Combination therapies for the treatment of cancer

Abstract

Provided is combination therapies that involve a construct has a TIGIT-binding moiety and a PVRIG-binding moiety and a KRAS G12C inhibitor for treating cancer with KRAS G12C mutations. In some cases, the construct is a multispecific antibody or a bispecific antibody that recognizes PVRIG and TIGIT.

Description

COMBINATION THERAPIES FOR THE TREATMENT OF CANCER

[0001] This application claims the benefit of PCT Application No. PCT / CN2023 / 106333, filed July 07, 2023, which is hereby incorporated by reference in its entirety.FIELD OF THE INVENTION

[0002] The present application relates to combination therapies for treating cancers with a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and a KRAS G12C inhibitor.BACKGROUND OF THE INVENTION

[0003] The tumor immune microenvironment is a critical component of a patient’s response to immunotherapy. The same treatment can elicit varied responses, from minimal to no clinical benefit to pronounced clinical response. One factor in therapeutic response is T cell exhaustion. In the tumor microenvironment, persisting antigenic stimulation can result in T cell exhaustion, a state of T cell dysfunction, and high expression of co-inhibitory receptors including PD-1, LAG-3, TIM3, and TIGIT.

[0004] TIGIT (T cell immune receptor with Ig and ITIM domains) , also known as Vstm3 and WUCAM, is a co-inhibitory receptor that is expressed on NK and CD8+ T cells, as well as a subset CD4+ T cells including immunosuppressive regulatory T cells (Tregs) [1-4] . There are four known ligands of TIGIT, poliovirus receptor (PVR) , PVRL2, PVRL3 and PVRL4, all of which are over-expressed by tumors and antigen-presenting cells, resulting in immune suppression [3, 5-8] . These ligands also bind the co-stimulatory molecule CD226 and the co-inhibitory molecule PVRIG and CD96 (the latter of which is sometimes considered co-stimulator) . Antagonistic antibodies of TIGIT disrupt binding of TIGIT to its ligands and block its inhibitory signals, shifting the balance in favor of CD226-mediated activating signals, which induces a strong anti-tumor immune response [9-11] . TIGIT is upregulated and identified as an exhaustion marker in cancer and inflammatory diseases [12-14] as other exhaustion markers like PD-1, LAG3 and TIM3 [15, 16] . Moreover, TIGIT is identified as a key inhibitory receptor of a new population of T cells, stem-like memory T cells, that may be the preferred targets for anti-PD- (L) 1 efficacy [17, 18] .

[0005] Poliovirus receptor-related Ig domain containing (PVRIG, a. k. a. CD112R) is one of the co-inhibitory immune-checkpoint proteins. It plays an important role in reversion of T cell exhaustion and increasing NK cell activation [19-22] . PVRIG belongs to the nectin and nectin-like family, among which the family members also includes TIGIT, DNAM-1 (CD226) and CD96. PVRIG is expressed on NK and T cells and is further up-regulated in T cells upon activation [19, 20] . The interaction of PVRIG and its ligand PVRL2 (CD112) expressed on APC and multiple tumor cells results in suppression of T cell and NK cell activation [21, 22] . PVRL2 is also a ligand for CD226, which upon ligand interaction activates human T and NK cells [23-25] . Though PVRIG and TIGIT have many similarities, scientists have reported distinct differences that indicate the pathways are non-redundant [20, 22] .

[0006] KRAS is a key regulator of cytokines that shape the tumor microenvironment. KRAS mutations play a role in many cancers. The KRAS G12C mutation, for example, accounts for about 44%of all KRAS mutations. G12C is a single point mutation with a glycine-to-cysteine substitution at codon 12 of the KRAS protein that favors the active, GTP-bound conformation. This promotes constitutive activation of the signaling pathways that lead to oncogenesis.

[0007] All references cited herein, including patent applications, patent publications, and UniProtKB / Swiss-Prot Accession numbers are herein incorporated by reference in their entirety, as if each individual reference were specifically and individually indicated to be incorporated by reference.SUMMARY OF THE INVENTION

[0008] The present application in one aspect provides a method of treating cancer in an individual, comprising administering to the individual 1) an effective amount of a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) an effective amount of KRAS G12C inhibitor.

[0009] In some embodiments, the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2 or  an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 6, optionally wherein the substitution is a conservative substitution. In some embodiments, the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6.

[0010] In some embodiments according to any of the methods described above, the PVRIG-binding moiety comprises an antibody moiety comprising a VH comprising a HCDR1, a HCDR2, and a HCDR3, and a VL comprising a LCDR1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 12, optionally wherein the substitution is a conserved substitution. In some embodiments, the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino  acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12.

[0011] In some embodiments according to any of the methods described above, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format.

[0012] In some embodiments according to any of the methods described above, the VH of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 13, and / or the VL of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 14 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 14.

[0013] In some embodiments according to any of the methods described above, the VH of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 15 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 15, and / or the VL of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 16.

[0014] In some embodiments according to any of the methods described above, wherein the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life.

[0015] In some embodiments according to any of the methods described above, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the  PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region.

[0016] In some embodiments according to any of the methods described above, the construct comprises one, two or more TIGIT-binding moieties, as well as one, two or more PVRIG-binding moieties.

[0017] In some embodiments according to any of the methods described above, the construct comprises TIGIT-binding moieties that are identical or different, and / or the PVRIG-binding moieties that are identical or different.

[0018] In some embodiments according to any of the methods described above, the construct comprises (i) a first and a second heavy chain that comprise SEQ ID NO: 17, and a first and a second light chain that comprise SEQ ID NO: 18; or (ii) a first and a second heavy chain that comprise SEQ ID NO: 19, and a first and a second light chain that comprise SEQ ID NO: 20.

[0019] In some embodiments according to any of the methods described above, the construct comprises two heavy chains and two light chains, wherein the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format, and wherein from N-terminus to C-terminus: the first and second heavy chains each comprises domains that are operably linked into the following format: VH1-CH1-Fc-scFv or scFv-VH1-CH1-Fc, the first and second light chains each comprises domains that are operably linked into the following format: VL1-CL, wherein the VH1-CH1 and VL1-CL are from the TIGIT-binding moiety and the scFv is from the PVRIG-binding moiety.

[0020] In some embodiments according to any of the methods described above, the construct comprises two heavy chains and two light chains, wherein the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format, and wherein from N-terminus to C-terminus: the first and second heavy chains each comprises domains that are operably linked into the following format: scFv-VH2-CH1-Fc or VH2-CH1-Fc-scFv, the first and second light chains each comprises domains that are operably linked into the following format: VL2-CL, wherein the scFv is from the TIGIT-binding moiety and the VH2-CH1 and VL2-CL are from the PVRIG-binding moiety.

[0021] In some embodiments according to any of the methods described above, the construct comprises two heavy chains and four light chains, wherein the TIGIT-binding moiety and the  PVRIG-binding moiety are in Fab format, and wherein from N-terminus to C-terminus: the first and second heavy chains each comprises domains that are operably linked into the following format: VH1-CH1-Fc-VH2-CH1, VH2-CH1-Fc-VH1-CH1, VH1-CH1-VH2-CH1-Fc or VH2-CH1-VH1-CH1-Fc, the first and second light chains each comprises domains that are operably linked into the following format: VL1-CL, the third and fourth light chains each comprises domains that are operably linked into the following format: VL2-CL, wherein the VH1-CH1 and VL1-CL are from the TIGIT-binding moiety and the VH2-CH1 and VL2-CL are from the PVRIG-binding moiety.

[0022] In some embodiments according to any of the methods described above, the construct comprises two heavy chains and four light chains, wherein the TIGIT-binding, construct comprises two heavy chains and four light chains, wherein the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format, and wherein from N-terminus to C-terminus: the first and second heavy chains each comprises domains that are operably linked into the following format: VH1-C1-Fc-VH2-CH1, VH2-CH1-Fc-VH1-C1, VH1-C1-VH2-CH1-Fc or VH2-CH1-VH1-C1-Fc, the first and second light chains each comprises domains that are operably linked into the following format: VL1-C2, the third and fourth light chains each comprises domains that are operably linked into the following format: VL2-CL, wherein the VH1-C1 and VL1-C2 are from the TIGIT-binding moiety and the VH2-CH1 and VL2-CL are from the PVRIG-binding moiety.

[0023] In some embodiments according to any of the methods described above, the construct comprises two heavy chains and four light chains, wherein the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format, and wherein from N-terminus to C-terminus: the first and second heavy chains each comprises domains that are operably linked into the following format: VH1-CH1-Fc-VH2-C1, VH2-C1-Fc-VH1-CH1, VH1-CH1-VH2-C1-Fc or VH2-C1-VH1-CH1-Fc, the first and second light chains each comprises domains that are operably linked into the following format: VL1-CL, the third and fourth light chains each comprises domains that are operably linked into the following format: VL2-C2, wherein the VH1-CH1 and VL1-CL are from the TIGIT-binding moiety and the VH2-C1 and VL2-C2 are from the PVRIG-binding moiety.

[0024] In some embodiments according to some of the methods described above, the scFv comprises a VH region operably linked to a VL region, and the VH region is at the N terminal of the VL region or the VL region is at the N terminal of the VH region.

[0025] In some embodiments according to any of the methods described above, the KRAS G12C inhibitor is a small molecule. In some embodiments, the KRAS G12C inhibitor is selected from the group consisting of: sotorasib, adagrasib, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157. In some embodiments, the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0026] wherein

[0027] T1 is selected from O and N;

[0028] R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra;

[0029] when T1 is O, R2 is not present;

[0030] when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb;

[0031] R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc;

[0032] R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd;

[0033] R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F;

[0034] R8 is selected from H and CH3;

[0035] Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F;

[0036] Rb is each independently selected from F, Cl, Br, I, OH and NH2;

[0037] Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R;

[0038] Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN;

[0039] R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino;

[0040] provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H.

[0041] In some embodiments according to any of the methods described above, the construct is administered intravenously or subcutaneously.

[0042] In some embodiments according to any of the methods described above, the KRAS G12C inhibitor is administered orally.

[0043] In some embodiments according to any of the methods described above, the cancer comprises one or more cancer cells that express a KRAS G12C mutant protein.

[0044] In some embodiments according to any of the methods described above, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma.

[0045] In some embodiments according to any of the methods described above, the cancer is advanced, unresectable, and / or metastatic solid tumor.

[0046] In some embodiments according to any of the methods described above, the construct and the KRAS G12C inhibitor are administered simultaneously.

[0047] In some embodiments according to any of the methods described above, the construct and the KRAS G12C inhibitor are administered concurrently.

[0048] In some embodiments according to any of the methods described above, the construct and the KRAS G12C inhibitor are administered sequentially. In some embodiments, the construct is  administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct.

[0049] In some embodiments according to any of the methods described above, the method further comprises administering to the individual an effective amount of a third therapy. In some embodiments, the third therapy comprises another anti-cancer agent. In some embodiments, the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents.

[0050] In some embodiments according to any of the methods described above, the individual is a human.

