides can be linked directly or via a linker comprising one or more amino acids.

[0128] The expression cassette or plasmid may contain a multicistronic expression cassette, which expresses two or more separate proteins from the same mRNA and contains one or more translational modification elements.

[0129] In some embodiments, the described expression cassettes encode two or three polypeptides expressed from a single promoter and have one or more translation modification elements that allow the two or three polypeptides to be expressed from a single mRNA. In some embodiments, the expression cassette comprises: a) PATB, b) PBTA, c) PBT-B' c) PATB-T'-B' or d) PBT-B'-T'-A where P is a promoter, A encodes CXCL9 or CD3 half-BiTE, B and B' encode cytokines or cytokine subunits, and T and T' are translational modification elements.

[0130] The promoter may be, but is not limited to, a constitutively active promoter, a conditional promoter, an inducible promoter, or a cell type-specific promoter. Examples of promoters can be found, for example, in International Publication No. 2013 / 176772. The promoter may be, but is not limited to, a CMV promoter, an Igκ promoter, an mPGK promoter, an SV40 promoter, a β-actin promoter, an α-actin promoter, an SRα promoter, a herpes thymidine kinase promoter, a herpes simplex virus (HSV) promoter, a mouse mammary tumor virus long terminal repeat (LTR) promoter, an adenovirus major late promoter (Ad MLP), a Rous sarcoma virus (RSV) promoter, and an EF1α promoter. The CMV promoter may be, but is not limited to, a CMV immediate early promoter, a human CMV promoter, a mouse CNV promoter, and a monkey CMV promoter.

[0131] In some embodiments, T and / or T' are internal ribosome entry site (IRES) elements or ribosome skipping modulators. Ribosome skipping modulators can be, but are not limited to, 2A elements (also called 2A peptides or 2A self-cleaving peptides). 2A elements can be, but are not limited to, P2A (SEQ ID NO: 29), T2A, E2A, or F2A elements.

[0132] CXCL9 can be, but is not limited to, mouse CXCL9 and human CXCL9, or a functional equivalent or homologue or ortholog thereof.

[0133] The CD3 half-BiTE can be, but is not limited to, an anti-CD3 scFv-transmembrane domain (TM), an epitope tag (ET)-anti-CD3 scFv-ET-TM, an ET-anti-CD3 scFv-TM, an anti-CD3 scFv-ET-TM, an HA-anti-CD3 scFv-Myc-TM, an HA-anti-CD3 scFv-TM, an anti-CD3 scFv-Myc-TM, an anti-CD3 scFv-TM, or an anti-CD3 scFv-TM. The anti-CD3 scFv can be an anti-mouse CD3 scFv or an anti-human CD3 scFv. Each of these can contain a signal peptide. The signal peptide can be, but is not limited to, an Igκ signal peptide. The TM can be, but is not limited to, a PDGFR TM. The anti-CD3 scFv can be, but is not limited to, 2C11 or OKT3.

[0134] In some embodiments, the cytokine is an immunostimulatory cytokine. In some embodiments, the immunostimulatory cytokine is an interleukin. Cytokines include, but are not limited to, IL-1, IL-2, IL-10, IL-12, IL-15, IL-23, IL-27, IL-35, IFN-α, IFN-β, IFN-γ, and TGF-β. In some embodiments, B and / or B' encodes an IL-12, an IL-12 p35-IL-12 p40 fusion, IL-12 p70, IL-12 p35, or IL-12 p40 polypeptide. The IL-12, IL-12 p35-IL-12 p40 fusion, IL-12 p70, IL-12 p35, or IL-12 p40 polypeptide can be, but is not limited to, a murine or human IL-12, IL-12 p35-IL-12 p40 fusion, IL-12 p70, IL-12 p35, or IL-12 p40 polypeptide. In some embodiments, B encodes IL-12 p35 and B' encodes IL-12 p40.

[0135] In some embodiments, P is a CMV promoter, A encodes CXCL9, T is a P2A element, B encodes IL-12 p35, and B' encodes IL-12 p40.

[0136] In some embodiments, P is a CMV promoter, A encodes human CXCL9, T is a P2A element, B encodes IL-12 p35, and B' encodes IL-12 p40.

[0137] In some embodiments, P is a CMV promoter, A encodes murine CXCL9, T is a P2A element, B encodes IL-12 p35, and B' encodes IL-12 p40.

[0138] In some embodiments, P is a CMV promoter, A encodes Igκ-HA-anti-CD3 scFv-PDGFR™ CD3 half-BiTE, T is a P2A element, B encodes IL-12 p35, and B′ encodes IL-12 p40.

[0139] In some embodiments, P is a CMV promoter, A encodes Igκ-anti-CD3 scFv-PDGFR™ CD3 half-BiTE, T is a P2A element, B encodes IL-12 p35, and B′ encodes IL-12 p40.

[0140] In some embodiments, P is a CMV promoter, A encodes Igκ-HA-2C11-PDGFR™ CD3 half-BiTE, T is a P2A element, B encodes IL-12 p35, and B′ encodes IL-12 p40.

[0141] In some embodiments, P is a CMV promoter, A encodes Igκ-2C11-PDGFR™ CD3 half-BiTE, T is a P2A element, B encodes IL-12 p35, and B′ encodes IL-12 p40.

[0142] In some embodiments, P is a CMV promoter, A encodes Igκ-HA-OCT3-PDGFR™ CD3 half-BiTE, T is a P2A element, B encodes IL-12 p35, and B′ encodes IL-12 p40.

[0143] In some embodiments, P is a CMV promoter, A encodes Igκ-OKT3-PDGFR™ CD3 half-BiTE, T is a P2A element, B encodes IL-12 p35, and B′ encodes IL-12 p40.

[0144] In some embodiments, B encodes IL-12 p35, T is a P2A element, and B' encodes IL-12 p40. In some embodiments, B encodes IL-12 p35, T is an IRES element, and B' encodes IL-12 p40. The promoter can be, but is not limited to, a CMV promoter.

[0145] In some embodiments, we describe an expression cassette that encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 60, 62, 74, or 76, or a polypeptide having at least 70% identity to the amino acid sequence of SEQ ID NO: 60, 62, 74, or 76. In some embodiments, the expression cassette encodes a polypeptide comprising an amino acid sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the amino acid sequence of SEQ ID NO: 60, 62, 74, or 76, wherein the encoded polypeptide retains the functional activity of a CD3 half-BiTE polypeptide.

[0146] In some embodiments, we describe expression cassettes that encode a polypeptide comprising the amino acid sequence of SEQ ID NO: 64, 66, 78, or 70, or a polypeptide having at least 70% identity to the amino acid sequence of SEQ ID NO: 64, 66, 78, or 70. In some embodiments, the expression cassette encodes a polypeptide comprising an amino acid sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the amino acid sequence of SEQ ID NO: 64, 66, 78, or 70, wherein the encoded polypeptide retains the functional activity of a CD3 half-BiTE polypeptide and an IL-12 polypeptide.

[0147] In some embodiments, we describe an expression cassette that encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 35 or 58, or a polypeptide having at least 70% identity to the amino acid sequence of SEQ ID NO: 35 or 58. In some embodiments, the expression cassette encodes a polypeptide comprising an amino acid sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the amino acid sequence of SEQ ID NO: 35 or 58, wherein the encoded polypeptide retains the functional activity of a CXCL9 polypeptide.

[0148] In some embodiments, we describe an expression cassette that encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 68 or 82, or a polypeptide having at least 70% identity to the amino acid sequence of SEQ ID NO: 68 or 82. In some embodiments, the expression cassette encodes a polypeptide comprising an amino acid sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the amino acid sequence of SEQ ID NO: 68 or 82, wherein the encoded polypeptide retains the functional activity of a CXCL9 polypeptide and an IL-12 polypeptide.

[0149] In some embodiments, we describe an expression cassette that encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 70 or 72, or a polypeptide having at least 70% identity to the amino acid sequence of SEQ ID NO: 70 or 72. In some embodiments, the expression cassette encodes a polypeptide comprising an amino acid sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the amino acid sequence of SEQ ID NO: 70 or 72, wherein the encoded polypeptide retains the functional activity of the anti-CTLA-4 scFv polypeptide.

[0150] In some embodiments, we describe an expression cassette comprising the nucleotide sequence of SEQ ID NO: 59, 61, 73, or 75, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 59, 61, 73, or 75. In some embodiments, the expression cassette comprises a sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the nucleotide sequence of SEQ ID NO: 59, 61, 73, or 75, and encodes a polypeptide having the functional activity of a CD3 half-BiTE polypeptide. In some embodiments, the nucleotide sequence of SEQ ID NO: 59, 61, 73, or 75, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 59, 61, 73, or 75, is operably linked to a CMV promoter.

[0151] In some embodiments, we describe an expression cassette comprising the nucleotide sequence of SEQ ID NO: 63, 65, 77, or 79, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 63, 65, 77, or 79. In some embodiments, the expression cassette comprises a sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the nucleotide sequence of SEQ ID NO: 63, 65, 77, or 79, and encodes a polypeptide having the functional activity of a CD3 half-BiTE polypeptide and an IL-12 polypeptide. In some embodiments, the nucleotide sequence of SEQ ID NO: 63, 65, 77, or 79, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 63, 65, 77, or 79, is operably linked to a CMV promoter.

[0152] In some embodiments, we describe an expression cassette comprising the nucleotide sequence of SEQ ID NO: 34 or 57, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 34 or 57. In some embodiments, the expression cassette comprises a sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the nucleotide sequence of SEQ ID NO: 34 or 57, and encodes a polypeptide having the functional activity of a CXCL9 polypeptide. In some embodiments, the nucleotide sequence of SEQ ID NO: 34 or 57, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 34 or 57, is operably linked to a CMV promoter.

[0153] In some embodiments, we describe an expression cassette comprising the nucleotide sequence of SEQ ID NO: 67 or 81, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 67 or 81. In some embodiments, the expression cassette comprises a sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the nucleotide sequence of SEQ ID NO: 67 or 81, and encodes a polypeptide having the functional activity of a CXCL9 polypeptide and an IL-12 polypeptide. In some embodiments, the nucleotide sequence of SEQ ID NO: 67 or 81, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 67 or 81, is operably linked to a CMV promoter.

[0154] In some embodiments, we describe an expression cassette comprising the nucleotide sequence of SEQ ID NO: 69 or 71, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 69 or 71. In some embodiments, the expression cassette comprises a sequence having greater than 70%, 72%, 75%, 78%, 80%, 82%, 83%, 85%, 87%, 88%, 90%, 92%, 93%, 95%, 96%, 97%, 98%, or 99% identity to the nucleotide sequence of SEQ ID NO: 69 or 71, and encodes a polypeptide having the functional activity of an anti-CTLA-4 scFv polypeptide. In some embodiments, the nucleotide sequence of SEQ ID NO: 69 or 71, or a nucleotide sequence having at least 70% identity to the nucleotide sequence of SEQ ID NO: 69 or 71, is operably linked to a CMV promoter. VII. Treatment Methods

[0155] Methods for treating a tumor in a subject are described, comprising administering to the tumor, tumor microenvironment, and / or tumor-surrounding tissue a composition comprising an effective amount of one or more of the described CXCL9, CD3 half-BiTE, and / or CTLA-4 scFv expression cassettes, and administering electroporation therapy to the tumor, tumor microenvironment, and / or tumor-surrounding tissue (IT-EP therapy). The CXCL9 or CD3 half-BiTE expression cassette may further encode IL-12. In some embodiments, an effective amount of the expression cassette is administered to the tumor, for example, by injecting the expression cassette into the tumor and administering at least one electroporation pulse to the tumor.

[0156] The tumor to be treated may be a skin tumor, a subcutaneous tumor, or a visceral tumor. The tumor may be cancerous or non-cancerous. The tumor may be, but is not limited to, a solid tumor, a surface lesion, a non-surface lesion, a lesion within 15 cm of the body surface, or a visceral lesion. In some embodiments, the described methods and expression vectors can be used to treat primary tumors as well as distant (i.e., untreated) tumors and metastases. In some embodiments, the described methods provide for reducing tumor size or inhibiting tumor growth, inhibiting cancer cell growth, inhibiting or reducing metastasis, reducing or inhibiting the occurrence of metastatic cancer, and / or reducing cancer recurrence in a subject suffering from cancer. The tumor is not limited to a particular type of tumor or cancer.

[0157] In some embodiments, the method further comprises administering an effective amount of an immunostimulatory cytokine. The immunostimulatory cytokine can be administered by IT-EP of an expression cassette encoding the cytokine. In some embodiments, the cytokine is encoded on an expression cassette encoding CXCL9 or a CD3 half-BiTE. In some embodiments, the cytokine is encoded on a second expression vector and delivered to the cancerous tumor by IT-EP. In some embodiments, the cytokine is IL-12. In some embodiments, the expression cassette comprises BT-B', where B encodes IL-12 p35, T is a P2A element, and B' encodes IL-12 p40. The cytokine can be administered before, simultaneously with, or after IT-EP CXCL9 treatment or IT-EP CD3 half-BiTE treatment.

[0158] IT-EP CXCL9 therapy or treatment involves injecting the tumor, tumor microenvironment, and / or tumor-surrounding tissue with an effective amount of the described expression cassette encoding CXCL9, and administering electroporation therapy to the tumor. In some embodiments, the expression cassette is injected into the tumor.

[0159] IT-EP IL12 to CXCL9 therapy or treatment involves injecting the tumor, tumor microenvironment, and / or tumor-surrounding tissue with an effective amount of the described expression cassettes encoding CXCL9 and IL-12, and administering electroporation therapy to the tumor. In some embodiments, the expression cassettes are injected into the tumor.