[0051] In some embodiments according to any of the methods described above, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0052] The present application in another aspect provides a kit for treating cancer in an individual, comprising: 1) construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor. In some embodiments, the construct binds PVRIG and / or TIGIT. In some embodiments, the construct that binds TIGIT is an anti-TIGIT antibody or an immunologically active fragment thereof. In some embodiments, the construct that binds PVRIG is an anti-PVRIG antibody or an immunologically active fragment thereof. In some embodiments, the anti-TIGIT antibody or immunologically active fragment thereof comprises (a) a VH that comprises (1) a CDR-H1 comprising SEQ ID NO: 1; (2) a CDR-H2 comprising SEQ ID NO: 2; and (3) a CDR-H3 comprising SEQ ID NO: 3 and (b) a VL that comprises (1) a CDR-L1 comprising SEQ ID NO: 4; (2) a CDR-L2 comprising SEQ ID NO: 5; and (3) a CDR-L3 comprising SEQ ID NO: 6, wherein the CDR sequences are defined according to the Kabat numbering system. In some embodiments, the anti-PVRIG antibody or immunologically active fragment thereof comprises (a) a VH that comprises (1) a CDR-H1 comprising SEQ ID NO: 7; (2) a CDR-H2 comprising SEQ ID NO: 8; and (3) a CDR-H3 comprising SEQ ID NO: 9 and (b) a VL that comprises (1) a CDR-L1 comprising SEQ ID NO: 10; (2) a CDR-L2 comprising SEQ ID NO: 11; and (3) a CDR-L3  comprising SEQ ID NO: 12, wherein the CDR sequences are defined according to the Kabat numbering system. In some embodiments, the VH domain of the anti-TIGIT antibody or immunologically active fragment thereof comprises an amino acid sequence that has at least 85%identity to SEQ ID NO: 13, and the VL of the anti-TIGIT antibody or immunologically active fragment thereof comprises an amino acid sequence that has at least 85%identity to SEQ ID NO: 14. In some embodiments, the VH domain of the anti-TIGIT antibody or immunologically active fragment thereof comprises an amino acid sequence that has at least 85%identity to SEQ ID NO: 15, and the VL of the anti-TIGIT antibody or immunologically active fragment thereof comprises an amino acid sequence that has at least 85%identity to SEQ ID NO: 16. In some embodiments, the construct comprises (i) a first and a second heavy chain that comprise SEQ ID NO: 17, and a first and a second light chain that comprise SEQ ID NO: 18; or (ii) a first and a second heavy chain that comprise SEQ ID NO: 19, and a first and a second light chain that comprise SEQ ID NO: 20. In some embodiments, the kit further comprises the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is an antibody, a peptide, a protein, an antisense oligonucleotide, or a small molecule that inhibits the activity of the KRAS G12C mutant protein. In some embodiments, the KRAS G12C inhibitor is a small molecule inhibitor. In some embodiments, the small molecule is selected from the group consisting of: Compound 17, sotorasib, adagrasib, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157. In some embodiments, the small molecule is Compound 17. In some embodiments, the cancer that comprises one or more cancer cells that express a KRAS G12C mutant protein is lung cancer, colon adenocarcinoma, colorectal adenocarcinoma, pancreatic cancer, cholangiocarcinoma, endometrial cancer, ovarian cancer, peritoneal cancer, bladder cancer, gastric cancer, thyroid cancer, melanoma, breast cancer, head and neck cancer, multiple myeloma, acute myeloid leukemia (AML) , uterine cancer, gastro-esophageal cancer, or rectal adenocarcinoma.

[0053] The present application in another aspect provides use of construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety for the manufacture of a medicament for treating cancer, wherein the treatment is in combination with a KRAS G12C inhibitor. In some embodiments, the cancer is selected from colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer,  pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is colon cancer.

[0054] It is to be understood that one, some, or all of the properties of the various embodiments described herein may be combined to form other embodiments of the present invention. These and other aspects of the invention will become apparent to one of skill in the art. These and other embodiments of the invention are further described by the detailed description that follows.

[0055] BRIEF DESCRIPTIONS OF THE DRAWINGS

[0056] FIG. 1A shows the gating strategy to identify various myeloid cell populations.

[0057] FIG. 1B shows the gating strategy to identify various T cell populations.

[0058] FIG. 2 shows the strategy to quantify cells positive for CD226 in populations of various cell types.

[0059] FIG. 3 shows the gating strategy to identify various cell populations for subsequent immune checkpoint expression analysis.

[0060] FIG. 4 shows the strategy to quantify cells positive for various markers in populations of total T cells and CD8+ T cells, in myeloid cells, and in tumor cells.

[0061] FIG. 5 shows the percent of CD45+ cells in the population of livecells.

[0062] FIG. 6 shows the percent myeloid and T cell populations in CD45+ cells.

[0063] FIG. 7 shows the percentage of myeloid derived suppressor cell (MDSC) subpopulations in CD45+ cells.

[0064] FIG. 8 shows the percentages of M1 and M2 in macrophages.

[0065] FIG. 9 shows the percentage of CD8+ T cells, CD4+ T cells in CD45+ cells.

[0066] FIG. 10 shows the expression of CD226 in T cells and various T cell subpopulations. MFI indicates mean fluorescence intensity.

[0067] FIG. 11A shows the median fluorescence intensity (MFI) of PVRIG signal in T cells and CD8+ T cells before and after compound 17 treatment.

[0068] FIG. 11B shows the percent PVRIG positive in populations of T cells and CD8+ T cells before and after compound 17 treatment.

[0069] FIG. 12A shows the median fluorescence intensity (MFI) of TIGIT signal in T cells and CD8+ T cells before and after compound 17 treatment.

[0070] FIG. 12B shows the percent TIGIT positive in populations of T cells and CD8+ T cells before and after compound 17 treatment.

[0071] FIG. 13A shows the median fluorescence intensity (MFI) of CD112 signal in myeloid and tumor cells before and after compound 17 treatment.

[0072] FIG. 13B shows the percent CD112 positive in populations of myeloid and tumor cells before and after compound 17 treatment.

[0073] FIG. 14A shows the median fluorescence intensity (MFI) of CD155 signal in myeloid and tumor cells before and after compound 17 treatment.

[0074] FIG. 14B shows the percent CD155 positive in populations of myeloid and tumor cells before and after compound 17 treatment.

[0075] FIG. 15 shows average percent body weight change per treatment group. N indicates the number of mice in the treatment group, PO indicates oral administration; QD indicates once daily; Q2W indicates every two weeks treatment, IP+PO indicates that Compound 17 was administered orally, and the antibody msG15 was administered intraperitoneally (IP) .

[0076] FIG. 16 shows average tumor volume change per treatment group over time.

[0077] FIG. 17A shows the individual tumor volume growth curves of the mice dosed with the vehicle control.

[0078] FIG. 17B shows the individual tumor volume growth curves of the mice treated with Compound 17 dosed at 10 mg / kg.

[0079] FIG. 17C shows the individual tumor volume growth curves of the mice treated with Compound 17 dosed at 30 mg / kg.

[0080] FIG. 17D shows the individual tumor volume growth curves of the mice treated with Antibody msG15 dosed at 13.3 mg / kg.

[0081] FIG. 17E shows the individual tumor volume growth curves of the mice treated with Antibody msG15 dosed at 13.3 mg / kg and Compound 17 at 10 mg / kg.

[0082] FIG. 17F shows the individual tumor volume growth curves of the mice treated with Antibody msG15 dosed at 13.3 mg / kg and Compound 17 at 30 mg / kg.

[0083] FIG. 18 shows average percent survival per treatment group over time.

[0084] FIG. 19 shows complete response rate (CR) of groups subjected to different treatments.DETAILED DESCRIPTION OF THE INVENTION

[0085] The present application provides combination therapies for treating KRAS mutant cancer (e.g., KRAS G12C cancer) that comprises a construct comprising a TIGIT ( “T cell immunoreceptor with Ig and ITIM domain” ) binding moiety and a PVRIG ( “Poliovirus receptor-related immunoglobulin domain-containing” ) binding moiety and a KRAS inhibitor (e.g., KRAS G12C inhibitor) . In some embodiments, the construct comprises a TIGIT / PVRIG multispecific antibody. As shown in the Examples, the combination therapies provides advantageous efficacious effects of treating KRAS mutant cancer while safely tolerated in vivo. See e.g., Example 2.

[0086] Definitions

[0087] Before describing the embodiments in detail, it is to be understood that the present disclosure is not limited to particular compositions or biological systems, which can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting.

[0088] As used in this specification and the appended claims, the singular forms “a” , “an” and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “a molecule” optionally includes a combination of two or more such molecules, and the like.

[0089] The term “about” as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. Reference to “about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se.

[0090] It is understood that aspects and embodiments of the present disclosure include “comprising, ” “consisting, ” and “consisting essentially of” aspects and embodiments.

[0091] The terms “polypeptide, ” “peptide, ” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues, or an assembly of multiple polymers of amino acid  residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer. The term “amino acid” refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine. Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an alpha-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. An alpha-carbon refers to the first carbon atom that attaches to a functional group, such as a carbonyl. A beta-carbon refers to the second carbon atom linked to the alpha-carbon, and the system continues naming the carbons in alphabetical order with Greek letters. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. The term “protein” typically refers to large polypeptides. The term “peptide” typically refers to short polypeptides. Polypeptide sequences are usually described as the left-hand end of a polypeptide sequence is the amino-terminus (N-terminus) ; the right-hand end of a polypeptide sequence is the carboxyl-terminus (C-terminus) . “Construct” as used herein refers to a complex comprising one or more polypeptides that are associated to perform certain functions. In certain embodiments, the polypeptides are immune-related. In some embodiments, the construct comprises at least two polypeptide chains.

[0092] The term “operably link” or “operably linked” refers to a juxtaposition, with or without a spacer or linker, of two or more biological sequences of interest in such a way that they are in a relationship permitting them to function in an intended manner. When used with respect to polypeptides, it is intended to mean that the polypeptide sequences are linked in such a way that permits the linked product to have the intended biological function. For example, an antibody variable region may be operably linked to a constant region so as to provide for a stable product  with antigen-binding activity. The term may also be used with respect to polynucleotides. For one instance, when a polynucleotide encoding a polypeptide is operably linked to a regulatory sequence (e.g., promoter, enhancer, silencer sequence, etc. ) , it is intended to mean that the polynucleotide sequences are linked in such a way that permits regulated expression of the polypeptide from the polynucleotide.

[0093] As used herein, the term “antibody” is used in the broadest sense and specifically covers intact antibodies (e.g., full-length antibodies) , antibody fragments (including without limitation Fab, F (ab’) 2, , scFv, scFv-Fc, single domain antibodies) , monoclonal antibodies, and polyclonal antibodies, so long as they exhibit the desired biological activity (e.g., epitope binding) .

[0094] A "blocking" antibody or an "antagonist" antibody is one that inhibits or reduces a biological activity of the antigen it binds. In some embodiments, blocking antibodies or antagonist antibodies substantially inhibit (e.g., inhibits at least 50%, 60%, 70%, 80%, 90%, or 95%) or completely inhibit the biological activity of the antigen. For example, the bispecific antibodies of the application block the signaling through TIGIT and PVRIG.

[0095] As used herein, the term “isolated” antibody may refer to an antibody that is substantially free of other cellular material. In one embodiment, an isolated antibody is substantially free of other proteins from the same species. In another embodiment, an isolated antibody is expressed by a cell from a different species and is substantially free of other proteins from the different species. In some embodiments, an “isolated” antibody is one which has been identified and separated and / or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. An antibody may be rendered substantially free of naturally associated components (or components associated with the cellular expression system used to produce the antibody) by isolation, using protein purification techniques well known in the art. In some embodiments, the antibody will be purified (1) to greater than 75%by weight of antibody as determined by the Lowry method, and most preferably more than 80%, 90%, 95%or 99%by weight, or (2) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will  not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.

[0096] As used herein, the term “epitope” means any antigenic determinant on an antigen to which the paratope of an antibody binds. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three-dimensional structural characteristics, as well as specific charge characteristics.

[0097] As used herein, the term “variable” refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity-determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework (FR) . The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a β-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the β-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies. See, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991) . The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity. Variable region sequences of interest include the humanized variable region sequences for multispecific antibodies described in detail elsewhere herein.

[0098] The term “hypervariable region (HVR) ” or “complementarity determining region (CDR) ” may refer to the subregions of the VH and VL domains characterized by enhanced sequence variability and / or formation of defined loops. These include three CDRs in the VH domain (H1, H2, and H3) and three CDRs in the VL domain (L1, L2, and L3) . H3 is believed to be critical in imparting fine binding specificity, with L3 and H3 showing the highest level of diversity. See Johnson and Wu, in Methods in Molecular Biology 248: 1-25 (Lo, ed., Human Press, Totowa, N.J., 2003) .

[0099] A number of CDR / HVR delineations are known. The Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991) ) . Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196: 901-917 (1987) ) . The AbM HVRs represent a compromise between the Kabat HVRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software. The “contact” HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs / CDRs are noted below. “Framework” or “FR” residues are those variable domain residues other than the HVR / CDR residues.

[0100] “Extended” HVRs are also known: 24-36 or 24-34 (L1) , 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (H1) , 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH (Kabat numbering) .

[0101] “Numbering according to Kabat” may refer to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., supra. The actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain. The Kabat  numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence. Typically, the Kabat numbering is used when referring to a residue in the variable domains (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) , whereas the EU numbering system or index (e.g., the EU index as in Kabat, numbering according to EU IgG1) is generally used when referring to a residue in the heavy chain constant region.

[0102] As used herein, a “monoclonal” antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., substantially identical but allowing for minor levels of background mutations and / or modifications. “Monoclonal” denotes the substantially homogeneous character of antibodies, and does not require production of the antibody by any particular method. In some embodiments, a monoclonal antibody is selected by its HVR, VH, and / or VL sequences and / or binding properties, e.g., selected from a pool of clones (e.g., recombinant, hybridoma, or phage-derived) . A monoclonal antibody may be engineered to include one or more mutations, e.g., to affect binding affinity or other properties of the antibody, create a humanized or chimeric antibody, improve antibody production and / or homogeneity, engineer a multispecific antibody, resultant antibodies of which are still considered to be monoclonal in nature. A population of monoclonal antibodies may be distinguished from polyclonal antibodies as the individual monoclonal antibodies of the population recognize the same antigenic site. A variety of techniques for production of monoclonal antibodies are known; see, e.g., the hybridoma method (e.g., Kohler and Milstein, Nature, 256: 495-97 (1975) ; Hongo et al., Hybridoma, 14 (3) : 253-260 (1995) , Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988) ; Hammerling et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981) ) , recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567) , phage-display technologies (see, e.g., Clackson et al., Nature, 352: 624-628 (1991) ; Marks et al., J. Mol. Biol. 222: 581-597 (1992) ; Sidhu et al., J. Mol. Biol. 338 (2) : 299-310 (2004) ; Lee et al., J. Mol. Biol. 340 (5) : 1073-1093 (2004) ; Fellouse, Proc. Natl. Acad. Sci. USA 101 (34) : 12467-12472 (2004) ; and Lee et al., J. Immunol. Methods 284 (1-2) : 119-132 (2004) , and technologies for producing human or human-like antibodies in animals that have parts or all of the human immunoglobulin loci or genes encoding human immunoglobulin sequences (see, e.g., WO 1998 / 24893; WO 1996 / 34096; WO 1996 / 33735; WO 1991 / 10741; Jakobovits et al., Proc. Natl.  Acad. Sci. USA 90: 2551 (1993) ; Jakobovits et al., Nature 362: 255-258 (1993) ; Bruggemann et al., Year in Immunol. 7: 33 (1993) ; U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016; Marks et al., Bio / Technology 10: 779-783 (1992) ; Lonberg et al., Nature 368: 856-859 (1994) ; Morrison, Nature 368: 812-813 (1994) ; Fishwild et al., Nature Biotechnol. 14: 845-851 (1996) ; Neuberger, Nature Biotechnol. 14: 826 (1996) ; and Lonberg and Huszar, Intern. Rev. Immunol. 13: 65-93 (1995) .

[0103] “Chimeric” antibodies may refer to an antibody with one portion of the heavy and / or light chain from a particular isotype, class, or organism and another portion from another isotype, class, or organism. In some embodiments, the variable region will be from one source or organism, and the constant region will be from another.

[0104] “Humanized antibodies” may refer to antibodies with predominantly human sequence and a minimal amount of non-human (e.g., mouse or chicken) sequence. In some embodiments, a humanized antibody has one or more HVR sequences (bearing a binding specificity of interest) from an antibody derived from a non-human (e.g., mouse or chicken) organism grafted onto a human recipient antibody framework (FR) . In some embodiments, non-human residues are further grafted onto the human framework (not present in either source or recipient antibodies) , e.g., to improve antibody properties. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc) , typically that of a human immunoglobulin. See Jones et al., Nature 321: 522-525 (1986) ; Riechmann et al., Nature 332: 323-329 (1988) ; and Presta, Curr. Op. Struct. Biol. 2: 593-596 (1992) .

[0105] A “human” antibody may refer to an antibody having an amino acid sequence which corresponds to that of an antibody produced by a human and / or has been made using any of the techniques for making human antibodies as disclosed herein. Human antibodies can be produced using various techniques known in the art, including phage-display libraries. Hoogenboom and Winter, J. Mol. Biol., 227: 381 (1991) ; Marks et al., J. Mol. Biol., 222: 581 (1991) ; preparation of human monoclonal antibodies as described in Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985) ; Boerner et al., J. Immunol., 147 (1) : 86-95 (1991) ; and by  administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSETM technology) or chickens with human immunoglobulin sequence (s) (see, e.g., WO2012162422, WO2011019844, and WO2013059159) .

[0106] There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes) , e.g., IgG1, IgG2, IgG3, IgG4, IgA1, IgA2. The heavy-chain constant domains that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.

[0107] As used herein, the term “antibody fragment” , and all grammatical variants thereof, are defined as a portion of an intact antibody comprising the antigen binding site or variable region of the intact antibody which, in certain instances, is free of the constant heavy chain domains (i.e. CH2, CH3, and / or CH4, depending on antibody isotype) of the Fc region of the intact antibody. Examples of antibody fragments include Fab, Fab’, Fab’-SH, F (ab’) 2, and Fv fragments; diabodies; any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues (referred to herein as a “single-chain antibody fragment” or “single chain polypeptide” ) , including without limitation (1) single-chain Fv (scFv) molecules, (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable domain, without an associated heavy chain moiety, and (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety; and multi-specific or multivalent structures formed from antibody fragments. In an antibody fragment comprising one or more heavy chains, the heavy chain (s) can contain any constant domain sequence (e.g. CH1 in the IgG isotype) found in a non-Fc region of an intact antibody, and / or can contain any hinge region sequence found in an intact antibody, and / or can contain a leucine zipper sequence fused to or situated in the hinge region sequence or the constant domain sequence of the heavy chain (s) .

[0108] Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual “Fc” fragment, whose name  reflects its ability to crystallize readily. Pepsin treatment yields an F (ab’) 2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen. “Fv” is the minimum antibody fragment which contains a complete antigen-recognition and -binding site. In a two-chain Fv species, this region consists of a dimer of one heavy-and one light-chain variable domain in tight, non-covalent association. In a single-chain Fv species (scFv) , one heavy-and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a “dimeric” structure analogous to that in a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site. See, e.g., Pluckthun, in The Pharmacology of Monoclonal Antibodies, Vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994) .

[0109] The Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab’ fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab’-SH is the designation herein for Fab’ in which the cysteine residue (s) of the constant domains bear a free thiol group. F (ab’) 2 antibody fragments originally were produced as pairs of Fab’ fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.

[0110] As used herein, the term “monoclonal antibody” (mAb) refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Each mAb is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they can be synthesized by hybridoma culture, uncontaminated by other immunoglobulins. The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the  present invention may be made in an immortalized B cell or hybridoma thereof, or may be made by recombinant DNA methods.

[0111] The monoclonal antibodies herein include hybrid and recombinant antibodies produced by splicing a variable (including hypervariable) domain of an antibody with a constant domain (e.g. “humanized” antibodies) , or a light chain with a heavy chain, or a chain from one species with a chain from another species, or fusions with heterologous proteins, regardless of species of origin or immunoglobulin class or subclass designation, as well as antibody fragments (e.g., Fab, F (ab’) 2, and Fv) , so long as they exhibit the desired biological activity.

[0112] The monoclonal antibodies herein specifically include chimeric antibodies (immunoglobulins) in which a portion of the heavy and / or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain (s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.

[0113] As used herein, the term “treatment” refers to clinical intervention designed to alter the natural course of the individual or cell being treated during the course of clinical pathology. Desirable effects of treatment include decreasing the rate of disease progression, ameliorating or palliating the disease state, and remission or improved prognosis. For example, an individual is successfully “treated” if one or more symptoms associated with cancer are mitigated or eliminated, including, but are not limited to, reducing the proliferation of (or destroying) cancerous cells, decreasing symptoms resulting from the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, and / or prolonging survival of individuals. In some embodiments, “treating” a disease such as cancer refers to delaying progression of the disease, i.e., deferring, hindering, slowing, retarding, stabilizing, and / or postponing development of the disease (such as cancer) . This delay can be of varying lengths of time, depending on the history of the disease and / or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.

[0114] An “effective amount” is at least the minimum amount required to effect a measurable improvement or prevention of a particular disease (e.g., cancer) . An effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of a therapeutic agent (or combination of therapeutic agents) to elicit a desired response in the individual. An effective amount is also one in which any toxic or detrimental effects of the treatment are outweighed by the therapeutically beneficial effects. For therapeutic use, beneficial or desired results include clinical results such as decreasing one or more symptoms resulting from the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, enhancing effect of another medication such as via targeting, delaying the progression of the disease, and / or prolonging survival. In the case of cancer or tumor, an effective amount of the drug may have the effect in reducing the number of cancer cells; reducing the tumor size; inhibiting (i.e., slow to some extent or desirably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and desirably stop) tumor metastasis; inhibiting to some extent tumor growth; and / or relieving to some extent one or more of the symptoms associated with the disorder. An effective amount can be administered in one or more administrations. For purposes of this disclosure, an effective amount of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish therapeutic treatment either directly or indirectly. As is understood in the clinical context, an effective amount of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition. Thus, an “effective amount” may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.

[0115] As used herein, the term “subject” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, etc. Preferably, the mammal is human.

[0116] The terms “subject” and “patient” are used interchangeably and include mammals such as humans and non-human primates, as well as rabbits, rats, mice, goats, pigs, and other mammalian species. The term does not necessarily indicate that the subject has been diagnosed with a particular disease, but typically refers to an individual under medical supervision.

[0117] The term “prevent” , “preventing” , or “prevention” , as used herein in the context of preventing a condition, refers generally to preventing or delaying the onset of the disease, or preventing the manifestation of clinical or subclinical symptoms thereof in a subject (whether a human or animal) , for example, preventing the disease from occurring in a subject predisposed to the condition or disease but has not yet been diagnosed as having it.

[0118] The term “pharmaceutically acceptable, ” as used herein, means that the vehicle, diluent, excipient and / or salts thereof, are chemically and / or physically is compatible with other ingredients in the formulation, and the physiologically compatible with the recipient.

[0119] As used herein, the term “apharmaceutically acceptable carrier and / or excipient” refers to a carrier and / or excipient pharmacologically and / or physiologically compatible with a subject and an active agent, which is well known in the art (see, e.g., Remington's Pharmaceutical Sciences. Edited by Gennaro AR, 19th ed. Pennsylvania: Mack Publishing Company, 1995) , and includes, but is not limited to pH adjuster, surfactant, adjuvant and ionic strength enhancer. For example, the pH adjuster includes, but is not limited to, phosphate buffer; the surfactant includes, but is not limited to, cationic, anionic, or non-ionic surfactant, e.g., Tween-80; the ionic strength enhancer includes, but is not limited to, sodium chloride.

[0120] As used herein, the term “adjuvant” refers to a non-specific immunopotentiator, which can enhance immune response to an antigen or change the type of immune response in an organism when it is delivered together with the antigen to the organism or is delivered to the organism in advance. There are a variety of adjuvants, including, but not limited to, aluminium adjuvants (for example, aluminum hydroxide) , Freund’s adjuvants (for example, Freund’s complete adjuvant and Freund’s incomplete adjuvant) , coryne bacterium parvum, lipopolysaccharide, cytokines, and the like. Freund's adjuvant is the most commonly used adjuvant in animal experiments now. Aluminum hydroxide adjuvant is more commonly used in clinical trials.

[0121] The pharmaceutically acceptable salt disclosed herein can be prepared from the parent compound that contains an acidic or basic moiety by conventional chemical methods. Generally, such salt can be prepared by reacting the free acid or base form of the compound with a stoichiometric amount of an appropriate base or acid in water or an organic solvent or a mixture thereof.

[0122] Compounds disclosed herein may be present in a specific geometric or stereoisomeric form. The present disclosure contemplates all such compounds, including cis and trans isomers, (-) -and (+) -enantiomers, (R) -and (S) -enantiomers, diastereoisomer, (D) -isomer, (L) -isomer, and a racemic mixture and other mixtures, for example, a mixture enriched in enantiomer or diastereoisomer, all of which are encompassed within the scope disclosed herein. The substituent such as alkyl may have an additional asymmetric carbon atom. All these isomers and mixtures thereof are encompassed within the scope disclosed herein.

[0123] Compounds disclosed herein may contain an unnatural proportion of atomic isotopes at one or more of the atoms that make up the compounds. For example, a compound may be labeled with a radioisotope such as tritium (3H) , iodine-125 (125I) or C-14 (14C) . For another example, hydrogen can be replaced by heavy hydrogen to form a deuterated drug. The bond between deuterium and carbon is stronger than that between ordinary hydrogen and carbon. Compared with undeuterated drugs, deuterated drugs have advantages of reduced toxic side effects, increased drug stability, enhanced efficacy, and prolonged biological half-life of drugs. All changes in the isotopic composition of compounds disclosed herein, regardless of radioactivity, are included within the scope of the present disclosure.

[0124] The term "optional" or "optionally" means that the subsequent event or condition may occur but not requisite, that the term includes the instance in which the event or condition occurs and the instance in which the event or condition does not occur.

[0125] The term "substituted" means that one or more than one hydrogen atoms on a specific atom are substituted by a substituent, including deuterium and hydrogen variants, as long as the valence of the specific atom is normal and the substituted compound is stable. When the substituent is oxo (i.e., =O) , it means two hydrogen atoms are substituted. Positions on an aromatic ring cannot be substituted by oxo. The term "optionally substituted" means an atom can be substituted by a substituent or not, unless otherwise specified, the species and number of the substituent may be arbitrary so long as being chemically achievable.