[0160] IT-EP CD3 half-BiTE therapy or treatment involves injecting the tumor, tumor microenvironment, and / or tumor-surrounding tissue with an effective amount of the described expression cassette encoding a CD3 half-BiTE, and administering electroporation therapy to the tumor. In some embodiments, the expression cassette is injected into the tumor.

[0161] The IT-EP CD3 half-BiTE to IL-12 or treatment regimen comprises injecting the tumor, tumor microenvironment, and / or tumor-surrounding tissue with an effective amount of the described expression cassette encoding CD3 half-BiTE and IL-12, and administering electroporation therapy to the tumor. In some embodiments, the expression cassette is injected into the tumor.

[0162] IT-EP anti-CTLA-4 scFv therapy or treatment comprises injecting the tumor, tumor microenvironment, and / or tumor-surrounding tissue with an effective amount of the described expression cassette encoding the anti-CTLA-4 scFv, and administering electroporation therapy to the tumor. In some embodiments, the expression cassette is injected into the tumor.

[0163] IT-EP IL12 therapy or treatment involves injecting the tumor, tumor microenvironment, and / or tumor-surrounding tissue with an effective amount of an expression cassette encoding IL-12 and administering electroporation therapy to the tumor. In some embodiments, the expression cassette encoding IL-12 comprises IL12-2A (mIL12-2A and hIL12-2A; FIG. 1). In some embodiments, the expression cassette is injected into the tumor.

[0164] In some embodiments, the described expression cassettes, plasmids containing the described expression cassettes, and methods can be used to treat one or more tumors, tumor cells, or tumor lesions. Tumor cells can be, but are not limited to, cancer cells. The term "cancer" generally includes a myriad of diseases characterized by inappropriate, abnormal, or excessive cell proliferation. Cancer can be, but is not limited to, solid cancers, sarcomas, carcinomas, and lymphomas. Cancer can also be, but is not limited to, pancreatic cancer, skin cancer, brain cancer, liver cancer, gallbladder cancer, stomach cancer, lymph node cancer, breast cancer, lung cancer, head and neck cancer, laryngeal cancer, pharyngeal cancer, lip cancer, throat cancer, heart cancer, kidney cancer, muscle cancer, colon cancer, prostate cancer, thymic cancer, testicular cancer, uterine cancer, ovarian cancer, skin cancer, and subcutaneous cancer. Skin cancer can be, but is not limited to, melanoma and basal cell carcinoma. Breast cancer can be, but is not limited to, ER-positive breast cancer, ER-negative breast cancer, and triple-negative breast cancer. In some embodiments, the described methods can be used to treat cell proliferative disorders. The term "cell proliferative disorder" refers to malignant and non-malignant cell populations that often appear morphologically and genotypically distinct from the surrounding tissue. In some embodiments, the described methods can be used to treat humans. In some embodiments, the described methods can be used to treat non-human animals or mammals. The non-human mammal can be, but is not limited to, a mouse, rat, rabbit, dog, cat, pig, cow, sheep, or horse.

[0165] The described expression cassettes and methods are intended for use in subjects suffering from cancer or other non-cancerous (benign) growths. The tumors treated by the methods of this embodiment can be non-invasive, invasive, superficial, papillary, flat, metastatic, localized, unicentric, multicentric, low-grade, and high-grade tumors. These growths may manifest as either lesions, polyps, neoplasms (e.g., papillary urothelial neoplasms), papillomas, malignancies, tumors (e.g., Kratskin tumor, hilar tumor, non-invasive papillary urothelial tumor, germ cell tumor, Ewing tumor, Askin tumor, primitive neuroectodermal tumor, Leydig cell tumor, Wilms tumor, Sertoli cell tumor), sarcomas, carcinomas (e.g., squamous cell carcinoma, cloacal carcinoma, adenocarcinoma, adenosquamous carcinoma, cholangiocarcinoma, hepatocellular carcinoma, invasive papillary urothelial carcinoma, squamous cell carcinoma), masses, or any other type of cancerous or non-cancerous growth. The expression cassettes and methods can be used to treat advanced, metastatic, or treatment-refractory cancers.

[0166] The expression cassettes and methods described herein can be used to express, for example, adrenocortical carcinoma, anal cancer, bile duct cancer (e.g., peripheral carcinoma, distal bile duct cancer, intrahepatic bile duct cancer), bladder cancer, benign and cancerous bone cancer (e.g., osteoma, osteoid osteoma, osteoblastoma, osteochondroma, hemangioma, chondromyxoid fibroma, osteosarcoma, chondrosarcoma, fibrosarcoma, malignant fibrous histiocytoma, giant cell tumor of bone, chordoma, lymphoma, multiple myeloma), brain and central nervous system cancer (e.g., meningioma, astrocytoma, oligodendroglioma, ependymoma, glioma, medulloblastoma, ganglioneuroma, schwannoma, germline cell tumor, leukemia ... cyst, craniopharyngioma), breast cancer (e.g., ductal carcinoma in situ, invasive ductal carcinoma, invasive lobular carcinoma, lobular carcinoma in situ, gynecomastia), Castleman's disease (e.g., giant lymph node hyperplasia, angiofollicular lymph node hyperplasia), cervical cancer, colorectal cancer, endometrial cancer (e.g., endometrial adenocarcinoma, adenocarcinoma, papillary serous adenocarcinoma, clear cell carcinoma), esophageal cancer, gallbladder cancer (mucinous adenocarcinoma, small cell carcinoma), gastrointestinal carcinoid tumors (e.g., choriocarcinoma, serous adenoma) destruens), Hodgkin's disease, non-Hodgkin's lymphoma, Kaposi's sarcoma, kidney cancer (e.g., renal cell carcinoma), laryngeal and hypopharyngeal cancer, liver cancer (e.g., hemangioma, hepatic adenoma, focal nodular hyperplasia, hepatocellular carcinoma), lung cancer (e.g., small cell lung cancer, non-small cell lung cancer), mesothelioma, plasmacytoma, nasal cavity and paranasal sinus cancer (e.g., esthesioneuroblastoma, midline granuloma), nasopharyngeal cancer, neuroblastoma, oral cavity and oropharyngeal cancer, ovarian cancer, pancreatic cancer, penile cancer, pituitary gland Use in cancers such as ovarian cancer, prostate cancer, retinoblastoma, rhabdomyosarcoma (e.g., embryonal rhabdomyosarcoma, alveolar rhabdomyosarcoma, pleomorphic rhabdomyosarcoma), salivary gland cancer, skin cancer, both melanoma and non-melanoma skin cancer, stomach cancer, testicular cancer (e.g., seminoma, non-seminomatous germ cell carcinoma), thymic cancer, thyroid cancer (e.g., follicular carcinoma, undifferentiated carcinoma, poorly differentiated carcinoma, medullary thyroid carcinoma, thyroid lymphoma), vaginal cancer, vulvar cancer, and uterine cancer (e.g., uterine leiomyosarcoma) is contemplated.

[0167] In some embodiments, the subject has low tumor infiltrating lymphocytes (TILs) and / or impaired tumor IFNγ signaling.

[0168] The described methods can be used to cause one or more of the following: inflame tumors, induce T cell infiltration into tumors or the tumor microenvironment (increase the number of tumor-infiltrating lymphocytes (TILs)), enhance systemic T cell responses, induce activation of tumor-specific T cells, increase antigen-specific T cell responses, increase proliferation of antigen-specific T cells, increase polyclonal T cell responses, enhance immune responses to treated and / or untreated tumors, decrease T cell exhaustion, increase lymphocyte and monocyte cell surface markers in one or more treated or untreated tumors, increase I in one or more treated or untreated tumors Increasing intratumoral levels of NFγ-regulatory genes, increasing proliferating effector memory T cells in the subject's blood, increasing short-lived effector cells in the subject's blood, increasing expression of genes present in activated natural killer cells in cancerous tumors, increasing expression of genes that function in antigen presentation in cancerous tumors, increasing expression of genes that function in T cell survival and T cell-mediated cytotoxicity in cancerous tumors, inducing regression of treated and / or untreated tumors, inducing debulking of treated and / or untreated tumors, and improving response to second therapies, such as, but not limited to, immune checkpoint inhibitor therapy. In some embodiments, the enhanced immune response to tumors results in increased survival of the subject.

[0169] In some embodiments, the described methods of treating a subject having a cancerous tumor include injecting an effective amount of a plasmid encoding CXCL9 into the cancerous tumor and administering electroporation therapy to the tumor. In some embodiments, the described methods of treating a subject having a cancerous tumor include injecting an effective amount of a plasmid encoding a CD3 half-BiTE into the cancerous tumor and administering electroporation therapy to the tumor. In some embodiments, the described methods of treating a subject having a cancerous tumor include injecting an effective amount of a plasmid encoding an anti-CTLA-4 scFv into the cancerous tumor and administering electroporation therapy to the tumor. In some embodiments, the plasmid is administered substantially simultaneously with the electroporation treatment. The term "substantially simultaneously" means that the molecules and the electroporation treatment are administered reasonably close in time, i.e., before the effect of the electric pulse on the cells has worn off.

[0170] In some embodiments, the described methods result in an increase in NK cell and T cell populations in the tumor or tumor microenvironment. The IT-EP of CXCL9, IL12 to CXCL9, CD3 half-BiTE to IL12, and / or CD3 half-BiTE increases tumor-specific T cell homing to the tumor, increases tumor-specific T cell activation and / or proliferation, and / or increases recruitment of CD8+ T cells, NK cells, and NKT cells to the tumor microenvironment. T cell activation can result in increased tumor cell killing by activated T cells.

[0171] In some embodiments, administration of IL-12 therapy with IT-EP enhances T cell infiltration of tumors. Subsequent expression of CD3 half-BiTE in tumors can activate T cells and enhance the population of antigen-specific T cells.

[0172] In some embodiments, IT-EP CXCL9 treatment enhances IL-12 effects, resulting in increased effective trafficking of tumor-specific lymphocytes.

[0173] In some embodiments, IT-EP CXCL9 treatment inhibits angiogenesis in tumors or the tumor microenvironment. In some embodiments, combining IT-EP CXCL9 with IL-12 treatment increases the trafficking of tumor-specific lymphocytes to tumors.

[0174] In some embodiments, intratumoral electroporation of an expression cassette encoding CXCL9 can be administered in conjunction with other therapeutic entities. In some embodiments, IT-EP CXCL9 therapy is combined with IL-12 therapy. IL-12 therapy can be administered before, simultaneously with, and / or after IT-EP CXCL9 therapy. IL-12 therapy can be administered before and simultaneously with IT-EP CXCL9 therapy. IL-12 therapy can be administered before and after IT-EP CXCL9 therapy. IL-12 therapy can be administered before and after IT-EP CXCL9 therapy. IL-12 therapy can be administered simultaneously with and after IT-EP CXCL9 therapy. IL-12 therapy can be administered before, simultaneously with, and / or after IT-EP CXCL9 therapy. IT-EP CXCL9 therapy can be administered before, simultaneously with, and / or after IL-12 therapy. IT-EP CXCL9 therapy can be administered before and simultaneously with IL-12 therapy. IT-EP CXCL9 therapy can be administered before and after IL-12 therapy. IT-EP CXCL9 therapy can be administered simultaneously with or after IL-12 therapy. IT-EP CXCL9 therapy can be administered before, simultaneously with, or after IL-12 therapy. In some embodiments, IL-12 therapy is administered via IT-EP of an expression cassette encoding IL-12. CXCL9 and IL-12 can be expressed from a single expression cassette or plasmid, or from multiple expression cassettes or plasmids. In some embodiments, for simultaneous therapy, IT-EP CXCL9-IL12 therapy, CXCL9 and IL-12 are expressed from a single expression cassette or plasmid.

[0175] In some embodiments, intratumoral electroporation of an expression cassette encoding a CD3 half-BiTE can be administered in conjunction with other therapeutic entities. In some embodiments, IT-EP CD3 half-BiTE therapy is combined with IL-12 therapy. IL-12 therapy can be administered before, simultaneously with, and / or after IT-EP CD3 half-BiTE therapy. IL-12 therapy can be administered before and simultaneously with IT-EP CD3 half-BiTE therapy. IL-12 therapy can be administered before and after IT-EP CD3 half-BiTE therapy. IL-12 therapy can be administered simultaneously with and after IT-EP CD3 half-BiTE therapy. IL-12 therapy can be administered before, simultaneously with, and after IT-EP CD3 half-BiTE therapy. IT-EP CD3 half-BiTE therapy can be administered before, simultaneously with, and / or after IL-12 therapy. IT-EP CD3 half-BiTE therapy can be administered before and simultaneously with IL-12 therapy. IT-EP CD3 half-BiTE therapy can be administered before and after IL-12 therapy. IT-EP CD3 half-BiTE therapy can be administered simultaneously with and after IL-12 therapy. IT-EP CD3 half-BiTE therapy can be administered before, simultaneously with, and after IL-12 therapy. In some embodiments, IL-12 therapy is administered via an IT-EP expression cassette encoding IL-12. CD3 half-BiTE and IL-12 can be expressed from a single expression cassette or plasmid, or from multiple expression cassettes or plasmids. In some embodiments, for simultaneous therapy, IT-EP CD3 half-BiTE-IL12 therapy, CD3 half-BiTE and IL-12 are expressed from a single expression cassette or plasmid.