[0126] When any variable (such as R) occurs in the constitution or structure of the compound more than once, the definition of the variable at each occurrence is independent. Thus, for example, if a group is substituted by 0-2 R, the group can be optionally substituted by up to two R, wherein  the definition of R at each occurrence is independent. Moreover, a combination of the substituent and / or the variant thereof is allowed only when the combination results in a stable compound.

[0127] When the number of a linking group is 0, such as - (CRR) 0-, it means that the linking group is a single bond.

[0128] When one of variables is a single bond, it means that the two groups linked by the single bond are connected directly. For example, when L in A-L-Z represents a single bond, the structure of A-L-Z is actually A-Z.

[0129] When an enumerated linking group does not indicate its linking direction, its linking direction is arbitrary. For example, when the linking group L in is -M-W-, the -M-W-can be linked to the ring A and the ring B in the same direction as the reading order from left to right to constitute or can be linked to the ring A and the ring B in the reverse direction as the reading order from left to right to constitute A combination of the linking groups, substituents and / or variants thereof is allowed only when such combination can result in a stable compound.

[0130] Unless otherwise specified, when a group has one or more connectable sites, any one or more sites of the group can be connected to other groups through chemical bonds. Where the connection position of the chemical bond is variable, and there is H atom (s) at a connectable site (s) , when the connectable site (s) having H atom (s) is connected to the chemical bond, the number of H atom (s) at this site will correspondingly decrease as the number of the connected chemical bond increases, and the group will become a group of corresponding valence. The chemical bond between the site and other groups can be represented by a straight solid bond astraight dashed bond or a wavy line For example, the straight solid bond in -OCH3 indicates that the group is connected to other groups through the oxygen atom in the group; the straight dashed bond in indicates that the group is connected to other groups through two ends of the nitrogen atom in the group; the wavy line in indicates that the group is connected to other groups  through the 1-and 2-carbon atoms in the phenyl group;  indicates that any connectable site on the piperidinyl group can be connected to other groups through one chemical bond, including at least four connection ways,  even if a H atom is drawn on -N-,  still includes the connection way of it's just that when one chemical bond is connected, the H at this site will be reduced by one, and the group will become the corresponding monovalent piperidinyl group.

[0131] Unless otherwise specified, a wedged solid bond and a wedged dashed bond indicate the absolute configuration of a stereocenter; a straight solid bond and a straight dashed bond indicate the relative configuration of a stereocenter; a wavy line indicates a wedged solid bond or a wedged dashed bond or a wavy line indicates a straight solid bond and a straight dashed bond For example,  represents represents

[0132] Unless otherwise specified, the term "enriched in one isomer" , "isomer enriched" , "enriched in one enantiomer" or "enantiomeric enriched" means that the content of one isomer or enantiomer is less than 100%, and the content of the isomer or enantiomer is 60%or more, or 70% or more, or 80%or more, or 90%or more, or 95%or more, or 96%or more, or 97%or more, or 98%or more, or 99%or more, or 99.5%or more, or 99.6%or more, or 99.7%or more, or 99.8%or more, or 99.9%or more.

[0133] Optically active (R) -and (S) -isomer, or D and L isomer can be prepared using chiral synthesis or chiral reagents or other conventional techniques. If one kind of enantiomer of certain compound disclosed herein is to be obtained, the pure desired enantiomer can be obtained by asymmetric synthesis or derivative action of chiral auxiliary followed by separating the resulting diastereomeric mixture and cleaving the auxiliary group. Alternatively, when the molecule contains a basic functional group (such as amino) or an acidic functional group (such as carboxyl) , the compound reacts with an appropriate optically active acid or base to form a salt of the diastereomeric isomer which is then subjected to diastereomeric resolution through the conventional method in the art to afford the pure enantiomer. In addition, the enantiomer and the diastereoisomer are generally isolated through chromatography which uses a chiral stationary phase and optionally combines with a chemical derivative method (for example, carbamate generated from amine) .

[0134] Unless otherwise specified, the term “C1-6 alkyl” is used to represent a linear or branched saturated hydrocarbon group composed of 1 to 6 carbon atoms. The C1-6 alkyl includes C1-5, C1-4, C1-3, C1-2, C2-6, C2-4, C6, and C5 alkyl, etc. It may be monovalent (such as methyl) , divalent (such as methylene) or multivalent (such as methenyl) . Examples of the C1-6 alkyl include, but are not limited to, methyl (Me) , ethyl (Et) , propyl (including n-propyl and isopropyl) , butyl (including n-butyl, isobutyl, s-butyl and t-butyl) , pentyl (including n-pentyl, isopentyl and neopentyl) , hexyl, and the like.

[0135] Unless otherwise specified, the term "C1-3 alkyl" is used to represent a linear or branched saturated hydrocarbon group composed of 1 to 3 carbon atoms. The C1-3 alkyl includes C1-2 alkyl, C2-3 alkyl, etc. It may be monovalent (such as methyl) , divalent (such as methylene) or multivalent (such as methenyl) . Examples of the C1-3 alkyl include, but are not limited to, methyl (Me) , ethyl (Et) , propyl (including n-propyl and isopropyl) , and the like.

[0136] Unless otherwise specified, the term "C1-3 alkoxy" means alkyl groups containing 1 to 3 carbon atoms and attached to the remainder of a molecule by an oxygen atom. The C1-3 alkoxy group includes C1-2, C2-3, C3, and C2 alkoxy groups, and the like. Examples of C1-3 alkoxy  groups include, but are not limited to, methoxy, ethoxy, propoxy (including n-propoxy and isopropoxy) , and the like.

[0137] Unless otherwise specified, the term "C1-3 alkylamino" means alkyl groups containing 1 to 3 carbon atoms and attached to the remainder of a molecule by an amino group. The C1-3 alkylamino group includes C1-2, C3 and C2 alkylamino groups and the like. Examples of C1-3 alkylamino groups include, but are not limited to -NHCH3, -N (CH3) 2, -NHCH2CH3, -N (CH3) CH2CH3, -NHCH2CH2CH3, -NHCH2 (CH3) 2, and the like.

[0138] Unless otherwise specified, “C2-3 alkenyl” is used to represent a linear or branched hydrocarbon group composed of 2 to 3 carbon atoms containing at least one carbon-carbon double bond, wherein the carbon-carbon double bond can be located at any position of the group. The C2-3 alkenyl includes C3 and C2 alkenyl. The C2-3 alkenyl may be monovalent, divalent or multivalent. Examples of the C2-3 alkenyl include, but are not limited to, vinyl, propenyl, and the like.

[0139] Unless otherwise specified, “C2-3 alkynyl” is used to represent a linear or branched hydrocarbon group composed of 2 to 3 carbon atoms containing at least one carbon-carbon triple bond, wherein the carbon-carbon triple bond can be located at any position of the group. The C2-3 alkynyl includes C3 and C2 alkynyl. Examples of the C2-3 alkynyl include, but are not limited to, ethynyl, propynyl, and the like.

[0140] Unless otherwise specified, the terms "C6-10 aromatic ring" and "C6-10 aryl" may be used interchangeably in this disclosure. The term"C6-10 aromatic ring" or "C6-10 aryl" means a cyclic hydrocarbon group having a conjugated pi electron system and composed of 6 to 10 carbon atoms. It may be a monocyclic, fused bicyclic or fused tricyclic ring system, wherein each ring is aromatic. It may be monovalent, divalent or multivalent. The C6-10 aryl includes C6-9, C9, C10 and C6 aryl, etc. Examples of C6-10 aryl include, but are not limited to, phenyl, naphthyl (including 1-naphthyl and 2-naphthyl, etc. ) .

[0141] Unless otherwise specified, the terms "5-to 10-membered heteroaromatic ring" and "5-to 10-membered heteroaryl" may be used interchangeably. The term "5-to 10-membered heteroaryl" means a cyclic group having a conjugated pi electron system and composed of 5 to 10 ring atoms, in which 1, 2, 3 or 4 ring atoms are heteroatoms independently selected from O, S and N, and the remainder is carbon atoms. It may be a monocyclic, fused bicyclic or fused tricyclic ring system, wherein each ring is aromatic, and wherein the nitrogen atom is optionally quaternized and  the nitrogen and sulfur heteroatoms are optionally oxidized (i.e., NO and S (O) p, p is 1 or 2) . A 5-to 10-membered heteroaryl can be attached to the remainder of the molecule through a heteroatom or a carbon atom. The 5-to 10-membered heteroaryl group includes 5-to 8-membered, 5-to 7-membered, 5-to 6-membered, 5-membered and 6-membered heteroaryl groups. Examples of the 5-10 membered heteroaryl include, but are not limited to, pyrrolyl (including N-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, and the like) , pyrazolyl (including 2-pyrazolyl and 3-pyrazolyl, and the like) , imidazolyl (including N-imidazolyl, 2-imidazolyl, 4-imidazolyl, and 5-imidazolyl, and the like) , oxazolyl (including 2-oxazolyl, 4-oxazolyl, and 5-oxazolyl, and the like) , triazolyl (1H-1, 2, 3-triazolyl, 2H-1, 2, 3-triazolyl, 1H-1, 2, 4-triazolyl and 4H-1, 2, 4-triazolyl, and the like) , tetrazolyl, isoxazolyl (3-isoxazolyl, 4-isoxazolyl and 5-isoxazolyl, and the like) , thiazolyl (including 2-thiazolyl, 4-thiazolyl and 5-thiazolyl, and the like) , furyl (including 2-furyl and 3-furyl, and the like) , thienyl (including 2-thienyl and 3-thienyl, and the like) , pyridyl (including 2-pyridyl, 3-pyridyl and 4-pyridyl, and the like) , pyrazinyl or pyrimidinyl (including 2-pyrimidinyl and 4-pyrimidinyl, and the like) , benzothiazolyl (including 5-benzothiazolyl, and the like) , purinyl, benzimidazolyl (including 2-benzimidazolyl, and the like) , benzoxazolyl, indolyl (including 5-indolyl, and the like) , isoquinolyl (including 1-isoquinolyl, 5-isoquinolyl, and the like) , quinoxalinyl (including 2-quinoxalinyl, 5-quinoxalinyl, and the like) or quinolyl (including 3-quinolyl, 6-quinolyl, and the like) .

[0142] Unless otherwise specified, the term "4-to 8-membered heterocycloalkyl" alone or in combination with other terms respectively represents a saturated cyclic group composed of 4 to 8 ring atoms, in which 1, 2, 3 or 4 ring atoms are heteroatoms independently selected from O, S and N, and the remainder is carbon atoms, wherein the nitrogen atom is optionally quaternized, and the nitrogen and sulfur heteroatoms are optionally oxidized (i.e., NO and S (O) p, p is 1 or 2) . The ring comprises monocyclic and bicyclic ring systems, wherein the bicyclic ring systems comprise spiro, fused, and bridged cyclic rings. In addition, with respect to the "4-to 8-membered heterocycloalkyl" , the heteroatom may be present on the position of attachment of the heterocycloalkyl group to the remainder of a molecule. The 4-to 8-membered heterocycloalkyl includes 4-6 membered, 5-6 membered, 4 membered, 5 membered, and 6 membered heterocycloalkyl, etc. Examples of the 4-to 8-membered heterocycloalkyl include, but are not limited to, azetidinyl, oxetanyl, thietanyl, pyrrolidinyl, pyrazolidinyl, imidazolidinyl, tetrahydrothienyl (including tetrahydrothien-2-yl and tetrahydrothien-3-yl and the like) ,  tetrahydrofuranyl (including tetrahydrofuran-2-yl and the like) , tetrahydropyranyl, piperidinyl (including 1-piperidinyl, 2-piperidinyl and 3-piperidinyl and the like) , piperazinyl (including 1-piperazinyl and 2-piperazinyl and the like) , morpholinyl (including 3-morpholinyl and 4-morpholinyl and the like) , dioxanyl, dithianyl, isoxazolidinyl, isothiazolidinyl, 1, 2-oxazinyl, 1, 2-thiazinyl, hexahydropyridazinyl, homopiperazinyl, homopiperidinyl or dioxepanyl, and the like.

[0143] Unless otherwise specified, Cn-n+m or Cn-Cn+m includes any specific case of n to n+m carbons, for example, C1-12 includes C1, C2, C3, C4, C5, C6, C7, C8, C9, C10, C11 and C12, also includes any range from n to n+m, for example, C1-12 includes C1-3, C1-6, C1-9, C3-6, C3-9, C3-12, C6-9, C6-12 and C9-12, etc.; similarly, n membered to n+m membered indicates that the number of atoms on a ring is n to n+m, for example, 3-12 membered ring includes 3 membered ring, 4 membered ring, 5 membered ring, 6 membered ring, 7 membered ring, 8 membered ring, 9 membered ring, 10 membered ring, 11 membered ring, and 12 membered ring, also includes any range from n to n+m, for example, 3-12 membered ring includes 3-6 membered ring, 3-9 membered ring, 5-6 membered ring, 5-7 membered ring, 6-7 membered ring, 6-8 membered ring, and 6-10 membered ring, and the like.