[0176] In some embodiments, IT-EP CXCL9 therapy is combined with IT-EP CD3 half-BiTE therapy. In some embodiments, IT-EP CXCL9 and / or IT-EP CD3 half-BiTE therapy is combined with IL-12 therapy. IT-EP CD3 half-BiTE therapy can be administered before, simultaneously with, and / or after IT-EP CXCL9 therapy. IT-EP CD3 half-BiTE therapy can be administered before and simultaneously with IT-EP CXCL9 therapy. IT-EP CD3 half-BiTE therapy can be administered before and after IT-EP CXCL9 therapy. IT-EP CD3 half-BiTE therapy can be administered simultaneously with and after IT-EP CXCL9 therapy. IT-EP CD3 half-BiTE therapy can be administered before, simultaneously with, and after IT-EP CXCL9 therapy. IT-EP CD3 half-BiTE therapy can be administered before, simultaneously with, and after IT-EP CXCL9 therapy. IT-EP CXCL9 therapy can be administered before, simultaneously with, and / or after IT-EP CD3 half-BiTE therapy. IT-EP CXCL9 therapy can be administered before and / or concurrently with IT-EP CD3 half-BiTE therapy. IT-EP CXCL9 therapy can be administered before and / or after IT-EP CD3 half-BiTE therapy. IT-EP CXCL9 therapy can be administered concurrently with and / or after IT-EP CD3 half-BiTE therapy. IT-EP CXCL9 therapy can be administered before, concurrently with, and / or after IT-EP CD3 half-BiTE therapy. Either CXCL3 or CD3 half-BiTE therapy can be combined with IL-12 therapy, such as by IT-EP of an expression cassette or plasmid encoding both CXCL9 and IL-12 or both CD3-half-BiTE and IL-12, respectively (i.e., IT-EP IL12~CXCL9 and IT-EP CD3 half-BiTE~IL12 therapy).

[0177] In some embodiments, the IT-EP CD3 half-BiTE therapy or IT-EP CD3 half-BiTE~IL-12 therapy can be co-administered with one or more of the IT-EP IL12 therapy, IT-EP CXCL9 therapy, and IT-EP IL12~CXCL9 therapy.

[0178] In some embodiments, the described expression cassettes are combined with one or more pharmaceutically acceptable excipients. Pharmaceutically acceptable excipients are substances other than the active ingredient (API, therapeutic product) that are intentionally included with an API (molecule). Excipients do not exert, or are not intended to exert, a therapeutic effect at the intended dosage. Excipients may a) aid in processing the API during manufacturing; b) protect, support, or enhance the stability, bioavailability, or subject acceptability of the API; c) aid in product identification; and / or d) act to enhance any other attribute of the overall safety, efficacy, or delivery of the API during storage or use. Pharmaceutically acceptable excipients may or may not be inert substances. Excipients include, but are not limited to, absorption enhancers, anti-adherents, anti-foaming agents, antioxidants, binders, buffers, carriers, coatings, colorants, delivery enhancers, delivery polymers, dextran, dextrose, diluents, disintegrants, emulsifiers, bulking agents, fillers, flavors, glidants, humectants, lubricants, oils, polymers, preservatives, saline, salts, solvents, sugars, suspending agents, sustained release matrices, sweeteners, thickeners, tonicity agents, vehicles, water repellents, and wetting agents. VIII. Treatment Regimen / Cycle

[0179] The described IT-EP treatments can be administered at various intervals depending on factors such as the nature of the tumor, the condition of the subject, the size and chemical characteristics of the molecule, and the half-life of the molecule.

[0180] In some embodiments, methods of treating tumors are described that include administering IT-EP IL12 therapy followed by IT-EP CXCL9 and / or IT-EP IL12-CXCL9 therapy. The IT-EP CXCL9 or IT-EP IL12-CXCL9 therapy can increase tumor-specific T cell recruitment to the tumor or tumor microenvironment and / or increase T cell activation. In some embodiments, the IT-EP IL12 therapy is administered to the tumor on day 0 (±1 day), and the IT-EP CXCL9 therapy is administered to the tumor on days 4 (±2 days) and 7 (±2 days). In some embodiments, the IT-EP IL12 therapy is administered to the tumor on day 0, and the IT-EP IL12-CXCL9 therapy is administered to the tumor on days 4 (±2 days) and 7 (±2 days).

[0181] In some embodiments, methods of treating tumors are described that include administering IT-EP IL12 therapy followed by IT-EP CD3 half-BiTE and / or CD3 half-BiTE~IL12 therapy. In some embodiments, the IT-EP IL12 therapy is administered to the tumor on day 0 (±1 day), and the IT-EP CD3 half-BiTE therapy is administered to the tumor on days 4 (±2 days) and 7 (±2 days). In some embodiments, the IT-EP IL12 therapy is administered to the tumor on day 0, and the IT-EP CD3 half-BiTE~IL12 therapy is administered to the tumor on days 4 (±2 days) and 7 (±2 days).

[0182] In some embodiments, methods of treating tumors are described that include IT-EP IL12 therapy followed by IT-EP CXCL9 or IT-EP IL12~CXCL9 therapy, and / or IT-EP CD3 half-BiTE or IT-EP CD3 half-BiTE~IL-12 therapy.

[0183] In some embodiments, IT-EP IL12 therapy is administered first to expand tumor-infiltrating lymphocytes, followed by treatment of the tumor with IT-EP CXCL9 or IL12 to CXCL9 therapy and / or IT-EP CD3 half-BiTE or IT-EP CD3 half-BiTE to IL-12 therapy.

[0184] In some embodiments, IT-EP IL12~CXCL9 therapy and / or IT-EP CD3 half-BiTE~IL-12 therapy is administered on days 0, 0 and 4 (±2 days), 0 and 7 (±2 days), or 0, 4 (±2 days) and 7 (±2 days). In some embodiments, IT-EP IL12~CXCL9 therapy is administered on days 0, 0 and 4 (±2 days), 0 and 7 (±2 days), or 0, 4 (±2 days) and 7 (±2 days). In some embodiments, IT-EP CD3 half-BiTE~IL-12 therapy is administered on days 0, 1 and 4 (±2 days), 1 and 7 (±2 days), or 1, 4 (±2 days) and 7 (±2 days). In some embodiments, IT-EP IL12~CXCL9 treatment and IT-EP CD3 half-BiTE~IL-12 treatment are administered on days 0, 0 and 4 (±2 days), 0 and 7 (±2 days), or 0, 4 (±2 days) and 7 (±2 days). Days 0, 4, and 7 are equivalent to days 1, 5, and 8.

[0185] A treatment cycle can include one to six IT-EP treatments. In some embodiments, a treatment cycle includes one, two, or three IT-EP treatments. A cycle can be about one week to about six weeks, or about two weeks to about five weeks. In some embodiments, the cycle is about three weeks. In some embodiments, the cycle is about six weeks. In some embodiments, IT-EP therapy is administered on one or more of days 0, 4 (±2 days), and 7 (±2 days) in alternating (every other) three-week cycles (i.e., every six weeks).

[0186] In some embodiments, a cycle includes one to three IT-EP treatments. Treatments can occur on days 1 (±2 days), 5 (±2 days), and / or 8 (±2 days) (i.e., days 0 (±2 days), 4 (±2 days), and / or 7 (±2 days)). Each treatment can include one or more of IT-EP IL2, IT-EP CXCL9, IT-EP IL12 to CXCL9, IT-EP CD3 half-BiTE, IT-EP CD3 half-BiTE to IL12, and IT-EP anti-CTLA4 scFv.

[0187] In some embodiments, methods of treating tumors are described, comprising administering IT-EP IL12 therapy on day 1 of a cycle and administering IT-EP CXCL9 or IT-EP IL12~CXCL9 on days 5 (± 2 days) and 8 (± 2 days) of the cycle. In some embodiments, methods of treating tumors are described, comprising administering IT-EP IL12 therapy on day 1 of a cycle and administering IT-EP CD3 half-BiTE or IT-EP CD3 half-BiTE~IL12 on days 5 (± 2 days) and 8 (± 2 days) of the cycle. In some embodiments, methods of treating a tumor are described, comprising administering IT-EP IL12 therapy on day 1 of a cycle and administering one or more of IT-EP CXCL9 or IT-EP IL12 to CXCL9, IT-EP CD3 half-BiTE, and IT-EP CD3 half-BiTE to IL12 on days 5 (± 2 days) and 8 (± 2 days) of the cycle.

[0188] In some embodiments, methods of treating tumors are described that include a) administering IT-EP IL12 therapy in a first cycle, b) administering IT-EP CXCL9 or IT-EP IL12~CXCL9 therapy in a second cycle, and c) administering IT-EP CD3 half-BiTE or IT-EP CD3 half-BiTE~IL-12 therapy in a third cycle. Each cycle can include 1 to 3 administrations of the corresponding IT-EP therapy.

[0189] Dosing regimens are described that include administration of an IT-EP IL12 therapy in combination with an IT-EP CXCL9 therapy and / or an IT-EP CD3 half-BiTE therapy. Dosing regimens are also described that include administration of an IT-EP CXCL9 or IL12-to-CXCL9 therapy with an IT-EP CD3 half-BiTE or IT-EP CD3 half-BiTE-to-IL12 therapy. The treatments can be administered simultaneously, sequentially, or separately. In some embodiments, an IT-EP IL12 therapy is administered in a first cycle, and an IT-EP CXCL9 therapy or an IT-EP IL12-to-CXCL9 therapy is administered in a second cycle. In some embodiments, an IT-EP IL12 therapy is administered in a first cycle, and an IT-EP CD3 half-BiTE therapy or an IT-EP CD3 half-BiTE-IL12 therapy is administered in a second cycle. In some embodiments, IT-EP IL12 therapy is administered in the first cycle, IT-EP CXCL9 therapy or IT-EP CXCL9-IL12 therapy is administered in the second cycle, and IT-EP CD3 half-BiTE therapy or IT-EP CD3 half-BiTE-IL12 therapy is administered in the third cycle. IT-EP therapy can be delivered on day 1 of each cycle. One or more cycles may be repeated as needed. Within a cycle, IT-EP therapy can be administered on at least day 1, 2, or 3 of the cycle. For example, a given expression cassette can be administered on day 1, day 5 (±2 days), and / or day 8 (±2 days).

[0190] In some embodiments, a CXCL9 or IL12 or CXCL9 + IL-12 expression cassette is administered on days 1, 5 ± 2, and 8 ± 2 of a cycle. In some embodiments, a CTLA-4 scFv or anti-CTLA-4 scFv + IL-12 expression cassette is administered on days 1, 5 ± 2, and 8 ± 2 of a cycle. In some embodiments, a CD3 half-BiTE or a CD3 half-BiTE + IL-12 expression cassette is administered on days 1, 5 ± 2, and 8 ± 2 of a cycle.

[0191] In some embodiments, a CXCL9 or CXCL9 + IL-12 expression cassette (e.g., IL12 to CXCL9) is administered on days 1 and 5 ± 2, and a CD3 half-BiTE or CD3 half-BiTE + IL-12 expression cassette (e.g., CD3 half-BiTE to IL12) is administered on day 8 ± 2 of the cycle. In some embodiments, a CXCL9 or CXCL9 + IL-12 expression cassette is administered on day 1, and a CD3 half-BiTE or CD3 half-BiTE + IL-12 expression cassette is administered on days 5 ± 2 and 8 ± 2 of the cycle. In some embodiments, a CXCL9 or CXCL9 + IL-12 expression cassette is administered on days 1 and 8 ± 2, and a CD3 half-BiTE or CD3 half-BiTE + IL-12 expression cassette is administered on day 5 ± 2 of the cycle.

[0192] In some embodiments, CD3 half-BiTEs or CD3 half-BiTEs+IL-12 expression cassettes are administered on days 1 and 5±2, and CXCL9 or CXCL9+IL-12 expression cassettes are administered on day 8±2 of the cycle. In some embodiments, CD3 half-BiTEs or CD3 half-BiTEs+IL-12 expression cassettes are administered on day 1, and CXCL9 or CXCL9+IL-12 expression cassettes are administered on days 5±2 and 8±2 of the cycle. In some embodiments, CD3 half-BiTEs or CD3 half-BiTEs+IL-12 expression cassettes are administered on days 1 and 8±2, and CXCL9 or CXCL9+IL-12 expression cassettes are administered on day 5±2 of the cycle.

[0193] In some embodiments, the IL-12-2A expression cassette is administered on day 1, and the CXCL9 or IL12-CXCL9 expression cassette is administered on days 5±2 and 8±2 of the cycle. In some embodiments, the IL-12-2A expression cassette is administered on days 1 and 5±2, and the CXCL9 or IL12-CXCL9 expression cassette is administered on day 8±2 of the cycle.

[0194] In some embodiments, the IL-12-2A expression cassette is administered on day 1, and the CD3 half-BiTE or CD3 half-BiTE~IL-12 expression cassette is administered on days 5±2 and 8±2 of the cycle. In some embodiments, the IL-12-2A expression cassette is administered on days 1 and 5±2, and the CD3 half-BiTE or CD3 half-BiTE~IL-12 expression cassette is administered on day 8±2 of the cycle.

[0195] In some embodiments, the IL12-2A expression cassette is administered on day 1, the CD3 half-BiTE or CD3 half-BiTE~IL-12 expression cassette is administered on day 5±2, and the CXCL9 or IL12~CXCL9 expression cassette is administered on day 8±2 of the cycle. In some embodiments, the IL-12-2A expression cassette is administered on day 1, the CXCL9 or IL12~CXCL9 expression cassette is administered on day 5±2, and the CD3 half-BiTE or CD3 half-BiTE~IL-12 expression cassette is administered on day 8±2 of the cycle.

[0196] In some embodiments, if a subject receives at least one IT-EP treatment with IL-12~CXCL9 and one IT-EP treatment with CD3 half-BiTE~IL12, the subject is administered either the IT-EP IL-12~CXCL9 treatment or the IT-EP CD3 half-BiTE~IL12 treatment on days 0, 4 (±2 days), and 7 (±2 days).

[0197] In some embodiments, treatment can be administered every other cycle or every other cycle.The cycle can be repeated so that two or more cycles are administered to the subject.The repeated cycle can be administered continuously, or can be alternated with one or more different treatment cycles, or can be administered simultaneously with one or more different treatment cycles.Any of the above treatments can be combined with other cancer treatments.For example, IT-EP cycle can be combined with checkpoint inhibitor treatment. IX. Combination Therapy

[0198] In some embodiments, the treatment method includes a combination therapy. The combination therapy includes a combination of therapeutic molecules or treatments. Therapeutic treatments include, but are not limited to, electrical pulses (i.e., electroporation), radiation, antibody therapy, checkpoint inhibitor therapy, and chemotherapy. In some embodiments, the administration of the combination therapy is achieved by electroporation alone. In some embodiments, the administration of the combination therapy is achieved by a combination of electroporation and systemic delivery. In some embodiments, the administration of the combination therapy is achieved by a combination of electroporation and radiation. In some embodiments, the administration of the combination therapy is achieved by a combination of electroporation and oral administration. Therapeutic electroporation may be combined with or administered along with one or more additional therapeutic treatments. The one or more additional therapeutic agents may be delivered by systemic delivery, intratumoral injection, intratumoral injection with electroporation, and / or radiation. The one or more additional therapeutic agents may be administered before, simultaneously with, or after the CXCL9 and / or CD3 half-BiTE electroporation treatment.

[0199] In some embodiments, the methods of treating cancer described include administering IT-EP therapy on days 1, 1 and 5 (±2 days), 1 and 8 (±2 days), or 1, 5 (±2 days) and 8 (±2 days), and administering an additional therapeutic treatment on day 1 of a 3- to 6-week cycle. In some embodiments, the methods of treating cancer described include administering IT-EP therapy on days 1, 1 and 5 (±2 days), 1 and 8 (±2 days), or 1, 5 (±2 days) and 8 (±2 days) of every other cycle (i.e., every 6 weeks), and administering an additional therapeutic treatment on day 1 of every 3-week cycle (i.e., every 3 weeks). In some embodiments, the additional therapeutic treatment comprises a checkpoint inhibitor. In some embodiments, the additional checkpoint inhibitor therapy comprises an anti-PD-1 / anti-PD-L1 therapy. The checkpoint inhibitor therapy may be administered systemically. X. Electroporation (EP) Treatment

[0200] Electroporation therapy involves administering at least one electroporation pulse to a cell, tissue, or tumor. As used herein, electroporation therapy utilizes "reversible electroporation." Reversible electroporation is the reversible or temporary permeabilization of a cell membrane to molecules normally impermeable to the membrane using an electric pulse below the electric field threshold of the target cell. Because the electric pulse is below the cell's electric threshold, the cell is able to repair itself and is not killed by the electric pulse. Reversible electroporation can be used to deliver macromolecules, such as nucleic acids, to cells without killing them. Reversible electroporation is a method of applying an electric pulse to promote cellular uptake of macromolecules, such as nucleic acids. Reversible electroporation has been used in several clinical trials to deliver DNA vaccines and has been shown to dramatically improve gene delivery to cells in vivo (100-1000-fold).

[0201] Electroporation therapy can be performed using known electroporation devices suitable for use in mammalian subjects. The described expression cassettes can be administered to the subject before, during, or after administration of the electrical pulse. The expression cassettes can be administered to the subject at or near a tumor. The described expression cassettes can be injected into the tumor using a hypodermic needle.

[0202] In some embodiments, electroporation treatment involves the administration of one or more voltage pulses. The nature of the electric field generated is determined by the nature of the tissue, the size of the selected tissue, and its location. The voltage pulses that can be delivered to a tumor can be from about 100 V / cm to about 1500 V / cm. In some embodiments, the voltage pulses are from about 700 V / cm to 1500 V / cm. In some embodiments, the voltage pulses can be about 600 V / cm, 650 V / cm, 700 V / cm, 750 V / cm, 800 V / cm, 850 V / cm, 900 V / cm, 950 V / cm, 1000 V / cm, 1050 V / cm, 1100 V / cm, 1150 V / cm, 1200 V / cm, 1250 V / cm, 1300 V / cm, 1350 V / cm, 1400 V / cm, 1450 V / cm, or 1500 V / cm. In some embodiments, the voltage pulse is 700±100. In some embodiments, the voltage pulse is 1300-1500 V / cm. In some embodiments, the voltage pulse is 1500±100 V / cm. In some embodiments, the voltage pulse is about 10 V / cm-700 V / cm. In some embodiments, the voltage pulse is about 100 V / cm, 150 V / cm, 200 V / cm, 250 V / cm, 300 V / cm, 350 V / cm, or 400 V / cm, 450 V / cm, 500 V / cm, 550 V / cm, 600 V / cm, 650 V / cm, or 700 V / cm. In some embodiments, the voltage pulse is about 300 V / cm-500 V / cm. In some embodiments, the voltage pulse is 300-500 V / cm. In some embodiments, the voltage pulse is 350±50 V / cm.

[0203] The pulse duration of the electroporation pulses can be from 10 μsec to 1 second. In some embodiments, the pulse duration is from about 10 μsec to about 100 milliseconds (ms). In some embodiments, the pulse duration is from about 100 μsec to about 10 ms. In some embodiments, the pulse duration is 100 μsec, 1 ms, 5 ms, 10 ms, or 100 ms. The interval between pulse sets can be any desired time, such as 1 second. The waveform, field strength, and pulse duration can also depend on the type of cell and the type of molecule to enter the cell via electroporation.

[0204] The waveform of the electrical signal provided by the pulse generator can be an exponentially decaying pulse, a square pulse, a unipolar oscillating pulse train, a bipolar oscillating pulse train, or any combination of these forms. Square wave electroporation systems deliver controlled electrical pulses that rapidly rise to a set voltage, remain at that level for a set length of time (pulse length), and then rapidly fall to zero.

[0205] Between 1 and 100 pulses can be administered. In some embodiments, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 pulses are administered. In some embodiments, 6 pulses are administered. In some embodiments, 6 x 0.1 msec pulses are administered. In some embodiments, 6 x 0.1 msec pulses are administered at 1300-1500 V / cm. In some embodiments, 8 pulses are administered. In some embodiments, 8 x 10 msec pulses are administered. In some embodiments, 8 x 10 msec pulses are administered at 300-500 V / cm.

[0206] The electroporation device can include a single needle electrode, a pair of needle electrodes, or multiple or an array of needle electrodes. The array of needle electrodes can include three, four, five, six, seven, eight, nine, ten, or more electrodes. In some embodiments, the electroporation device can include a hypodermic needle or equivalent. In some embodiments, the electroporation device can include an electrokinetic device ("EKD device") capable of generating a series of programmable constant current pulse patterns between electrodes in the array based on user control and input of pulse parameters.

[0207] Electroporation devices suitable for use with the described compounds, compositions, and methods include, but are not limited to, those described in U.S. Patent Nos. 7,245,963, 5,439,440, 6,055,453, 6,009,347, 9,020,605, and 9,037,230, and U.S. Patent Application Publication Nos. 2005 / 0052630, 2019 / 0117964, and patent application PCT / US2019 / 030437 and U.S. Patent Application No. 16 / 269,022.

[0208] "Intratumoral electroporation" involves injecting an effective amount of a nucleic acid encoding a therapeutic polypeptide into a tumor, tumor microenvironment, and / or tumor-surrounding tissue, and administering electroporation therapy to the tumor, resulting in delivery of the nucleic acid to tumor cells and expression of the therapeutic polypeptide. The nucleic acid may be, but is not limited to, an expression vector, a plasmid, or mRNA.

[0209] List of embodiments:

[0210] 1. A method of treating cancer in a subject, comprising: (a) administering to a subject at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine; (b) obtaining a tumor sample from the subject; (c) measuring CXCR3 expression in tumor samples; (d) determining whether CXCR3 expression is increased in the tumor sample compared to CXCR3 expression in a given subject; and (e) administering to the subject at least one additional dose of a checkpoint inhibitor and / or an immunostimulatory cytokine if CXCR3 expression in the tumor sample is increased compared to CXCR3 expression in a predetermined control, or administering to the subject at least one pharmaceutically effective dose of a CXCL9 and / or CD3 half-BiTE and at least one additional dose of a checkpoint inhibitor and / or an immunostimulatory cytokine if CXCR3 expression in the tumor sample is not increased compared to CXCR3 expression in a predetermined control.

[0211] 2. The method of embodiment 1, wherein step (a) comprises administering at least one dose of a checkpoint inhibitor, and wherein the checkpoint inhibitor is administered systemically.

[0212] 3. The method of embodiment 2, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody.

[0213] 4. The method of embodiment 3, wherein the checkpoint inhibitor comprises nivolumab, pembrolizumab, pidilizumab, or atezolizumab.

[0214] 5. The method of any one of embodiments 1 to 4, wherein step (a) comprises administering at least one dose of an immunostimulatory cytokine, and wherein the immunostimulatory cytokine is administered by intratumoral electroporation of a nucleic acid encoding the immunostimulatory cytokine.

[0215] 6. The method of embodiment 5, wherein the immunostimulatory cytokine comprises IL-12 or IL-15.

[0216] 7. The method of embodiment 6, wherein the nucleic acid encoding IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, wherein the first nucleic acid sequence and the second nucleic acid sequence are separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

[0217] 8. The method of embodiment 1, wherein step (a) comprises administering at least one dose of a checkpoint inhibitor and at least one dose of an immunostimulatory cytokine, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody administered systemically, and the immunostimulatory cytokine comprises IL-12 administered by intratumoral electroporation of a nucleic acid encoding IL-12.

[0218] 9. The method of any one of embodiments 1 to 8, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 mRNA in the tumor sample.

[0219] 10. The method of embodiment 9, wherein measuring CXCR3 mRNA comprises performing quantitative polymerase chain reaction.

[0220] 11. The method of any one of embodiments 1 to 8, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 protein in the tumor sample.

[0221] 12. Measuring CXCR3 expression in tumor samples is + 9. The method according to any one of embodiments 1 to 8, comprising measuring the number of T cells.

[0222] 13. The method of any one of embodiments 1 to 12, wherein the predetermined control comprises a tumor sample obtained from the subject prior to step (a).

[0223] 14. The method of any one of embodiments 1-12, wherein the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor and / or immunostimulatory cytokine treatment.

[0224] 15. The method of any one of embodiments 1-14, wherein administering at least one pharmaceutically effective dose of CXCL9 and / or CD3 half-BiTE comprises intratumoral electroporation of a nucleic acid encoding a CXCL9 and / or CD3 half-BiTE.

[0225] 16. The method of embodiment 15, wherein the nucleic acid encoding a CXCL9 and / or CD3 half-BiTE further encodes an immunostimulatory cytokine, and the immunostimulatory cytokine comprises IL-12.

[0226] 17. The method of any one of embodiments 1-14, wherein administering at least one additional dose of a checkpoint inhibitor and / or an immunostimulatory cytokine comprises administering at least one additional dose of a checkpoint inhibitor, administering at least one additional dose of an immunostimulatory cytokine, or administering at least one additional dose of a checkpoint inhibitor and an immunostimulatory cytokine.

[0227] 18. The method of embodiment 17, wherein the checkpoint inhibitor comprises a systemically administered anti-PD-1 antibody or anti-PD-L1 antibody.

[0228] 19. The method of embodiment 17, wherein the immunostimulatory cytokine comprises IL-12 administered by intratumoral electroporation of a nucleic acid encoding IL-12.

[0229] 20. The method of embodiment 19, wherein the nucleic acid encoding IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, wherein the first nucleic acid sequence and the second nucleic acid sequence are separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

[0230] 21. The method of any one of embodiments 1-20, wherein the subject is a human.

[0231] 22. A method of treating cancer in a subject, comprising: (a) administering to a subject at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine; (b) measuring the level of CXCR3 in a tumor sample obtained from the subject after administering a checkpoint inhibitor and / or an immunostimulatory cytokine; and (c) administering to the subject at least one pharmaceutically effective dose of CXCL9 and / or CD3 half-BiTE if the level of CXCR3 in the tumor sample is not increased compared to the level of CXCR3 in a predetermined control.

[0232] 23. The method of embodiment 22, wherein step (a) comprises administering at least one dose of a checkpoint inhibitor, and wherein the checkpoint inhibitor is administered systemically.

[0233] 24. The method of embodiment 23, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody.

[0234] 25. The method of embodiment 24, wherein the checkpoint inhibitor comprises nivolumab, pembrolizumab, pidilizumab, or atezolizumab.

[0235] 26. The method of any one of embodiments 22-25, wherein step (a) comprises administering at least one dose of an immunostimulatory cytokine, and wherein the immunostimulatory cytokine is administered by intratumoral electroporation of a nucleic acid encoding the immunostimulatory cytokine.

[0236] 27. The method of embodiment 26, wherein the immunostimulatory cytokine comprises IL-12 or IL-15.

[0237] 28. The method of embodiment 27, wherein the nucleic acid encoding IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, and the first nucleic acid sequence and the second nucleic acid sequence are separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

[0238] 29. The method of embodiment 22, wherein step (a) comprises administering at least one dose of a checkpoint inhibitor and at least one dose of an immunostimulatory cytokine, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody administered systemically, and the immunostimulatory cytokine comprises IL-12 administered by intratumoral electroporation of a nucleic acid encoding IL-12.