[0144] Compounds disclosed herein can be prepared by a variety of synthetic methods well known to those skilled in the art, including the following enumerated embodiment, the embodiment formed by the following enumerated embodiment in combination with other chemical synthesis methods, and equivalent replacement well known to those skilled in the art. Alternative embodiments include, but are not limited to the embodiment disclosed herein.

[0145] The structures of compounds disclosed herein can be confirmed by conventional methods well known to those skilled in the art. If the present disclosure relates to an absolute configuration of a compound, the absolute configuration can be confirmed by conventional techniques in the art, such as single crystal X-Ray diffraction (SXRD) . In the single crystal X-Ray diffraction (SXRD) , the diffraction intensity data of the cultivated single crystal is collected using a Bruker D8 venture diffractometer with a light source of CuKα radiation in a scanning mode of φ / ωscan; after collecting the relevant data, the crystal structure is further analyzed by the direct method (Shelxs97) to confirm the absolute configuration.

[0146] Solvents used in the present disclosure are commercially available.

[0147] Compounds are named according to general naming principles in the art or by  software, and commercially available compounds are named with their vendor directory names.

[0148] The pharmaceutically acceptable salt disclosed herein can be prepared from the parent compound that contains an acidic or basic moiety by conventional chemical methods. Generally, such salt can be prepared by reacting the free acid or base form of the compound with a stoichiometric amount of an appropriate base or acid in water or an organic solvent or a mixture thereof.

[0149] All references cited herein, including patent applications, patent publications, and UniProtKB / Swiss-Prot Accession numbers are herein incorporated by reference in their entirety, as if each individual reference were specifically and individually indicated to be incorporated by reference.

[0150] Methods of Treating Cancer

[0151] Provided herein are methods of treating cancer harboring a KRAS G12C mutation (i.e., a cancer comprising one or more cancer cells that express a KRAS G12C mutant protein) in a subject, comprising administering to the subject an effective amount of a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety (i.e., a TIGIT / PVRIG-binding construct) and an effective amount of a KRAS G12C inhibitor. In some embodiments, the TIGIT / PVRIG-binding construct is used for the manufacture of a medicament for treating cancer, wherein the treatment is in combination with a KRAS G12C inhibitor.

[0152] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual (e.g., a human patient) , comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further  comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the KRAS G12C inhibitor is a small molecule, optionally selected from the group consisting of: sotorasib, adagrasib, Compound 17, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157 and any of the compounds disclosed in US20230151004A1 (e.g., 8A and 17) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises  administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0153] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises a full-length antibody comprising two heavy chains and two light chains, and wherein PVRIG-binding moiety comprises a scFv, and wherein the anti-PVRIG scFv is linked to the N-or C-terminus of both heavy chains of the anti-TIGIT full-length antibody. In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the PVRIG-binding moiety comprises a full-length antibody comprising two heavy chains and two light chains, and wherein TIGIT-binding moiety comprises a scFv, and wherein the anti-TIGIT scFv is linked to the N-or C-terminus of both heavy chains of the anti-PVRIG full-length antibody. In some embodiments, the full-length antibody comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the KRAS G12C inhibitor is a small molecule, optionally selected from the group consisting of: sotorasib, adagrasib, Compound 17, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157 and any of the compounds disclosed in US20230151004A1 (e.g., 8A and 17) . In some embodiments, the construct  is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0154] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the  LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the KRAS G12C inhibitor is a small molecule, optionally selected from the group consisting of: sotorasib, adagrasib, Compound 17, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157 and any of the compounds disclosed in US20230151004A1 (e.g., 8A and 17) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma,  chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0155] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the PVRIG-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region,  such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the KRAS G12C inhibitor is a small molecule, optionally selected from the group consisting of: sotorasib, adagrasib, Compound 17, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157 and any of the compounds disclosed in US20230151004A1 (e.g., 8A and 17) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti- cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0156] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6; wherein the PVRIG-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an  IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the KRAS G12C inhibitor is a small molecule, optionally selected from the group consisting of: sotorasib, adagrasib, Compound 17, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157 and any of the compounds disclosed in US20230151004A1 (e.g., 8A and 17) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual  an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0157] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) and a light chain variable region (VL) , and wherein the VH of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 13, and / or the VL of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 14 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 14, and / or wherein the PVRIG-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) and a light chain variable region (VL) , and wherein the VH of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 15 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 15, and / or the VL of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 16. In some embodiments, the VH of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 13, and the VL of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 14. In some embodiments, the VH of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 15, and / or the VL of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 16. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the  TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the KRAS G12C inhibitor is a small molecule, optionally selected from the group consisting of: sotorasib, adagrasib, Compound 17, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157 and any of the compounds disclosed in US20230151004A1 (e.g., 8A and 17) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C  inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0158] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises a full-length antibody comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6; wherein the PVRIG-binding moiety comprises a scFv comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the anti-PVRIG scFv is linked to N-or C-terminus of two heavy chains of the anti-TIGIT full-length antibody. In some embodiments, the full-length antibody comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the  human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the KRAS G12C inhibitor is a small molecule, optionally selected from the group consisting of: sotorasib, adagrasib, Compound 17, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157 and any of the compounds disclosed in US20230151004A1 (e.g., 8A and 17) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0159] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a  construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises a scFv comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO:6; wherein the PVRIG-binding moiety comprises a full-length antibody comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the anti-TIGIT scFv is linked to N-or C-terminus of two heavy chains of the anti-PVRIG full-length antibody. In some embodiments, the full-length antibody comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the KRAS G12C inhibitor is a small molecule, optionally selected from the group consisting of: sotorasib, adagrasib, Compound 17, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157 and any of the compounds disclosed in US20230151004A1 (e.g., 8A and 17) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer,  cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0160] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the construct comprises a first and a second heavy chain that comprise SEQ ID NO: 17, and a first and a second light chain that comprise SEQ ID NO: 18. In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the construct comprises a first and a second heavy chain that comprise SEQ ID NO: 19, and a first and a second light chain that comprise SEQ ID NO: 20.

[0161] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C  inhibitor, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0162] wherein T1 is selected from O and N; R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra; when T1 is O, R2 is not present; when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb; R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc; R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd; R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F; R8 is selected from H and CH3; Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F; Rb is each independently selected from F, Cl, Br, I, OH and NH2; Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R; Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN; R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino; provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and  the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a  debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0163] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises a full-length antibody comprising two heavy chains and two light chains, and wherein PVRIG-binding moiety comprises a scFv, and wherein the anti-PVRIG scFv is linked to the N-or C-terminus of both heavy chains of the anti-TIGIT full-length antibody. In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the PVRIG-binding moiety comprises a full-length antibody comprising two heavy chains and two light chains, and wherein TIGIT-binding moiety comprises a scFv, and wherein the anti-TIGIT scFv is linked to the N-or C-terminus of both heavy chains of the anti-PVRIG full-length antibody, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0164] wherein T1 is selected from O and N; R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra; when T1 is O, R2 is not present; when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl  and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb; R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc; R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd; R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F; R8 is selected from H and CH3; Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F; Rb is each independently selected from F, Cl, Br, I, OH and NH2; Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R; Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN; R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino; provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H. In some embodiments, the full-length antibody comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the  KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0165] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0166] wherein T1 is selected from O and N; R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra; when T1 is O, R2 is not present; when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb;

[0167] R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc; R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd;R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F; R8 is selected from H and CH3; Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F; Rb is each independently selected from F, Cl, Br, I, OH and NH2; Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R; Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN; R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino; provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably  linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0168] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C  inhibitor, wherein the PVRIG-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0169] wherein T1 is selected from O and N; R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra; when T1 is O, R2 is not present; when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb;

[0170] R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc; R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd; R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F; R8 is selected from H and CH3; Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F; Rb is each independently selected from F, Cl, Br, I, OH and NH2; Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R; Rd is each independently  selected from F, Cl, Br, I, OH, NH2 and CN; R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino; provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is  advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0171] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6; wherein the PVRIG-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11,  and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0172] wherein T1 is selected from O and N; R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra; when T1 is O, R2 is not present; when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb; R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc; R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd; R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F; R8 is selected from H and CH3; Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F; Rb is each independently selected from F, Cl, Br, I, OH and NH2; Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R; Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN; R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino; provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and  the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a  debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0173] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) and a light chain variable region (VL) , and wherein the VH of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 13, and / or the VL of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 14 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 14, and / or wherein the PVRIG-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) and a light chain variable region (VL) , and wherein the VH of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 15 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 15, and / or the VL of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 16. In some embodiments, the VH of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 13, and the VL of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 14. In some embodiments, the VH of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 15, and / or the VL of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 16, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0174] wherein T1 is selected from O and N; R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra; when T1 is O, R2 is not present; when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb;

[0175] R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc; R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd;R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F; R8 is selected from H and CH3; Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F; Rb is each independently selected from F, Cl, Br, I, OH and NH2; Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R; Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN; R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino; provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an  IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent,  BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0176] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises a full-length antibody comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6; wherein the PVRIG-binding moiety comprises a scFv comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the anti-PVRIG scFv is linked to N-or C-terminus of two heavy chains of the anti-TIGIT full-length antibody, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0177] wherein T1 is selected from O and N; R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra; when T1 is O, R2 is not present; when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb; R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc; R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd; R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F; R8 is selected from H and CH3; Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F; Rb is each independently selected from F, Cl, Br, I, OH and NH2; Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R; Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN; R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino; provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H. In some embodiments, the full-length antibody comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct is  administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0178] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises a scFv comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino  acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6; wherein the PVRIG-binding moiety comprises a full-length antibody comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the anti-TIGIT scFv is linked to N-or C-terminus of two heavy chains of the anti-PVRIG full-length antibody, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0179] wherein T1 is selected from O and N; R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra; when T1 is O, R2 is not present; when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb;

[0180] R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc; R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd;R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F; R8 is selected from H and CH3; Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F; Rb is each independently selected from F, Cl, Br, I, OH and NH2; Rc is  each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R; Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN; R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino; provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H. In some embodiments, the full-length antibody comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some  embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0181] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the construct comprises a first and a second heavy chain that comprise SEQ ID NO: 17, and a first and a second light chain that comprise SEQ ID NO: 18. In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the construct comprises a first and a second heavy chain that comprise SEQ ID NO: 19, and a first and a second light chain that comprise SEQ ID NO: 20, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,

[0182] wherein T1 is selected from O and N; R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra; when T1 is O, R2 is not present; when T1 is N, R2 is selected from H, C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (═O) -C1-3 alkyl and -S (═O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb;

[0183] R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc; R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd; R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F; R8 is selected from H and CH3; Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and  C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F; Rb is each independently selected from F, Cl, Br, I, OH and NH2; Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R; Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN; R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (═O) -C1-3 alkylamino; provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H. In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0184] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the KRAS G12C inhibitor is a compound is selected from

[0185] or a pharmaceutically acceptable salt thereof. In some embodiments, the KRAS G12C inhibitor is Compound 17 or a pharmaceutical acceptable salt thereof. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In  some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0186] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises a full-length antibody comprising two heavy chains and two light chains, and wherein PVRIG-binding moiety comprises a scFv, and wherein the anti-PVRIG scFv is linked to the N-or C-terminus of both heavy chains of the anti-TIGIT full-length antibody. In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2)  KRAS G12C inhibitor, wherein the PVRIG-binding moiety comprises a full-length antibody comprising two heavy chains and two light chains, and wherein TIGIT-binding moiety comprises a scFv, and wherein the anti-TIGIT scFv is linked to the N-or C-terminus of both heavy chains of the anti-PVRIG full-length antibody, wherein the KRAS G12C inhibitor is a compound is selected from

[0187] or a pharmaceutically acceptable salt thereof. In some embodiments, the KRAS G12C inhibitor is Compound 17 or a pharmaceutical acceptable salt thereof. In some embodiments, the full-length antibody comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor  is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0188] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6, wherein the KRAS G12C inhibitor is a compound is selected from

[0189] or a pharmaceutically acceptable salt thereof. In some embodiments, the KRAS G12C inhibitor is Compound 17 or a pharmaceutical acceptable salt thereof. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv  format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is  selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0190] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the PVRIG-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the KRAS G12C inhibitor is a compound is selected from