[0239] 30. The method of any one of embodiments 22-29, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 mRNA in the tumor sample.

[0240] 31. The method of embodiment 29, wherein measuring CXCR3 mRNA comprises performing quantitative polymerase chain reaction.

[0241] 32. The method of any one of embodiments 22-29, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 protein in the tumor sample.

[0242] 33. Measuring CXCR3 expression in a tumor sample is + 30. The method according to any one of embodiments 22 to 29, comprising measuring the number of T cells.

[0243] 34. The method of any one of embodiments 22 to 33, wherein the predetermined control comprises a tumor sample obtained from the subject prior to step (a).

[0244] 35. The method of any one of embodiments 22-33, wherein the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor and / or immunostimulatory cytokine treatment.

[0245] 36. The method of any one of embodiments 22-35, wherein administering at least one pharmaceutically effective dose of CXCL9 and / or CD3 half-BiTE comprises intratumoral electroporation of a nucleic acid encoding a CXCL9 and / or CD3 half-BiTE.

[0246] 37. The method of embodiment 36, wherein the nucleic acid encoding CXCL9 and / or CD3 half-BiTE further encodes an immunostimulatory cytokine, and the immunostimulatory cytokine comprises IL-12.

[0247] 38. The method of embodiment 22, wherein administering at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine comprises administering at least one dose of a checkpoint inhibitor, administering at least one dose of an immunostimulatory cytokine, or administering at least one dose of a checkpoint inhibitor and an immunostimulatory cytokine.

[0248] 39. The method of embodiment 38, wherein the checkpoint inhibitor comprises a systemically administered anti-PD-1 antibody or anti-PD-L1 antibody.

[0249] 40. The method of embodiment 38, wherein the immunostimulatory cytokine comprises IL-12 administered by intratumoral electroporation of a nucleic acid encoding IL-12.

[0250] 41. The method of embodiment 40, wherein the nucleic acid encoding IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, and the first nucleic acid sequence and the second nucleic acid sequence are separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

[0251] 42. The method of any one of embodiments 22-41, wherein the subject is a human.

[0252] 43. A method for identifying a subject having cancer at risk of not responding to checkpoint inhibitor and / or immune stimulatory cytokine treatment, comprising: measuring the level of CXCR3 in a tumor sample obtained from a subject administered at least one dose of a checkpoint inhibitor and / or an immune stimulatory cytokine; The method, wherein a level of CXCR3 in the tumor sample below a predetermined control indicates that the subject is at risk of not responding to checkpoint inhibitor and / or immune stimulatory cytokine treatment.

[0253] 44. The method of embodiment 43, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody.

[0254] 45. The method of embodiment 44, wherein the checkpoint inhibitor comprises nivolumab, pembrolizumab, pidilizumab, or atezolizumab.

[0255] 46. ​​The method of embodiment 43, wherein the immunostimulatory cytokine comprises IL-12 or IL-15.

[0256] 47. The method of any one of embodiments 43-46, wherein measuring the level of CXCR3 in the tumor sample comprises measuring CXCR3 mRNA in the tumor sample.

[0257] 48. The method of embodiment 47, wherein measuring CXCR3 mRNA comprises performing quantitative polymerase chain reaction.

[0258] 49. The method of any one of embodiments 43-46, wherein measuring the level of CXCR3 in the tumor sample comprises measuring CXCR3 protein in the tumor sample.

[0259] 50. Measuring the level of CXCR3 in a tumor sample is + 47. The method according to any one of embodiments 43 to 46, comprising measuring the number of T cells.

[0260] 51. The method of any one of embodiments 43-50, wherein the predetermined control comprises a tumor sample obtained from the subject before the subject is administered at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine.

[0261] 52. The method of any one of embodiments 43-50, wherein the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor and / or immunostimulatory cytokine treatment.

[0262] 53. The method of any one of embodiments 43-52, wherein the subject is a human.

[0263] 54. A method of treating cancer in a subject, comprising: (a) Determine whether the subject is at risk of not responding to checkpoint inhibitor and / or immune stimulatory cytokine treatment by: (i) administering to a subject at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine; and (ii) measuring the level of CXCR3 in a tumor sample obtained from the subject after administering at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine, Identifying whether a subject is at risk of not responding to checkpoint inhibitor and / or immune stimulatory cytokine treatment, wherein a level of CXCR3 in the tumor sample that is less than a predetermined control indicates that the subject is at risk of not responding to checkpoint inhibitor and / or immune stimulatory cytokine treatment; and (b) administering to a subject identified as being at risk of not responding to checkpoint inhibitor and / or immunostimulatory cytokine treatment at least one pharmaceutically effective dose of a CXCL9 and / or CD-3 half-BiTE.

[0264] 55. The method of embodiment 54, wherein step (a) comprises administering at least one dose of a checkpoint inhibitor, and wherein the checkpoint inhibitor is administered systemically.

[0265] 56. The method of embodiment 55, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody.

[0266] 57. The method of embodiment 56, wherein the checkpoint inhibitor comprises nivolumab, pembrolizumab, pidilizumab, or atezolizumab.

[0267] 58. The method of any one of embodiments 54 to 57, wherein step (a) comprises administering at least one dose of an immunostimulatory cytokine, and the immunostimulatory cytokine is administered by intratumoral electroporation of a nucleic acid encoding the immunostimulatory cytokine.

[0268] 59. The method of embodiment 58, wherein the immunostimulatory cytokine comprises IL-12 or IL-15.

[0269] 60. The method of embodiment 59, wherein the nucleic acid encoding IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, and the first nucleic acid sequence and the second nucleic acid sequence are separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

[0270] 61. The method of embodiment 1, wherein step (a) comprises administering at least one dose of a checkpoint inhibitor and at least one dose of an immunostimulatory cytokine, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody administered systemically, and the immunostimulatory cytokine comprises IL-12 administered by intratumoral electroporation of a nucleic acid encoding IL-12.

[0271] 62. The method of any one of embodiments 54-60, wherein measuring the level of CXCR3 in the tumor sample comprises measuring CXCR3 mRNA in the tumor sample.

[0272] 63. The method of embodiment 62, wherein measuring CXCR3 mRNA comprises performing quantitative polymerase chain reaction.

[0273] 64. The method of any one of embodiments 54-61, wherein measuring the level of CXCR3 in the tumor sample comprises measuring CXCR3 protein in the tumor sample.

[0274] 65. Measuring the level of CXCR3 in a tumor sample is + 62. The method of any one of embodiments 54-61, comprising measuring the number of T cells.

[0275] 66. The method of any one of embodiments 54-65, wherein the predetermined control comprises a tumor sample obtained from the subject prior to administering to the subject at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine.

[0276] 67. The method of any one of embodiments 54-65, wherein the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor and / or immunostimulatory cytokine treatment.

[0277] 68. The method of any one of embodiments 54-67, wherein administering at least one pharmaceutically effective dose of CXCL9 and / or CD3 half-BiTE comprises intratumoral electroporation of a nucleic acid encoding CXCL9 and / or CD3 half-BiTE.

[0278] 69. The method of embodiment 68, wherein the nucleic acid encoding CXCL9 and / or CD3 half-BiTE further encodes an immunostimulatory cytokine, and the immunostimulatory cytokine comprises IL-12.

[0279] 70. The method of embodiments 54-67, wherein administering at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine comprises administering at least one dose of a checkpoint inhibitor, administering at least one dose of an immunostimulatory cytokine, or administering at least one dose of a checkpoint inhibitor and an immunostimulatory cytokine.

[0280] 71. The method of embodiment 70, wherein the checkpoint inhibitor comprises a systemically administered anti-PD-1 antibody or anti-PD-L1 antibody.

[0281] 72. The method of embodiment 70, wherein the immunostimulatory cytokine comprises IL-12 administered by intratumoral electroporation of a nucleic acid encoding IL-12.

[0282] 73. The method of embodiment 72, wherein the nucleic acid encoding IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, and the first nucleic acid sequence and the second nucleic acid sequence are separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

[0283] 74. The method of any one of embodiments 54-73, wherein the subject is a human.

[0284] 75. A method of treating a patient with cancer, comprising: (a) obtaining a tumor sample from a patient; (b) measuring the level of CXCR3 expression in the tumor sample; (c) correlating the level of CXCR3 expression in the tumor sample with reference levels obtained from predetermined controls or standards derived from populations of known responders and / or known non-responders to determine whether the patient is at risk of progression on checkpoint inhibitor treatment; and (d) administering at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine if the expression level is greater than the reference level, or administering to the patient at least one pharmaceutically effective dose of a CXCL9 and / or CD3 half-BiTE and at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine if the expression level is less than the reference level.

[0285] 76. The method of embodiment 75, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 mRNA in the tumor sample.

[0286] 77. The method of embodiment 76, wherein measuring CXCR3 mRNA comprises performing quantitative polymerase chain reaction.

[0287] 78. The method of embodiment 75, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 protein in the tumor sample.

[0288] 79. Measuring CXCR3 expression in a tumor sample is + 76. The method of embodiment 75, comprising measuring the number of T cells.

[0289] 80. The method of any one of embodiments 75-79, wherein administering at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine comprises administering at least one dose of a checkpoint inhibitor, administering at least one dose of an immunostimulatory cytokine, or administering at least one dose of a checkpoint inhibitor and an immunostimulatory cytokine.

[0290] 81. The method of embodiment 80, wherein the checkpoint inhibitor is administered systemically.

[0291] 82. The method of embodiment 81, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody.

[0292] 83. The method of embodiment 82, wherein the checkpoint inhibitor comprises nivolumab, pembrolizumab, pidilizumab, or atezolizumab.

[0293] 84. The method of any one of embodiments 80, wherein administering at least one dose of an immunostimulatory cytokine comprises intratumoral electroporation of a nucleic acid encoding the immunostimulatory cytokine.

[0294] 85. The method of embodiment 84, wherein the immunostimulatory cytokine comprises IL-12 or IL-15.

[0295] 86. The method of embodiment 85, wherein the nucleic acid encoding IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, and the first nucleic acid sequence and the second nucleic acid sequence are separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

[0296] 87. The method of any one of embodiments 75-86, wherein administering at least one pharmaceutically effective dose of CXCL9 and / or CD3 half-BiTE comprises intratumoral electroporation of a nucleic acid encoding CXCL9 and / or CD3 half-BiTE.

[0297] 88. The method of embodiment 87, wherein the nucleic acid encoding CXCL9 and / or CD3 half-BiTE further encodes an immunostimulatory cytokine, and the immunostimulatory cytokine comprises IL-12.

[0298] 89. The method of embodiment 88, wherein IL-12 and CXCL9 and / or CD3 half-BiTE are expressed from a single promoter.

[0299] 90. The method of any one of embodiments 75-89, wherein the subject is a human.

[0300] 91. A nucleic acid encoding IL-12 for use in a method of treating a subject having cancer, the method comprising: (a) administering to a subject at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine; (b) obtaining a tumor sample from the subject; (c) measuring CXCR3 expression in tumor samples; (d) determining whether CXCR3 expression is increased in the tumor sample compared to CXCR3 expression in a given subject; and (e) administering to the subject by intratumoral electroporation at least one dose of a nucleic acid encoding IL-12 if CXCR3 expression in the tumor sample is increased compared to CXCR3 expression in a predetermined control, or administering to the subject by intratumoral electroporation at least one pharmaceutically effective dose of a nucleic acid encoding a CXCL9 and / or a CD3 half-BiTE and at least one dose of a nucleic acid encoding IL-12 if CXCR3 expression in the tumor sample is not increased compared to CXCR3 expression in a predetermined control.

[0301] 92. A method of treating cancer in a subject, comprising: (a) obtaining a tumor sample from a subject; (b) measuring CXCR3 expression in tumor samples; (c) determining whether CXCR3 expression is increased in the tumor sample compared to CXCR3 expression in a given subject; and (d) administering to the subject at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine if CXCR3 expression in the tumor sample is increased compared to CXCR3 expression in a predetermined control, or administering to the subject at least one pharmaceutically effective dose of a CXCL9 and / or CD3 half-BiTE and at least one additional checkpoint inhibitor and / or immunostimulatory cytokine if CXCR3 expression in the tumor sample is not increased compared to CXCR3 expression in a predetermined control.

[0302] 93. The method of embodiment 92, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 mRNA in the tumor sample.

[0303] 94. The method of embodiment 93, wherein measuring CXCR3 mRNA comprises performing quantitative polymerase chain reaction.

[0304] 95. The method of embodiment 92, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 protein in the tumor sample.

[0305] 96. Measuring CXCR3 expression in a tumor sample is + 93. The method of embodiment 92, comprising measuring the number of T cells.

[0306] 97. The method of any one of embodiments 92-96, wherein the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor and / or immunostimulatory cytokine treatment.

[0307] 98. The method of embodiment 97, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody.

[0308] 99. The method of any one of embodiments 92-98, wherein administering at least one dose of a checkpoint inhibitor and / or an immunostimulatory cytokine comprises administering at least one dose of a checkpoint inhibitor, administering at least one dose of an immunostimulatory cytokine, or administering at least one dose of a checkpoint inhibitor and an immunostimulatory cytokine.

[0309] 100. The method of embodiment 99, wherein the checkpoint inhibitor is administered systemically.

[0310] 101. The method of embodiment 100, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody or an anti-PD-L1 antibody.

[0311] 102. The method of embodiment 101, wherein the checkpoint inhibitor comprises nivolumab, pembrolizumab, pidilizumab, or atezolizumab.

[0312] 103. The method of any one of embodiments 99, wherein administering at least one dose of an immunostimulatory cytokine comprises intratumoral electroporation of a nucleic acid encoding the immunostimulatory cytokine.

[0313] 104. The method of embodiment 103, wherein the immunostimulatory cytokine comprises IL-12 or IL-15.

[0314] 105. The method of embodiment 104, wherein the nucleic acid encoding IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, and the first nucleic acid sequence and the second nucleic acid sequence are separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

[0315] 106. The method of any one of embodiments 92-105, wherein administering at least one pharmaceutically effective dose of CXCL9 and / or CD3 half-BiTE comprises intratumoral electroporation of a nucleic acid encoding CXCL9 and / or CD3 half-BiTE.

[0316] 107. The method of embodiment 106, wherein the nucleic acid encoding CXCL9 and / or CD3 half-BiTE further encodes an immunostimulatory cytokine, and the immunostimulatory cytokine comprises IL-12.

[0317] 108. The method of any one of embodiments 92-107-20, wherein the subject is a human.

[0318] 109. A method for identifying a subject having cancer at risk of not responding to checkpoint inhibitor and / or immunostimulatory cytokine treatment, comprising measuring the level of CXCR3 in a tumor sample obtained from the subject, wherein a level of CXCR3 in the tumor sample that is less than a predetermined control indicates that the subject is at risk of not responding to checkpoint inhibitor and / or immunostimulatory cytokine treatment.

[0319] 110. The method of embodiment 109, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 mRNA in the tumor sample.

[0320] 111. The method of embodiment 100, wherein measuring CXCR3 mRNA comprises performing quantitative polymerase chain reaction.

[0321] 112. The method of embodiment 109, wherein measuring CXCR3 expression in the tumor sample comprises measuring CXCR3 protein in the tumor sample.

[0322] 113. Measuring CXCR3 expression in a tumor sample is + 110. The method of embodiment 109, comprising measuring the number of T cells.

[0323] 114. The method of any one of embodiments 102-113, wherein the predetermined control comprises a standard derived from a population of known responders and / or known non-responders to checkpoint inhibitor and / or immunostimulatory cytokine treatment.

[0324] 115. Administration of at least one pharmaceutically effective dose of CXCL9 and / or CD-3 half-BiTE inhibits CXCR3 in tumors. + The method of any one of embodiments 1 to 42, 54 to 114, which results in an increase in the number of T cells. [Table 1-1] [Table 1-2] [Table 1-3] [Table 1-4] [Table 1-5] [Table 1-6] [Table 1-7] [Table 1-8] [Table 1-9] [Table 1-10] [Table 1-11] [Table 1-12] [Table 1-13]

[0325] Although the present invention has been described in detail for clarity of understanding, certain modifications can be practiced within the scope of the appended claims. All publications, accession numbers, websites, patent documents, etc. cited in this application are incorporated herein by reference in their entirety for all purposes to the same extent as if each were individually indicated as such. To the extent different information is associated with citations at different times, the information present as of the effective filing date of this application is meant. Unless otherwise apparent from the context, any element, embodiment, step, feature, or aspect of the present invention can be practiced in combination with any other. [Example]

[0326] CXCL9 Example 1. CXCL9 Plasmid Construction. The murine CXCL9 (mCXCL9) or human CXCL9 (hCXCL9) nucleic acid sequence was cloned into an expression vector using standard molecular biology techniques. Alternatively, mCXCL9 or hCXCL9 was cloned downstream of murine (mIL12-2A) or human (hIL12-2A) IL12 p35-P2A-IL12 p40 to generate mIL12~mCXCL9 and hIL12~hCXCL9 (Figures 1A-B). The IL12 p35-P2A-IL12 p40 constructs were generated essentially as described in WO 2017 / 106795 or WO 2018 / 229696.

[0327] The resulting plasmid contains IL-12 p35, IL-12 p40, and CXCL9, all expressed from the same promoter and contains an intervening exon skipping (P2A) motif, allowing all three proteins to be expressed from a single polycistronic message. A similar method was used to generate mCXCL9-mCherry.

[0328] Example 2. Protein Expression. mIL12-2A, mCXCL9, and the mIL12~mCXCL9 expression vector were transfected into HEK293 cells in vitro. 96 hours after transfection, supernatants were collected, and IL12 and CXCL9 protein expression was assayed by ELISA. The results, shown in Figure 2, demonstrate that cells transfected with the mIL12~mCXCL9 expression vector produced detectable levels of both IL12 and CXCL9, although expression was reduced. Figure 27 shows high levels of secreted hIL12 and hCXCL9 in cells transfected with the hIL-12~hCXCL9 expression vector.

[0329] Similarly, hIL12-2A, hCXCL9, and hIL12~hCXCL9 expression vectors were transfected into HEK293 cells in vitro. Ninety-six hours after transfection, supernatants were collected, and IL12 and CXCL9 protein expression was assayed by ELISA. hIL12 was expressed approximately equally from both the hIL12-2A (1.59 μg / mL) and hIL12~hCXCL9 (1.37 μg / mL) expression vectors (Figure 10A). Compared to cells transfected with the hCXCL9 expression vector (5.19 μg / mL), cells transfected with the hIL12~hCXCL9 expression vector (1.75 μg / mL) showed reduced, but still significant, levels of hCXCL9 (Figure 10B).

[0330] The mIL12 protein produced from the mIL12~mCXCL9 expression vector was further tested for activity. mIL12 produced from cells transfected with mIL12-2A or mIL12~mCXCL9 expression vectors was incubated with HEK-Blue IL-12 cells. HEK-Blue IL-12 cells are used to detect bioactive human and mouse IL-12. HEK-Blue IL-12 cells are used to verify the functionality of recombinant native or engineered human or mouse IL-12. Functional IL-12 binds to the IL-12 receptor in HEK-Blue IL-12 cells, activating the STAT-4 pathway and the STAT4-inducible SEAP reporter gene. SEAP expression is then assayed. The response ratio was calculated by dividing the OD at 630 nm for treated cells by the OD at 630 nm for untreated cells. The results shown in Figure 3 demonstrate that IL-12 produced from either the mIL12-2A or mIL12~mCXCL9 expression vector is functional.

[0331] Similarly, hIL12 protein produced from the hIL12~hCXCL9 expression vector was also tested for activity. hIL12 produced from cells transfected with the hIL12~hCXCL9 expression vector was incubated with HEK-Blue IL-12 cells. The results, shown in Figure 11, demonstrate that IL-12 produced from the hIL12-2A expression vector is functional.

[0332] Example 3. CXCL9-Induced Migration of T Cells In Vitro. Mammalian (HEK293) cells were transfected with a CXCL9 expression vector (CXCL9 or IL12~CXCL9). OT-I mouse splenocytes were pulsed with 1 μg / mL SIINFEKL peptide for 24 hours and then allowed to recover for 72 hours. CXCL9-transfected cells were then assayed for induction of chemotaxis of SIINFEKL-pulsed OT-I splenocytes through a polycarbonate membrane with 5.0 micron pores. The migration index was defined as the number of observed chemotactic cells normalized to the number of cells that passively migrated through the membrane in the OptiMEM negative control. The results are shown in Figures 4A, 4B, and 4C. mCXCL9 produced from the mCXCL9 and mIL12~mCXCL9 expression vectors caused an approximately 7-fold and 3-fold increase in chemotactic cells, respectively. The increase in chemotaxis was inhibited by the addition of a CXCL9-neutralizing antibody, indicating that this effect was dependent on mCXCL9.

[0333] Example 4. In vivo expression of mCXCL9. CT-26 (colon carcinoma) tumors were implanted into mice. Tumors were then treated with IT-EP pUMCV3 control vector or IT-EP mCXCL9 expression vector. 48 hours after IT-EP, tumors were homogenized and assayed for CXCL9 expression by ELISA (DuoSet ELISA DY392; n=3; *P<0.05; T-test with Welch's correction). The results in Figure 5 show that IT-EP-treated tumors expressed CXCL9.

[0334] Example 5. Tumor regression in mice treated with mIL12-2A and mCXCL9. Mice were implanted with tumor cells. Cells were injected subcutaneously into the right and / or left flank of anesthetized mice. The mean tumor volume was approximately 100 mm 3 Tumor growth was monitored by digital caliper measurements until tumor growth reached .

[0335] Tumors were treated with IT-EP target vector or IT-EP IL12-2A expression vector on day 0, and with IT-EP target vector or IT-EP CXCL9 (with mcherry reporting protein, if desired) on days 4 and 7. Tumor volume and survival were monitored. Primary and contralateral tumor volumes were >2000 mm. 3 When the stool was reached, the mice were euthanized.

[0336] The data shown in Figure 6 demonstrate that mice treated with IT-EP mIL12-2A + mCXCL9 therapy exhibited increased survival compared to untreated mice, mice treated with control vehicle, or mice treated with IT-EP mIL12-2A alone. Tumor-bearing mice treated with IT-EP mIL12-2A + mCXCL9 ~ mCherry therapy also exhibited reduced primary (treated) and contralateral (untreated) tumor progression (Figure 7A-B).

[0337] Example 6. IT-EP IL12-2A + IT-EP CXCL9 drives systemic proliferation of antigen-specific CD8 and short-lived effector cells (SLECs). On day -8, mice were implanted with tumors as described above. On day 0, tumors were treated with IT-EP mIL12-2A. On days 4 and 7, mice were treated with control plasmid or mCXCL9 (n=3 / group) with IT-EP as described above. On day 9, spleens were harvested and CD3 + CD8 + Cells were analyzed by FACS. + The fold increase in AH1+CD8+ T cell numbers is shown in Figure 9, indicating that the T cell population was significantly increased in mice treated with IL12-2A+CXCL9.

[0338] Example 7. Intratumoral CXCL9 synergizes with IL-12 to regulate the tumor microenvironment, expand antigen-specific T cells, and control contralateral tumor growth. A mouse model was used to assess intratumoral expression after electroporation.

[0339] CT26 tumors were implanted into mice on day -7. A single tumor model was used for NanoString analysis and flow-based assays. Mice were treated with a suboptimal dose of IL12-2A via IT-EP on day 1, followed by treatment with either 100 μg of mCXCL9 or pUMVC3 via IT-EP on days 4 and 7. Tumor and immune responses were then monitored. For NanoString and flow-based analysis, tumors and splenocytes were harvested 2 days after the final EP (i.e., day 9). Alternatively, tumor volume was measured three times a week for regression / survival studies. Gene expression changes in electroporated CT26 lesions were assessed using NanoString nCounter® technology. Intratumoral expression of mCXCL9 was confirmed using ELISA for mCXCL9 in tumor lysates from CT26 tumor-bearing mice 48 hours after electroporation (n = 3; *P < 0.05; t-test with Welch's correction).

[0340] Volcano plots showing the p-value and log2 fold change for each gene were generated in mice treated with CXCL9 alone or in combination with IL12-2A (Figure 28A). Analysis of cell type scores showed an increase in cytotoxic immune cells in response to treatment with either CXCL9 or IL12-2A. A synergistic increase in cytotoxic immune cell scores was further observed when CXCL9 was administered in combination with IL12-2A. The cell type scores for "cytotoxic immune cells" are shown in Figure 28B.

[0341] Flow cytometry analysis was used to analyze splenocytes from treated mice. Antigen-specific AH1+CD8+ T cells were measured by tetramer analysis (Immudex). Cells were gated on Singlets<Live<CD3+CD4- splenocytes (Figure 8). Fold increase in the number of AH1+CD8+ T cells compared to empty vector control (N = 2 independent experiments using 3 - 5 animals / group; *P<0.05, **P<0.005; one-way ANOVA). In mice treated with only the control plasmid, 0.79% of the AH1 tetramer was CD8+. In mice treated with IT-EP IL12-2A, 1.43% of the AH1 tetramer was CD8+. In mice treated with IT-EP IL12-2A and CXCL9, 3.22% of the AH1 tetramer was CD8+. The fold increase in AH1+CD8+ T cell numbers is shown in Figure 9.

[0342] The results indicate that IT-EP CXCL9 can substantially enhance the anti-tumor immune response in animals previously treated with sub-optimal doses of IT-EP IL12-2A. CD3 half-BiTE

[0343] Example 8. The Half-BiTE expression cassette was prepared in a similar manner as described above for the preparation of the CXCL9 plasmid (Figure 12A and Figure 12B).

[0344] Example 9. Protein expression. HEK293 cells were transfected in vitro with the OKT3 scFv and 2C11 scFv expression vectors. B16-F10 tumor cells were transfected with HA-2C11 scFv and HA-2C11 scFv~mIL12. Twenty-four hours after transfection, the supernatant was collected and the proteins were separated by gel electrophoresis. CD3 scFv, cadherin (membrane protein) and Hsp90 were detected by Western blot analysis. The results shown in Figure 13 indicate that the expression vector expressed the CD3 scFv protein. The CD3 scFv protein was mainly located in the membrane fraction.

[0345] HA-OKT3 scFv and OKT3 scFv~hIL12 expression vectors were transfected into HEK293 cells in vitro. 72 hours after transfection, cells were analyzed by FACS to detect CD3 scFv (Figures 14A-C). HA-2C11 scFv and HA-2C11 scFv~mIL12 expression vectors were transfected into B16-F10 cells. Cells were analyzed by FACS to detect surface expression of CD3 scFv (Figure 14D). Expression of IL12 from IL12-2A and HA-2C11 scFv~mIL12 expression vectors is shown in Figure 14E.