[0191] or a pharmaceutically acceptable salt thereof. In some embodiments, the KRAS G12C inhibitor is Compound 17 or a pharmaceutical acceptable salt thereof. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab  format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a  cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0192] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6; wherein the PVRIG-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the KRAS G12C inhibitor is a compound is selected from

[0193] or a pharmaceutically acceptable salt thereof. In some embodiments, the KRAS G12C inhibitor is Compound 17 or a pharmaceutical acceptable salt thereof. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal  cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0194] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) and a light chain variable region (VL) , and wherein the VH of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 13, and / or the VL of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 14 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 14, and / or wherein the PVRIG-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) and a light chain variable region (VL) , and wherein the VH of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 15 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 15, and / or the VL of the PVRIG-binding moiety comprises the amino acid sequence of  SEQ ID NO: 16 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 16. In some embodiments, the VH of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 13, and the VL of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 14. In some embodiments, the VH of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 15, and / or the VL of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 16, wherein the KRAS G12C inhibitor is a compound is selected from

[0195] or a pharmaceutically acceptable salt thereof. In some embodiments, the KRAS G12C inhibitor is Compound 17 or a pharmaceutical acceptable salt thereof. In some embodiments, the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format. In some embodiments, the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format. In some embodiments, the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct comprises: (a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety; (b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or (c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region. In some embodiments, one of the TIGIT-binding moiety and the PVRIG-binding moiety is a full-length antibody, and the other  is a scFv or VHH operably linked to the full-length antibody (e.g., via being linked to the N-or C-terminus of one or both of the heavy or light chains of the full-length antibody optionally via a linker) . In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0196] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises a full-length antibody comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a  LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6; wherein the PVRIG-binding moiety comprises a scFv comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the anti-PVRIG scFv is linked to N-or C-terminus of two heavy chains of the anti-TIGIT full-length antibody, wherein the KRAS G12C inhibitor is a compound is selected from

[0197] or a pharmaceutically acceptable salt thereof. In some embodiments, the KRAS G12C inhibitor is Compound 17 or a pharmaceutical acceptable salt thereof. In some embodiments, the full-length antibody comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate  cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0198] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the TIGIT-binding moiety comprises a scFv comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6; wherein the PVRIG-binding moiety comprises a full-length antibody comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3,  and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein: the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12, wherein the anti-TIGIT scFv is linked to N-or C-terminus of two heavy chains of the anti-PVRIG full-length antibody, wherein the KRAS G12C inhibitor is a compound is selected from

[0199] or a pharmaceutically acceptable salt thereof. In some embodiments, the KRAS G12C inhibitor is Compound 17 or a pharmaceutical acceptable salt thereof. In some embodiments, the full-length antibody comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof. In some embodiments, the human IgG Fc region is a human IgG1 Fc region or a variant thereof. In some embodiments, the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life. In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or  metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0200] In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the construct comprises a first and a second heavy chain that comprise SEQ ID NO: 17, and a first and a second light chain that comprise SEQ ID NO: 18. In some embodiments, there is provided a method of treating cancer (e.g., cancer comprising a KRAS mutation) in an individual, comprising administering to the individual 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor, wherein the construct comprises a first and a second heavy chain that comprise SEQ ID NO: 19, and a first and a second light chain that comprise SEQ ID NO: 20, wherein the KRAS G12C inhibitor is a compound is selected from

[0201] apharmaceutically acceptable salt thereof. In some embodiments, the KRAS G12C inhibitor is  Compound 17 or a pharmaceutical acceptable salt thereof. In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally. In some embodiments, the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is advanced, unresectable, and / or metastatic solid tumor. In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously, concurrently, or sequentially. In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct. In some embodiments, the method further comprises administering to the individual an effective amount of a third therapy comprising another anti-cancer agent, optionally wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents. In some embodiments, the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.

[0202] In some embodiments, the subject is a human. Cancer described herein include any kind of cancer that has a KRAS G12C mutation. A cancer (or a population of cancer cells) that comprises one or more cancer cells that express a KRAS G12C mutant protein is alternatively referred to herein as “aKRAS G12C mutant cancer. ” In some embodiments, the cancer (such as the KRAS G12C mutant cancer) is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear  cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma. In some embodiments, the cancer is an advanced, unresectable, and / or metastatic solid tumor.

[0203] In some embodiments, the construct binds TIGIT and PVRIG. Exemplary constructs that find use with the methods are described in further detail below.

[0204] In some embodiments, the KRAS G12C inhibitor is, e.g., a polypeptide (such as an antibody) , a peptide, an antisense oligonucleotide or a small molecule that inhibits the activity of the KRAS G12C mutant protein. In some embodiments, the KRAS G12C inhibitor is a small molecule. Exemplary small molecule KRAS G12C inhibitors that find use with the methods provided herein include, without limitation, e.g., Compound 17, sotorasib, adagrasib, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157. In some embodiments, the KRAS G12C inhibitor is Compound 17. Additional details regarding these and other exemplary small molecule KRAS G12C inhibitors are described in further detail below.

[0205] In some embodiments, the construct is administered intravenously or subcutaneously. In some embodiments, the KRAS G12C inhibitor is administered orally.

[0206] In some embodiments, the construct and the KRAS G12C inhibitor are administered simultaneously. In some embodiments, “simultaneous administration” means that the TIGIT / PVRIG-binding construct and the KRAS G12C inhibitor are administered with a time separation of no more than about 15 minute (s) , such as no more than about any of 10, 5, or 1 minutes. In some embodiments, simultaneous administration of the TIGIT / PVRIG-binding construct and the KRAS G12C inhibitor can be combined with supplemental doses of the TIGIT / PVRIG-binding construct and / or the KRAS G12C inhibitor. In some embodiments, the TIGIT / PVRIG-binding construct and the KRAS G12C inhibitor are administered sequentially. In some embodiments, “sequential administration” means that TIGIT / PVRIG-binding construct and the KRAS G12C inhibitor are administered with a time separation of more than about 15 minutes, such as more than about any of 20, 30, 40, 50, 60 or more minutes. For example, in some embodiments, the TIGIT / PVRIG-binding construct is administered prior to the small molecule KRAS G12C inhibitor. In some embodiments, the small molecule KRAS G12C inhibitor is  administered prior to the TIGIT / PVRIG-binding construct. In some embodiments, the administration of the TIGIT / PVRIG-binding construct and the KRAS G12C inhibitor are concurrent, i.e., the administration period of the TIGIT / PVRIG-binding construct and the KRAS G12C inhibitor overlap with each other. In some embodiments, the administration of the TIGIT / PVRIG-binding construct and the KRAS G12C inhibitor are non-concurrent.

[0207] In some embodiments, the construct is administered prior to the KRAS G12C inhibitor. In some embodiments, the KRAS G12C inhibitor is administered prior to the construct.

[0208] In some embodiments, the methods disclosed herein further comprise administering an effective amount of a third therapy. In some embodiments, the third therapy is another anti-cancer agent. The term “anti-cancer agent” or “anti-proliferative agent” means any agent that can be used to treat a cell proliferative disorder such as cancer, and includes, but is not limited to, cytotoxic agents, cytostatic agents, anti-angiogenic agents, debulking agents, chemotherapeutic agents, radiotherapy and radiotherapeutic agents, targeted anti-cancer agents, BRMs, therapeutic antibodies, cancer vaccines, cytokines, hormone therapies, radiation therapy and anti-metastatic agents and immunotherapeutic agents. It will be appreciated that, in selected embodiments as discussed above, such anti-cancer agents may comprise conjugates and may be associated with the disclosed antibodies prior to administration. More specifically, in certain embodiments selected anti-cancer agents will be linked to the unpaired cysteines of the engineered antibodies to provide engineered conjugates as set forth herein. Accordingly, such engineered conjugates are expressly contemplated as being within the scope of the present disclosure. In other embodiments, the disclosed anti-cancer agents will be given in combination with site-specific conjugates comprising a different therapeutic agent as set forth above.

[0209] In some embodiments, the KRAS G12C inhibitor (e.g., compound 17) is administered at a dose of 10mg / kg. In some embodiments, the KRAS G12C inhibitor (e.g., compound 17) is administered at a dose of 30 mg / kg. In some embodiments, the KRAS G12C inhibitor (e.g., compound 17) administered daily. In some embodiments, the KRAS G12C inhibitor (e.g., compound 17) administered orally.

[0210] In some embodiments, the construct that has a TIGIT binding moiety and a PVRIG binding moiety (e.g., a bispecific TIGIT / PVRIG antibody) is administered at a dose of about 13.3 mg / kg. In some embodiments, the construct that has a TIGIT binding moiety and a PVRIG binding  moiety (e.g., a bispecific TIGIT / PVRIG antibody) is administered twice a week. construct that has a TIGIT binding moiety and a PVRIG binding moiety (e.g., a bispecific TIGIT / PVRIG antibody) is administered intraperitoneally.

[0211] Constructs comprising a TIGIT-binding moiety and a PVRIG-binding moiety

[0212] The constructs provided herein include but not limited to multispecific antibodies, antigen-binding portions thereof, and fusion proteins comprising such multispecific antibodies or antigen-binding portions thereof.

[0213] In some embodiments, the TIGIT / PVRIG-binding construct described herein comprise a first antigen-binding moiety that specifically binds to PVRIG (e.g., human PVRIG) ( “PVRIG-binding moiety” ) and a second antigen-binding moiety that specifically binds to TIGIT (e.g., human TIGIT) ( “TIGIT-binding moiety” ) .

[0214] A. TIGIT

[0215] TIGIT, also known as WUCAM, Vstm3, and VSIG9, is a member of the Ig superfamily. Its expression is described in several human cancers, including melanoma, NSCLC, and colorectal cancer. The TIGIT receptor consists of an Ig variable domain, a transmembrane domain, and an immunoreceptor tyrosine-based inhibitory motif. Activated T cells, both regulatory CD4+ and effector CD8+, and NK cells, express TIGIT at cell surface and interact with the highest binding capacity to the poliovirus receptor (PVR) , also known as CD155, and, at weaker affinity to the nectin-2 receptor or Poliovirus receptor-related 2 (PVRL2) or CD112. Similarly, the costimulatory receptor CD226 is among the ligands of TIGIT, with a lower affinity to TIGIT binding, compared with the CD155. CD155 is an adhesion molecule, preferentially expressed on dendritic cells and macrophages, acting as a recognition molecule for NK cells. The interaction between CD155 and its ligand, TIGIT, was studied in different malignancies, including melanoma and NSCLC. In lung adenocarcinoma, immunohistochemical (IHC) overexpression of TIGIT / CD155 emerged as an unfavorable prognostic factor. The CD155 / TIGIT interaction is responsible for the negative regulation of the innate and adaptive immune responses at different levels. In response to CD155 / TIGIT pathway activation, T-cell receptor expression is reduced, resulting in impairment of NK cell and CD8 T-cell effector functions. Impaired T-cell activation is also a consequence of immunosuppressive cytokine release such as interleukin-10 by dendritic cells and decrease of  interleukin-12 production, which is favored by TIGIT engagement. Inhibition of CD226 signaling by disrupting homodimerization is among the known mechanisms of TIGIT inhibition in T cells. TIGIT expression in humans is a late event in the cancer-immunity cycle, occurring after chronic tumor antigen exposure. See Rousseau et al., ESMO Open. 2023 Apr; 8 (2) : 101184.

[0216] Although TIGIT continues to attract interest in the drug development field, clinical findings for novel antibodies targeting the checkpoint have been mixed. AntiTIGIT monotherapy resulted in objective response rates (ORRs) ranging from 0%to 5%across several trials in advanced solid tumors.

[0217] TIGIT can compete for ligand binding with CD226, replacing CD226 from CD155 binding, hence impairing antitumor immunity as demonstrated in mice and humans. In addition, TIGIT signaling in regulatory T cells (Tregs) enhances their immunosuppressive functions. In mice and humans TIGIT is highly expressed by a subset of natural Tregs and its upregulation in Tregs is associated with hypomethylation and Foxp3 binding at the TIGIT locus. TIGIT+ Tregs upregulate many Treg gene signature markers in tumors. They include Foxp3, Helios, neuropilin-1, CTLA-4, PD-1, TIM-3, and LAG-3. As with PD-1 / PD-L1, binding of TIGIT with its ligands can suppress T-cell function. This pathway is not redundant to the PD-1 / PD-L1 axis, but they display more than one similarity. Both PD-1 and TIGIT are increasingly upregulated in activated T lymphocytes, to prevent excessive immune responses. As with PD-1 / PD-L1, binding of TIGIT with its ligands can suppress T-cell function. This pathway is not redundant to the PD-1 / PD-L1 axis, but they display more than one similarity. Both PD-1 and TIGIT are increasingly upregulated in activated T lymphocytes, to prevent excessive immune responses. To date, accumulating data support the inhibition of TIGIT receptor to unleash the immune system against cancer cells, thereby countering the phenomenon of immune escape. Preclinical evidence and early-phase clinical trials prove the feasibility of exploiting novel drugs addressing ICIs’ combination, such as TIGIT and PD- (L) 1. See Rousseau et al., ESMO Open. 2023 Apr; 8 (2) : 101184.