[0346] HA-OKT3 scFv~hIL12 and OKT3 scFv~hIL12 expression vectors were transfected into HEK293 cells in vitro. 72 hours after transfection, cell supernatants were collected and assayed for IL12p70 by ELISA. The results confirm that cells transfected with HA-OKT3 scFv~hIL12 and OKT3 scFv~hIL12 expression vectors express and secrete hIL12p70 (Figure 15).

[0347] In vivo expression: Mice were inoculated with B16F10 melanoma cells or 4T1 breast cancer cells on day -7. On day 0, tumors were treated with IT-EP HA-2C11 scFv~hIL12 (Figure 16). Figures 16A-B show that CD3 half-BiTE is expressed on the surface of melanoma and breast cancer tumors after IT-EP. Figure 16C shows that following IT-EP of HA-OKT3 scFv~hIL12, the expression vector also expresses IL-12.

[0348] Example 10. In vitro functional assay. B16F10 cells were transfected in vitro with a control vector and a 2C11 scFv-expressing vector (with or without recombinant mouse IL12). The transfected B16F10 cells were then cocultured with naive mouse splenocytes for 24, 48, or 72 hours. After coculture, the supernatant was assayed for IFNγ, and cell proliferation was assessed by FACS. Plate-bound anti-CD3 was used as a positive control. The results, shown in Figure 17, demonstrate that IFNγ expression was substantially increased when splenocytes were cocultured with B16F10 expressing 2C11 scFv. FACS analysis was performed to analyze the proliferation of CFSE-labeled CD3+CD45+ T cells after coculture of naive mouse splenocytes with B16F10 cells transfected in vitro with a control vector (Tfx control), a 2C11 scFv expression vector (with or without recombinant mouse IL12), or plate-bound anti-CD3 (positive control) (Figure 18).

[0349] Example 11. In vivo functional assay. On day -9, B16-OVA cells were implanted into mice (n=8 / group). On day 0, tumors were treated with 2C11 scFv expression vector or empty vector (negative control) by IT-EP. On day 0, OT-1(GFP)CD8 +A 1:1 mixture of adoptively transferred T cells and naive mouse lymphocytes was also transplanted into mice. On day 5, the proliferation of adoptively transferred T cells in the spleen and draining lymph nodes (DLN) was examined by FACS. Endogenous T cell populations and SIINFEKL expression in tumor-infiltrating lymphocytes (TIL) were also examined by FACS. Increased polyclonal T cell proliferation in DLN was observed in IT-EP 2C11 scFv-treated mice (Figure 19). Increased OT-1 and polyclonal T cell populations were also observed in splenocytes from IT-EP 2C11 scFv-treated mice. Increased CD8+ T cells in CD45.1+ live cells in TIL were observed in B16-OVA tumor model mice treated with 2C11 scFv IT-EP (Figure 20). An increase in antigen-specific (SIINFEKL+) CD8+ T cells in TILs was observed in B16-OVA tumor model mice treated with 2C11 scFv IT-EP (Figure 21). The results demonstrate that IT-EP with 2C11 leads to the expansion of polyclonal T cells and the enhancement of tumor-specific T cell responses in tumors.

[0350] Example 12. In vivo cytotoxic T cell killing assay. Lymphocytes were collected from naive mice and labeled with CFSE. The labeled lymphocytes were then pulsed with OVA peptide to activate T cells (CFSE hi , treated), or left untreated (CFSE lo , no pulse). CFSE hi and CFSE lo Lymphocytes were combined at approximately a 1:1 ratio for administration to tumor-bearing mice.

[0351] On day -7, mice were implanted with B16-OVA tumor cells (ovalbumin-expressing B16 melanoma cells) into the flanks of C57 / BL / 6 mice. On day 1, mice were treated with IT-EP anti-2C11 scFv or empty vector (pUMVC3). On day 2, mice were administered pulsed target cells (cells pulsed with 2 μg / ml SIINFEKL peptide labeled with 1 μM CFSE (5(6)-carboxyfluorescein N-hydroxysuccinimidyl ester)) or unpulsed cells by adoptive transfer. 18 hours after adoptive transfer, spleens and draining lymph nodes were harvested and analyzed.

[0352] Western blot analysis showed that the tumors expressed CD3 half-BiTE. On day 3, 18 hours after adoptive transfer, DLNs were isolated. Then, CFSE was detected. lo and CFSE hi DLNs were analyzed by FACS for the presence of CFSE cells. The results, shown in Figure 22, hi There was a substantial reduction in the number of cells, indicating antigen-specific killing of cells presenting the OVA peptide. The reduction was quantified using the following formula:

number

[0353] IT-EP of CD3 half-BiTE resulted in increased targeting of tumor cells by T cells. Flow cytometry analysis of cells from the spleen and draining lymph nodes demonstrated significant antigen-specific killing in the IT-EP anti-CD3(2C11) group (Figures 23 and 26).

[0354] Example 13. Tumor regression.

[0355] A. Melanoma: On day -7, mice were implanted with B16 melanoma cells. On day 0, mice were treated with IT-EP using a control empty vector, an expression vector encoding IL12-2A. On days 4 and 7, mice were treated with IT-EP control vector or IT-EP 2C11 (CD3 half-BiTE) expression vector. Tumor progression was monitored every 3 days. Results show improved contralateral (untreated) tumor regression in mice treated with IL12-2A + CD3 half-BiTE compared to treatment with IL12-2A alone (Figures 25A and 25B).

[0356] B. Breast cancer: Mice were implanted with 4T1 breast cancer cells on day -7. On day 0, mice were treated with IT-EP with a control vector or IT-EP IL12-2A. On days 4 and 7, mice were treated with IT-EP with a control vector or IT-EP 2C11 (CD3 half-BiTE)-expressing vector. Tumor progression was monitored every 3 days. The results show that combining IT-EP IL12-2A with CD3 half-BiTE treatment improved breast cancer tumor regression (Figure 26A). IL12-2A + CD3 half-BiTE treatment was also effective in treating lung metastatic nodules in 4T1 breast cancer model mice (Figure 26B). The absolute number of effector T cells (CD127-CD62L-CD3+) per μL of peripheral blood in 4T1 breast cancer model mice is shown in Figure 26C. CXCL9 / CD3 half-BiTE combination therapy

[0357] Example 14. CXCL9 + CD3 half-BiTE Combination Treatment. B16.F10 tumor-bearing mice were treated with IT-EP (days 1, 5, and 8) with 10 μg of IL-12 expression plasmid, 100 μg of IL-12 expression plasmid, or 100 μg of IL-12~CXCL9 / CD3 half-BiTE~IL12. For IL-12~CXCL9 / CD3 half-BiTE~IL12, either IL-12~CXCL9 or CD3 half-BiTE~IL12 was administered on each of days 1, 5, and 8, provided subjects received at least one IT-EP treatment with IL-12~CXCL9 and one IT-EP treatment with CD3 half-BiTE~IL12. Intratumoral expression of IL-12 was confirmed in tumor lysates (ELISA) 48 hours after IT-EP (n=8 animals). IL12p70 expression is shown in Figure 29A. Growth of primary (electroporated lesion) and contralateral (non-electroporated lesion) B16.F10 lesions was measured 12 days after IT-EP treatment (Figure 29B-C). Regarding IL12p70 expression, animals treated with IT-EP plus 10 μg of IL12-2A expressed the same amount of IL12 as animals treated with 100 μg of IL-12~CXCL9 / CD3 half-BiTE~IL12 (Figure 29A). Contralateral tumors were significantly smaller in IL-12~CXCL9 / CD3 half-BiTE~IL12-treated animals compared with 10 μg of IL12-2A-treated mice (8–10 animals / group; statistical significance determined using two-way ANOVA *p<0.05), demonstrating enhanced tumor regression with IT-EP plus IL-12~CXCL9 / CD3 half-BiTE~IL12 treatment. CLTA-4 scFv

[0358] Example 15. Intratumoral expression of anti-CTLA4 scFv. Mouse IgG1 ELISA (ab133045) was performed on RENCA tumor lysates to quantify intratumoral expression of anti-CTLA4 scFv. Expression of anti-CTLA4 scFv was detected only in the tumor, not in serum, highlighting the local expression of the antibody upon intratumoral electroporation.

[0359] The plasmid encoded an anti-CTLA4 scFv that bound to recombinant CTLA4 protein. Transfection-derived secreted anti-CTLA4 (scFv) was evaluated for its binding ability to CTLA-4. Recombinant mouse CTLA-4 / human IgG1 chimera (R&D Systems) was immobilized on a 96-well plate (1 or 5 μg / mL, or 50 μg / well or 250 μg / well) for 18 hours at room temperature. The wells were washed three times with 0.1% Tween® in PBS and blocked with 1% BSA in PBS. Conditioned medium from HEK293 cells transfected with 9H10-scFv (168 ng / mL) or 9D9-scFv (130 ng / mL) was added to the wells and incubated for 2 hours at room temperature. Wells were washed three times, and anti-mouse IgG horseradish peroxidase (Jackson ImmunoResearch, 0.2 μg / mL) was added and incubated for 1.5 hours at room temperature. Wells were washed three times again, developed with HRP substrate reagent (R&D Systems), and stopped with stop solution, 2N sulfuric acid (R&D Systems). The optical density of each well was measured at 450 nm. A graphical representation of the mean OD values ​​for each condition is shown (Figure 30A), demonstrating binding of the plasmid-derived anti-CTLA4 scFv to recombinant CTLA4 protein.

[0360] Mouse IgG1 ELISA (ab133045) was performed on RENCA tumor lysates to quantify intratumoral expression of anti-CTLA4 scFv. Expression of anti-CTLA4 scFv was detected in the tumor (Figure 30B). Statistically significant levels of anti-CTLA4 scFv were not observed in serum, indicating local expression of the antibody upon intratumoral electroporation.

[0361] It will be understood that the present invention has been described above by way of example only. The examples are not intended to limit the scope of the invention. Various modifications and embodiments can be made without departing from the scope and spirit of the invention, which is defined solely by the claims that follow. CXCR3 expression

[0362] Example 16. Intratumoral levels of CXCR3 predict response to anti-PD-1 / anti-PD-L1 therapy. Clinical and preclinical studies have demonstrated that plasmid IL-12 delivered into tumors via electroporation drives IFN-γ expression, leading to T cell proliferation and recruitment of T cells to the tumor microenvironment. This recruitment results in a sustained systemic T cell response. Analysis of biomarker data from patients receiving IL-12 / anti-PD-1 combination therapy shows that clinical response correlates with intratumoral CXCR3 levels. Although all patients had similar frequencies of activated CD8+ T cells in the periphery, responding patients had a significant increase in intratumoral CXCR3 transcripts after treatment (p=0.03) compared with non-responding patients (p=0.4). Thus, tumor-infiltrating CXCR3 + The presence of immune cells can be used as a biomarker for clinical response.

[0363] Intratumoral electroporation of CXCL9 induces CXCR3 expression in tumors. + CD8 + The CXCL9 gradient results in efficient trafficking of tumor-infiltrating tumor-reactive CXCR3 T cells. + T cell frequencies can be productively regulated.

[0364] As described above, intratumoral electroporation of plasmid IL-12 and CXCL9 elicits robust antitumor immune responses evidenced by an increase in systemic antigen-specific CD8+ T cells and improved regression of both treated and contralateral tumors.

[0365] Example 17. Clinical response to combination therapy of IL-12 IT-EP and pembrolizumab. Patients were treated with 0.5 mg / ml IT-EP IL-12 on days 1, 5, and 8 every 6 weeks for 27 weeks at accessible lesions, and with 200 mg of IV pembrolizumab on day 1 of each 3-week cycle (Figure 31). Nucleic acid encoding IL-12 was injected at a minimum dose volume of 0.1 mL at a dose volume of approximately 1 / 4 of the calculated lesion volume. Electroporation was administered using an applicator with a hexagonal array of 6 microneedles. The microneedles were placed in and around the injected tumor, and the tips were co-localized at the site and depth of plasmid injection. Six pulses with an electric field strength of 1500 V / cm and a pulse width of 100 μs were applied at 300 ms intervals.

[0366] Proliferation Ki-67 after treatment + CD8 + An increase in T cells was observed in both responders and non-responders. Ki-67 + CD8+ T cells were analyzed by flow cytometry (gating strategy Singlets<Live<CD3<CD8) before treatment (pre-treatment) and after treatment cycle 2 (post-treatment) in both responder and non-responder patients (n = 6 / group) (Figure 32). In contrast, an increase in intratumoral CXCR3 transcript levels was observed only in responders (n = 5 for responders, n = 8 for non-responders) (Figure 33).

[0367] Example 18. Anti-CXCR3 antibody inhibits tumor regression mediated by pIL12 IT-EP treatment. IT-EP IL-12 (TAVO(P2A)) resulted in an increase in CXCR3 + lymphocytes in draining lymph nodes. CT26 tumors were transplanted into the flanks of mice. After tumor development, mice were treated with either 50 μg of IL-12 (TAVO(P2A)) or 50 μg of control (empty) vector (EV) by IT-EP. Twenty-four hours later, PBMC were obtained from the mice and analyzed by flow cytometry (gating strategy Live<singlets<CD45 + CD3 + <CD8 +CD4 - , MFI = mean fluorescence intensity) for CD8+CXCR3+ T cells (Figure 34).

[0368] After 96 hours, cells were obtained from the draining lymph nodes (DLN) and analyzed for CXCL9-induced chemotaxis (Figure 35). DLN-derived cells were placed in an upper chamber separated from the lower chamber by a polycarbonate membrane (Costar 3421) with 5.0 micron pores. The lower chamber contained conditioned medium from HEK cells transfected with a plasmid expressing CXCL9. The number of chemotactic cells observed was measured after 2 hours at 37°C. Cells from the DLN of mice treated with IT-EP TAVO (P2A) showed increased migration compared to cells from the DLN of mice treated with empty vector. Preincubation of cells with an anti-CXCR3 monoclonal antibody (BioXCell BE0249) abolished chemotaxis, indicating that the increased chemotaxis was due to CXC3R. + This was shown to be the result of an increase in cells.

[0369] CXCR3 depletion resulted in a complete loss of IL-12 response. CT26 contralateral tumor models were treated with IT-EP IL-12 with or without concomitant anti-CXCR3 antibody treatment. Growth of primary (electroporated) and untreated (contralateral) tumors after IT-EP with empty vector, TAVO(P2A), or TAVO(P2A) + anti-CXCR3 was analyzed. Contralateral tumor growth was inhibited in mice treated with IT-EP IL-12 (TAVO(P2A)). This inhibition was blocked by anti-CXCR3 antibody (Figure 36).

[0370] Furthermore, mice treated with IT-EP IL-12 showed a significant survival benefit, which was also blocked by anti-CXCR3 antibodies (Figure 37).

[0371] Example 19. Intratumoral electroporation of IL-12 + CXCL9 enhanced the antitumor effect of IT-EP IL-12. CT26 contralateral tumor mouse models were treated with IT-EP IL-12 using either 2 μg (low dose) or 50 μg of empty vector or IL-12 (TAVO(P2A)). 24 hours later, tumor-resident CD8 + T cells were isolated and stained for intracellular IFN-γ expression. + Intratumoral IFN-γ expression by T cells was similar regardless of IL-12 dose, indicating that low doses (2 μg) of IL-12 are immunologically active (FIG. 38).

[0372] Mice were then treated with IT-EP empty vector, IT-EP IL-12(TAVO(P2A)) + IT-EP empty vector, or IT-EP IL-12(TAVO(P2A)) + IT-EP CXCL9 (plasmid-expressing CXCL9), as shown in Table 2. [Table 2]

[0373] Spleens and treated tumors were harvested on day 10 and analyzed by NanoString and flow cytometry. Gene expression changes in electroporated tumors were analyzed by NanoString nCounter technology (Mouse PanCancer io360 panel) using pathway scores. Pathway scores followed the assumptions of equal variance and normal distribution of t-scores. A standard one-way ANOVA was used to calculate significance compared to the empty vector-treated group (n = 4 / group). Transcriptome analysis of the tumor microenvironment revealed enrichment for genes associated with immune-related pathways (IFNγ signaling, interleukin signaling, GPCR signaling), antigen presentation mechanisms, and TCR signaling, indicating that this combination treatment enhanced antitumor immunity (Figure 39).

[0374] Antigen-specific CD8 T cells (AH1 + CD8 +) were enriched in mice treated with IT-EP IL-12 + IT-EP CXCL9 when compared with IT-EP IL-12 alone or empty vector (gating strategy SSC <Live<Singlets<CD4 - splenocytes).

[0375] AH1 was significantly increased in IT-EP IL-12-treated and IT-EP IL-12+CXCL9-treated mice compared with empty vector control-treated mice. + CD8 + A significant increase in the percentage of T cells was observed.

[0376] Example 20. IT-EP CXCL9 enhances IT-EP IL-12-mediated abscopal antitumor responses. Mice bearing tumors implanted in both the left and right flanks (contralateral tumor model) were treated as shown in Table 2. Treatment was administered to only one tumor. Tumor volumes were measured three times weekly for regression and survival studies. Growth of treated (left panel) and untreated tumors showed that sequential treatment with IT-EP IL-12 and IT-EP CXCL9 therapy resulted in improved tumor regression and survival in both treated and untreated tumors (contralateral) (Figure 41).

[0377] Mice were treated with IT-EP IL-12+CXCL9 using plasmids expressing IL-12 p35, IL-12 p40, and CXCL9 from a single CMV promoter. CXCR3 expression was measured on tumor-derived CD8+ cells harvested 24 hours after IT-EP treatment with empty vector TAVO(P2A) or TAVO(P2A)-CXCL9. + The frequency of expression and mean fluorescence intensity were measured in CD8+ cells after IT-EP of IL-12 or IL-12+CXCL9. + CXCR3 + The increase in cells was observed (Figure 43).

[0378] CT26 tumor cells were implanted into the left and right flanks of mice on day -7. Tumor-implanted mice were then treated on one side of the tumor with either IT-EP empty vector (group 1), IT-EP IL-12 (TAVO(P2A); group 2), or IT-EP IL-12-CXCL9 (TAVO(P2A)-CXCL9; group 3) on days 1, 5, and 8. Plasmid doses were normalized to the amount of IL-12 produced in mice treated with the TAVO(P2A)-CXCL9 plasmid, as determined by ELISA. Twelve days after treatment, contralateral tumors from the IT-EP IL-12-CXCL9 group were significantly smaller (Figure 44). Mice treated with IT-EP IL-12-CXCL9 also demonstrated a survival advantage (Figure 45).

[0379] Example 21. Intratumoral electroporation of IL-12 and CXCL9 improves anti-PD-1 therapy. CT-26 tumor cells were implanted into the left and right flanks of mice. Mice were then treated according to the schedule in Table 3. Tumor volumes were measured three times a week for regression and survival studies (Figure 46). [Table 3]

[0380] IT-EP CXCL9, when combined with IT-EP IL12, inhibits antigen-specific CD8 + Cytotoxic T lymphocytes (AH1 + CD8 + ) production, enhanced abscopal response to IL-12 treatment, and improved anti-PD-1 antitumor responses. Without wishing to be bound by theory, IL-12 mediates the activation of CXCR3 + It can increase T cell activation and / or proliferation. + T cells are recruited to tumors by the CXCR3 chemokine activity of CXCL9.

[0381] Example 22. IT-EP CD3 half-BiTE inhibits CXCR3 in tumors +Biomarker data identified non-tumor-reactive TILs that, when mobilized, could increase clinical immunotherapy responses. CD3 half-BiTE expression on neoplastic and stromal cells enhances CD3 + Activating TILs and promoting their proliferation and enhanced cytotoxicity. Naive T cells, Treg cells, and exhausted T cells (subsets not typically associated with robust anti-tumor responses) exhibited enhanced effector function (IFNγ and granzyme B release) upon engagement of CD3 half-BiTE and IL-12 (Figures 47-48).

[0382] The combination of IL-12 and CD3 half-BiTE enhanced T cell proliferation regardless of their affinity for their cognate peptide:MHC, suggesting a T cell receptor-independent mechanism. Thus, IT-EP IL-12+CD3 half-BiTE can recruit a broad subset of T cells.

[0383] Using immune profiling of the tumor microenvironment (TME), IT-EP CD3 half-BiTE was shown to inhibit CXCR3 + CD8 + We found that CD3 half-BiTE significantly upregulated the frequencies of T cells and short-lived effector T cells. We further demonstrate that CD3 half-BiTE engagement in the presence of IL-12 enabled functional restoration of TILs in melanoma patients with active clinical progression on anti-PD-1 therapy (Figure 49).

[0384] 4T1 tumors were treated with IT-EP using 50 μg of empty vector (EV) or IL-12 (TAVO(P2A)) on day 0, followed by IT-EP using 50 μg of EV or CD3 half-BiTE on days 3 and 5: (A) tumor volume, (B) spontaneous metastatic lung module, (C) CD3 + CD8 + T cells, (D)CD8 + CXCR3 + T cells, (E)CD45 + CD3 +T cells, (F) effector T cells, and (G) effector memory T cells. T cell populations were measured 6 days after IT-EP treatment.

[0385] TILs isolated from patients actively progressing on anti-PD-1 therapy were cocultured for 3 days with HEK293T cells transfected with empty vector or CD3 half-BiTE (with or without IL-12). TILs cultured with plate-bound anti-human CD3 were used as a positive control. The percentages of CD8+ T cells, PD-1+ CD8+ T cells, and IFNγ expression levels were higher in TILs incubated with CD3 half-BiTE-transfected HEK293T cells, indicating that TILs from patients progressing on anti-PD-1 therapy regain immune function in response to CD3 half-BiTE (Figure 50).

[0386] IT-EP CD3 half-BiTE or IT-EP IL-12~CD3 half-BiTE can increase the numbers of effector T cells, effector memory T cells, and activated T cells in peripheral blood, increase antigen-specific cytotoxicity, reduce metastatic tumor burden, and restore the functional activity of TILs in patients progressing on checkpoint inhibitor therapy.

Claims

1. A pharmaceutical composition for use in a method of treating cancer in a subject, comprising a nucleic acid encoding a CXCL9 and / or CD3 half-BiTE, and a pharmaceutically acceptable carrier, the subject has previously been systemically administered at least one dose of a checkpoint inhibitor and / or at least one dose of an immune stimulatory cytokine, and CXCR3 expression in a tumor sample obtained from the subject is not increased compared to CXCR3 expression in a predetermined control; the method comprising administering to the subject at least one pharmaceutically effective dose of the pharmaceutical composition and at least one additional dose of the checkpoint inhibitor and / or at least one additional dose of the immunostimulatory cytokine; The checkpoint inhibitor comprises an anti-PD-1 antibody, an anti-PD-L1 antibody, nivolumab, pembrolizumab, pidilizumab, or atezolizumab; Pharmaceutical compositions.

2. A pharmaceutical composition for use in the method of claim 1, wherein the method comprises: (a) measuring CXCR3 expression in a tumor sample obtained from said subject who has previously been treated with at least one dose of a checkpoint inhibitor and / or at least one dose of an immunostimulatory cytokine; (b) determining whether CXCR3 expression is increased in the tumor sample compared to CXCR3 expression in a predetermined control; and (c) administering to the subject at least one additional dose of the checkpoint inhibitor and / or at least one additional dose of the immunostimulatory cytokine if CXCR3 expression in the tumor sample is increased compared to CXCR3 expression in the predetermined control, or administering to the subject at least one pharmaceutically effective dose of the pharmaceutical composition and at least one additional dose of the checkpoint inhibitor and / or at least one additional dose of the immunostimulatory cytokine if CXCR3 expression in the tumor sample is not increased compared to CXCR3 expression in the predetermined control.

3. 10. The pharmaceutical composition for use in the method of claim 1, wherein the subject has previously been treated with at least one systemic dose of the checkpoint inhibitor.

4. 10. The pharmaceutical composition for use in the method of claim 1, wherein the subject has previously been treated with at least one dose of the immunostimulatory cytokine, wherein the immunostimulatory cytokine was administered by intratumoral electroporation of a nucleic acid encoding the immunostimulatory cytokine.

5. The pharmaceutical composition for use in the method of claim 4, wherein the immunostimulatory cytokine comprises IL-12 or IL-15.

6. 6. The pharmaceutical composition for use in the method of claim 5, wherein the nucleic acid encoding IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, the first nucleic acid sequence and the second nucleic acid sequence being separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

7. measuring CXCR3 expression in the tumor sample; (a) measuring CXCR3 mRNA in said tumor sample; (b) measuring CXCR3 protein in said tumor sample; or (c) measuring the number of CXCR3+ T cells in the tumor sample; 3. A pharmaceutical composition for use in the method of claim 2 comprising:

8. The predetermined control is (a) a tumor sample obtained from the subject prior to step (a); or (b) standards derived from populations of known responders and / or known non-responders to checkpoint inhibitor and / or immune stimulatory cytokine treatment; 3. A pharmaceutical composition for use in the method of claim 2 comprising:

9. 10. The pharmaceutical composition for use in the method of claim 1, wherein administering at least one pharmaceutically effective dose of said pharmaceutical composition comprises intratumoral electroporation of one or more nucleic acids encoding one or more of CXCL9, a CD3 half-BiTE, CXCL9 and IL-12, or a CD3 half-BiTE and IL-12.

10. 10. The method of claim 1, wherein administering at least one additional dose of the checkpoint inhibitor and / or the at least one additional dose of the immunostimulatory cytokine comprises administering at least one additional dose of an anti-PD-1 antibody or an anti-PD-L1 antibody by systemic administration, administering at least one additional dose of a nucleic acid encoding IL-12 by intratumoral electroporation, or administering at least one additional dose of an anti-PD-1 antibody or an anti-PD-L1 antibody by systemic administration and administering at least one additional dose of a nucleic acid encoding IL-12 by intratumoral electroporation.

11. 11. The pharmaceutical composition for use in the method of claim 10, wherein the nucleic acid encoding the IL-12 comprises a first nucleic acid sequence encoding an IL-12 p35 subunit and a second nucleic acid sequence encoding an IL-12 p40 subunit, the first nucleic acid sequence and the second nucleic acid sequence being separated by an internal ribosome entry site (IRES) or a 2A translational modification element.

12. 2. The pharmaceutical composition for use in the method of claim 1, wherein the cancer is melanoma, basal cell carcinoma, breast cancer, ER-positive breast cancer, ER-negative breast cancer, triple-negative breast cancer, or head and neck cancer.

13. 10. The pharmaceutical composition for use in the method of claim 9, wherein the one or more nucleic acids encoding one or more of CXCL9, a CD3 half-BiTE, CXCL9 and IL-12, and / or a CD3 half-BiTE and IL-12 are administered on days 1, 5, and 8 of at least one three-weekly or six-weekly cycle.

14. 14. The pharmaceutical composition for use in the method of claim 13, wherein the checkpoint inhibitor is administered on day 1 of at least one three-week cycle.

15. Administering at least one pharmaceutically effective dose of the pharmaceutical composition is effective to inhibit CXCR3 in the tumor. ＋ A pharmaceutical composition for use in the method of any one of claims 1 to 14, which results in an increase in the number of T cells.

Images