[0218] Dual PD-1 and TIGIT blockade is a promising combinatorial immunotherapy of cancer. While each single blockade does not significantly impede growth of CT26 tumors in mice, dual TIGIT and PD-1 / PD-L1 blockade synergizes to augment proliferation and function of antitumor CD8+ T cells, resulting in protective memory T cells, complete tumor rejection, and prolonged overall survival. These effects are abrogated on CD8+ T cell depletion, supporting a critical role of  CD8+ T cell-mediated tumor reactivity. See e.g., Chauvin et al., J Immunother Cancer. 2020 Sep; 8 (2) : e000957.

[0219] According to a recent review, currently three trials are investigating anti-TIGIT therapies involving a) vibostolimab in a phase III study, b) etigilimab in a phase I study and c) tiragolumab in a phase III study. All of them involve a combination of TIGIT inhibitors and PD-1 / PD-L1 inhibitors for treating NSCLC. See Rousseau et al., ESMO Open. 2023 Apr; 8 (2) : 101184.

[0220] For tiragolumab, On March 2022, a press release announced interim results of the phase III SKYSCRAPER-01 study of tiragolumab plus atezolizumab in the first-line treatment of PD-L1-high, metastatic NSCLC. The trial did not meet its co-primary endpoint of PFS. However, as OS, the other co-primary endpoint, was immature, the study is still ongoing. The atezolizumab arm in CITYSCAPE underperformed, with 14.5 months of the median OS in all-round population and 12.8 months of the median OS in the high-expression PD-L1 group, whereas in IMpower110 it was 18 months in the all-round population and 20 months in the high-expression PD-L1 group. Thereby, positive result of phase II could be explained by this underperforming control arm, leading to phase III’s failure. See Rousseau et al., ESMO Open. 2023 Apr; 8 (2) : 101184.

[0221] B. PVRIG

[0222] PVRIG, also known as CD112R, has been discovered in the year of 2016. Being a recently discovered inhibitory receptor in this family, researches on this receptor are very limited compared with those on TIGIT, CD96 and CD226. PVRIG expresses on T cells and NK cells, and its expression on T cells increases with cell activation. Upregulation of PVRIG on CD8+ T cells causes their exhaustion in lymphocytic choriomeningitis virus infection. CD8+ T cells from PVRIG-deficient mice show stronger antigen-specific effector functions during acute Listeria monocytogenes infection. Furthermore, PVRIG-deficient mice display significantly reduced tumor growth due to enhanced CD8+ T cell function. Moreover, genetic knock-out of PVRIG in mice or treatment with anti-PVRIG mAb (both early and late treatments) significantly inhibited the exhaustion of NK cells and slowed tumor growth in several murine tumor models. See Li et al., J Hematol Oncol. 2021 Jun 26; 14 (1) : 100.

[0223] PVRIG may compete with TIGIT and CD226 for binding to CD112, and it is hypothesized that blockade of PVRIG / CD112 in addition to TIGIT / PVR blockade may allow CD226 to engage its ligands unencumbered. PVRIG is expressed on TILs and intratumoral NK  cells. In vitro experiments have demonstrated that a combination of anti-PVRIG and anti-TIGIT mAbs enhanced human TIL and NK cell effector function. Combination of anti-PVRIG with anti-PD-L1 reduced tumor growth as did anti-PD-L1 treatment in PVRIG- / -mice, indicating that combination of anti-PVRIG with anti-TIGIT may be another strategy worth investigating. See e.g., Chiang et al., Journal for ImmunoTherapy of Cancer 2022; 10: e004711.

[0224] C. TIGIT binding moieties

[0225] The TIGIT binding moieties discussed herein include any moieties that can bind to TIGIT (e.g., human TIGIT) . In some embodiments, the TIGIT binding moiety is an antibody moiety. In some embodiments, the TIGIT binding moiety is a small molecule. In some embodiments, the TIGIT binding moiety blocks the binding of TIGIT (e.g., human TIGIT) and CD155 (e.g., human CD155) . In some embodiments, the TIGIT binding moiety blocks the binding of TIGIT (e.g., human TIGIT) and CD112 (e.g., human CD112) . See e.g. Zhong et al., Journal for ImmunoTherapy of Cancer 2020; 8: doi: 10.1136 / jitc-2020-SITC2020.0184.

[0226] In some embodiments, the TIGIT binding moiety is a small molecule that specifically targets TIGIT. In some embodiments, the TIGIT binding moiety comprises liothyronine. See e.g., Zhou et al., Cell Commun Signal 18, 142 (2020) .

[0227] In some embodiments, the TIGIT binding moiety is an antibody moiety. In some embodiments, the TIGIT binding moiety (or the multispecific TIGIT / PVRIG antibody) binds to TIGIT protein (e.g., human, monkey or mouse TIGIT protein) with a KD of 1×10-10 M or less, a KD of 8×10-11 M or less, a KD of 6×10-11 M or less, a KD of 4×10-11 M or less, or a KD of 2×10-11 M or less. In some embodiments, the TIGIT binding moiety (or the multispecific TIGIT / PVRIG antibody) binds to TIGIT protein (e.g., human, monkey or mouse TIGIT protein) with a KD of 5×10-9 M or less, a KD of 4×10-9 M or less, or a KD of 3×10-9 M or less, as measured by Surface Plasmon Resonance.

[0228] In some embodiments, the TIGIT-binding moiety comprises the six CDRs, the VH and / or VL or the full sequences of an anti-TIGIT antibody known in the field. Exemplary anti-TIGIT antibodies include tiragolumab (RG6058) , domvanalimab (AB154) , vibostolimab (MK-7684) , ociperlimab (BGB-A1217) , BMS-986207, BMS-98620, EOS-448, MBSA43, ASP-8374, OMP-313M32, COM-902, etigilimab, IBI-939, AGEN-1307, PTZ-201 (ASP8374) , CASC-674,  NB-6253, PH-804, M6223, MTIG7192A, ociperlimab, and eos88448. See e.g., Rotte et al., Biomedicines. 2021 Sep; 9 (9) : 1277.

[0229] In some embodiments, the TIGIT-binding moiety comprises the six CDRs, the VH and / or VL or the full sequences of an anti-TIGIT antibody disclosed in any of US11,225,523B2, U.S. Pat. No. 9,499,596, WO 2016 / 191643, WO 2017 / 053748, WO2016 / 191643, WO 2016 / 028656, WO 2017 / 030823, US Patent Appl. No. 2016 / 0176963, WO 2017 / 037707, WO 2017 / 059095, WO 2016 / 106302, U.S. Patent Publication No. 2017281764, WO 2015 / 009856, U.S. Patent Application No. 20170037133, WO 2017 / 048824, U.S. Pat. No. 9,713,364, WO 2016 / 028656, all of which are incorporated herein by their entireties. In some embodiments, TIGIT-binding moiety comprises the six CDRs, the VH and / or VL or the full sequences of the 10A7, 1F4, 14A6, 28H5, 31C6, 15A6, 22G2, 11G11, or 10D7.

[0230] In some embodiments, the TIGIT-binding moiety comprises a heavy chain variable region (VH) and / or a light chain variable region (VL) , wherein A) the VH comprises heavy chain CDRs (HCDRs) comprising: (i) a HCDR1 comprising the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 1; (ii) a HCDR2 comprising the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 2; and (iii) a HCDR3 comprising the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 3; and B) the light chain comprises light chain CDRs (LCDRs) comprising: (i) a LCDR1 comprising the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 4; (ii) a LCDR2 comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 5; and (iii) a LCDR3 comprising the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 6.

[0231] In some embodiments, the TIGIT-binding moiety comprises a heavy chain variable region (VH) and a light chain variable region (VL) : wherein A) the VH comprises heavy chain CDRs (HCDRs) comprising: (i) a HCDR1 comprising the amino acid sequence of SEQ ID NO: 1;  (ii) a HCDR2 comprising the amino acid sequence of SEQ ID NO: 2; and (iii) a HCDR3 comprising the amino acid sequence of SEQ ID NO: 3; and B) the VL comprises light chain CDRs (LCDRs) comprising: (i) a LCDR1 comprising the amino acid sequence of SEQ ID NO: 4; (ii) a LCDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (iii) a LCDR3 comprising the amino acid sequence of SEQ ID NO: 6.

[0232] In some embodiments, the TIGIT-binding moiety comprises a heavy chain variable region (VH) and / or a light chain variable region (VL) : wherein (A) the VH comprises: (i) the amino acid sequence of SEQ ID NO: 13; (ii) an amino acid sequence at least about 80%, 85%, 90%, or 95%identical (preferably, at least 90%, more preferably, at least 95% (e.g., 95%, 96%, 97%, 98%, or 99%) ) to SEQ ID NO: 13; or (iii) an amino acid sequence with addition, deletion and / or substitution of one or more (e.g., one, two, three, or more, preferably one, two, or three, more preferably, one or two) amino acids compared with SEQ ID NO: 13; and / or (B) the VL comprises (i) the amino acid sequence of SEQ ID NO: 14; (ii) an amino acid sequence at least about 80%, 85%, at least 90%, or at least 95%identical (preferably, at least 90%, more preferably, at least 95%(e.g., 95%, 96%, 97%, 98%, or 99%) to SEQ ID NO: 14; or (iii) an amino acid sequence with addition, deletion and / or substitution of one or more (e.g., one, two, three, or more, preferably one, two, or three, more preferably, one or two) amino acids compared with SEQ ID NO: 14.

[0233] In some embodiments, the TIGIT-binding moiety comprises a scFv comprising the sequence set forth in SEQ ID NO: 23 or an amino acid sequence at least about 80%, 85%, 90%, or 95%identical (preferably, at least 90%, more preferably, at least 95% (e.g., 95%, 96%, 97%, 98%, or 99%) ) to SEQ ID NO: 23.

[0234] D. PVRIG binding moieties

[0235] The PVRIG binding moieties discussed herein include any moieties that can bind to PVRIG (e.g., human PVRIG) . In some embodiments, the PVRIG binding moiety is an antibody moiety. In some embodiments, the PVRIG binding moiety is a small molecule. In some embodiments, the PVRIG binding moiety blocks the binding of PVRIG (e.g., human PVRIG) and PVRL2 (e.g., human PVRL2) .

[0236] In some embodiments, the PVRIG binding moiety is a small molecule that specifically targets PVRIG.

[0237] In some embodiments, the PVRIG binding moiety is an antibody moiety. In some embodiments, the PVRIG binding moiety (or the multispecific TIGIT / PVRIG antibody) binds to PVRIG protein (e.g., human, monkey or mouse PVRIG protein) with a KD of 1×10-10 M or less, a KD of 8×10-11 M or less, a KD of 6×10-11 M or less, a KD of 4×10-11 M or less, or a KD of 2×10-11 M or less. In some embodiments, the PVRIG binding moiety (or the multispecific TIGIT / PVRIG antibody) binds to PVRIG protein (e.g., human, monkey or mouse PVRIG protein) with a KD of 5×10-9 M or less, a KD of 4×10-9 M or less, or a KD of 3×10-9 M or less, as measured by Surface Plasmon Resonance.

[0238] In some embodiments, the anti-PVRIG antibody (including antigen-binding fragments) both bind to PVRIG and prevent activation by PVRL2 (e.g. by blocking the interaction of PVRIG and PVLR2) .

[0239] In some embodiments, the PVRIG-binding moiety comprises the six CDRs, the VH and / or VL or the full sequences of an anti-PVRIG antibody known in the field. Exemplary PVRIG antibodies include COM701.

[0240] In some embodiments, the PVRIG-binding moiety comprises the six CDRs, the VH and / or VL or the full sequences of an anti-PVRIG antibody disclosed in any of US20210188974A1, US20210000952A1, US20190382477A1, US20230057899A1, WO2022069940A1, and EP3259597, all of which are incorporated herein by their entireties.

[0241] In some embodiments, the PVRIG-binding moiety comprises a heavy chain variable region (VH) and / or a light chain variable region (VL) , wherein A) the VH comprises heavy chain CDRs (HCDRs) comprising: (i) a HCDR1 comprising the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 7; (ii) a HCDR2 comprising the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 8; and (iii) a HCDR3 comprising the amino acid sequence of SEQ ID NO: 9 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 9; and B) the light chain comprises light chain CDRs (LCDRs) comprising: (i) a LCDR1 comprising the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 10; (ii) a LCDR2 comprising the amino acid  sequence of SEQ ID NO: 11 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 11; and (iii) a LCDR3 comprising the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 12.

[0242] In some embodiments, the PVRIG-binding moiety comprises a heavy chain variable region (VH) and a light chain variable region (VL) : wherein A) the VH comprises heavy chain CDRs (HCDRs) comprising: (i) a HCDR1 comprising the amino acid sequence of SEQ ID NO: 7; (ii) a HCDR2 comprising the amino acid sequence of SEQ ID NO: 8; and (iii) a HCDR3 comprising the amino acid sequence of SEQ ID NO: 9; and B) the VL comprises light chain CDRs (LCDRs) comprising: (i) a LCDR1 comprising the amino acid sequence of SEQ ID NO: 10; (ii) a LCDR2 comprising the amino acid sequence of SEQ ID NO: 11; and (iii) a LCDR3 comprising the amino acid sequence of SEQ ID NO: 12.

[0243] In some embodiments, the PVRIG-binding moiety comprises a heavy chain variable region (VH) and / or a light chain variable region (VL) : wherein (A) the VH comprises: (i) the amino acid sequence of SEQ ID NO: 15; (ii) an amino acid sequence at least about 80%, 85%, 90%, or 95%identical (preferably, at least 90%, more preferably, at least 95% (e.g., 95%, 96%, 97%, 98%, or 99%) ) to SEQ ID NO: 15; or (iii) an amino acid sequence with addition, deletion and / or substitution of one or more (e.g., one, two, three, or more, preferably one, two, or three, more preferably, one or two) amino acids compared with SEQ ID NO: 15; and / or (B) the VL comprises (i) the amino acid sequence of SEQ ID NO: 16; (ii) an amino acid sequence at least about 80%, 85%, at least 90%, or at least 95%identical (preferably, at least 90%, more preferably, at least 95%(e.g., 95%, 96%, 97%, 98%, or 99%) to SEQ ID NO: 16; or (iii) an amino acid sequence with addition, deletion and / or substitution of one or more (e.g., one, two, three, or more, preferably one, two, or three, more preferably, one or two) amino acids compared with SEQ ID NO: 16.

[0244] In some embodiments, the PVRIG-binding moiety comprises a scFv comprising the sequence set forth in SEQ ID NO: 23 or an amino acid sequence at least about 80%, 85%, 90%, or 95%identical (preferably, at least 90%, more preferably, at least 95% (e.g., 95%, 96%, 97%, 98%, or 99%) ) to SEQ ID NO: 23.

[0245] The binding of an antibody to TIGIT and PVRIG can be assessed using one or more techniques well established in the art, for instance, ELISA or FACS, which measures binding of the  antibody to soluble TIGIT / PVRIG protein or TIGIT / PVRIG protein expressed on cell surfaces, respectively. For example, an antibody can be tested by a flow cytometry assay in which the antibody is reacted with a cell line that expresses human TIGIT or human PVRIG, such as CHO cells that have been transfected to express TIGIT or PVRIG on their cell surface, or a TIGIT or PVRIG positive cell line, or a TIGIT and PVRIG double positive cell line.

[0246] In some embodiments, the multispecific antibodies as disclosed herein are characterized by particular functional features or properties. In some embodiments, the antibodies have one or more of the following properties: (a) specifically bind to human, cyno and mouse TIGIT; (b) specifically bind to human and cyno PVRIG; (c) could simultaneously bind to both TIGIT and PVRIG; (d) efficiently block the binding of PVRIG to PVRL2 and TIGIT to PVR; e) have no cross-activity to paralog proteins of TIGIT and PVRIG; (f) show better effect in Reporter Gene assay, NK cell killing and T cell activation assays than control antibodies (WBP364-BMK1 and WBPT117-BMK1) and even the combination of the control antibodies; (g) have good antibody developability, including thermal stability, solubility, hydrophobicity and stress stability; (h) significantly improved efficacy in treating cancer when combined with an anti-PD-L1 antibody, as demonstrated in in vivo mouse model; and / or (i) have acceptable pharmacokinetic profiles in monkeys.

[0247] In some embodiments, the control antibody is a monoclonal antibody, such as a monoclonal anti-TIGIT antibody. In some embodiments, the control antibody is WBP364-BMK1 as shown in Table 2. In some embodiments, the control antibody is a monoclonal anti-PVRIG antibody. In some embodiments, the control antibody is WBPT117-BMK1 as shown in Table 2. In some embodiments, the control antibody is the parental antibody from which the multispecific antibodies are derived and constructed. In some embodiments, the control antibody is W3642 and / or WT1175.

[0248] In some embodiments, the multispecific constructs as disclosed herein have a higher binding affinity to TIGIT as compared to monospecific anti-TIGIT antibodies or other anti-TIGIT / PVRIG multispecific antibodies. In some embodiments, the multispecific constructs as disclosed herein have binding affinity to TIGIT that is at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%higher than monospecific anti-TIGIT antibodies, as measured by SPR or FACS.

[0249] In some embodiments, the multispecific constructs as disclosed herein have a higher or comparable binding affinity to PVRIG as compared to monospecific anti-PVRIG antibodies or other anti-TIGIT / PVRIG multispecific antibodies. In some embodiments, the multispecific constructs as disclosed herein have binding affinity to PVRIG that is at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%higher than monospecific anti-PVRIG antibodies or other anti-TIGIT / PVRIG multispecific antibodies, as measured by FACS.

[0250] The anti-TIGIT / PVRIG antibodies as disclosed herein can inhibit interactions between TIGIT and its ligand PVR (CD155) and between PVRIG and PVRL2 (CD112) . The blockade of these signaling pathways can e.g., restore a functional response by T-cells (e.g., proliferation, cytokine production, target cell killing) from a dysfunctional state to antigen stimulation.

[0251] The ability of an antibody to inhibit interactions between antigens and their ligands may be evaluated by measuring whether physical interactions between e.g. TIGIT and PVR decrease in a binding assay. In some embodiments, the binding assay is a competitive binding assay. The assay may be performed in various formats, such as but not limited to an ELISA assay, flow cytometry, a surface plasmon resonance (SPR) assay (e.g., BiacoreTM) , or BioLayer interferometry (e.g., ForteBio OctetTM) .

[0252] E. Antibody moieties (e.g., anti-TIGIT or anti-PVRIG antibody moiety) in the construct

[0253] The antibody moieties described herein (such as anti-TIGIT antibody moiety or anti-PVRIG antibody moiety) can have any one or more of the features described below.

[0254] In some embodiments, the antibody moiety comprises an Fc fragment. In some embodiments, the antibody moiety comprises a scFv. In some embodiments the antibody moiety comprises a scFv fused to an Fc fragment. In some embodiments, the antibody moiety comprises a scFv fused to an Fc fragment via a peptide linker. In some embodiments, the Fc fragment is a human IgG1 Fc fragment. In some embodiments, the Fc fragment comprises one or more mutations to increase clearance or decrease half-life.

[0255] In some embodiments, the Fc fragment comprises an immunoglobulin IgG heavy chain constant region comprising a hinge region (starting at Cys226) , an IgG CH2 domain and CH3 domain. The term “hinge region” or “hinge sequence” as used herein refers to the amino acid sequence located between the linker and the CH2 domain. In some embodiments, the fusion protein comprises an Fc fragment comprising a hinge region. In some embodiments, the Fc fragment of the  fusion protein starts at the hinge region and extends to the C-terminus of the IgG heavy chain. In some embodiments, the fusion protein comprises an Fc fragment that does not comprise the hinge region.

[0256] In some embodiments, the antibody moiety comprises an Fc fragment selected from the group consisting of Fc fragments from IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof. In some embodiments, the Fc fragment is derived from a human IgG. In some embodiments, the Fc fragment comprises the Fc region of human IgG1, IgG2, IgG3, IgG4, or a combination or hybrid IgG. In some embodiments, the Fc fragment is an IgG1 Fc fragment. In some embodiments, the Fc fragment comprises the CH2 and CH3 domains of IgG1. In some embodiments, the Fc fragment is an IgG4 Fc fragment. In some embodiments, the Fc fragment comprises the CH2 and CH3 domains of IgG4. IgG4 Fc is known to exhibit less effector activity than IgG1 Fc, and thus may be desirable for some applications. In some embodiments, the Fc fragment is derived from of a mouse immunoglobulin.

[0257] In some embodiments, the IgG CH2 domain starts at Ala231. In some embodiments, the CH3 domain starts at Gly341. It is understood that the C-terminus Lys residue of human IgG can be optionally absent. It is also understood that conservative amino acid substitutions of the Fc region without affecting the desired structure and / or stability of Fc is contemplated within the scope of the invention.

[0258] Heterodimerization of non-identical polypeptides in the Fc fragments of the antibody moieties can be facilitated by methods known in the art, including without limitation, heterodimerization by the knob-into-hole technology. The structure and assembly method of the knob-into-hole technology can be found in, e.g., US5,821,333, US7,642,228, US 201 1 / 0287009 and PCT / US2012 / 059810, hereby incorporated by reference in their entireties. This technology was developed by introducing a “knob” (or a protuberance) by replacing a small amino acid residue with a large one in the CH3 domain of one Fc and introducing a “hole” (or a cavity) in the CH3 domain of the other Fc by replacing one or more large amino acid residues with smaller ones. In some embodiments, one chain of the Fc fragment in the fusion protein comprises a knob, and the second chain of the Fc fragment comprises a hole.

[0259] The preferred residues for the formation of a knob are generally naturally occurring amino acid residues and are preferably selected from arginine (R) , phenylalanine (F) , tyrosine (Y)  and tryptophan (W) . Most preferred are tryptophan and tyrosine. In one embodiment, the original residue for the formation of the knob has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine or valine. Exemplary amino acid substitutions in the CH3 domain for forming the knob include without limitation the T366W, T366Y or F405W substitution.

[0260] The preferred residues for the formation of a hole are usually naturally occurring amino acid residues and are preferably selected from alanine (A) , serine (S) , threonine (T) and valine (V) . In one embodiment, the original residue for the formation of the hole has a large side chain volume, such as tyrosine, arginine, phenylalanine or tryptophan. Exemplary amino acid substitutions in the CH3 domain for generating the hole include without limitation the T366S, L368A, F405A, Y407A, Y407T and Y407V substitutions. In certain embodiments, the knob comprises T366W substitution, and the hole comprises the T366S / L368A / Y407V substitutions. It is understood that other modifications to the Fc region known in the art that facilitate heterodimerization are also contemplated and encompassed by the instant application.

[0261] Other antibody moiety variants comprises any of the variants described herein (e.g., Fc variants, effector function variants, glycosylation variants, cysteine engineered variants) , or combinations thereof, are contemplated.

[0262] a) Antibody affinity

[0263] Binding specificity of the antibody moieties can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA-, RIA-, ECL-, IRMA-, EIA-, BIACORETM -tests and peptide scans.

[0264] In some embodiments, the KD of the binding between the antibody moiety and the target antigen (e.g., TIGIT or PVRIG) is about 10-7 M to about 10-12 M, about 10-7 M to about 10-8 M, about 10-8 M to about 10-9 M, about 10-9 M to about 10-10 M, about 10-10 M to about 10-11 M, about 10-11 M to about 10-12 M, about 10-7 M to about 10-12 M, about 10-8 M to about 10-12 M, about 10-9 M to about 10-12 M, about 10-10 M to about 10-12 M, about 10-7 M to about 10-11 M, about 10-8 M to about 10-11 M, about 10-9 M to about 10-11 M, about 10-7 M to about 10-10 M, about 10-8 M to about 10-10 M, or about 10-7 M to about 10-9 M. In some embodiments, the KD of the binding between the antibody moiety and the target antigen (e.g., TIGIT or PVRIG) is stronger than about any one of 10-7 M, 10-8 M, 10-9 M, 10-10 M, 10-11 M, or 10-12 M. In some embodiments, the target antigen (e.g., TIGIT or PVRIG) is a human antigen.

[0265] In some embodiments, the Kon of the binding between the antibody moiety and the target antigen (e.g., TIGIT or PVRIG) is about 103 M-1s-1 to about 108 M-1s-1, about 103 M-1s-1 to about 104 M-1s-1, about 104 M-1s-1 to about 105 M-1s-1, about 105 M-1s-1 to about 106 M-1s-1, about 106 M-1s-1 to about 107 M-1s-1, or about 107 M-1s-1 to about 108 M-1s-1. In some embodiments, the Kon of the binding between the antibody moiety and the target antigen (e.g., TIGIT or PVRIG) is about 103 M-1s-1 to about 105 M-1s-1, about 104 M-1s-1 to about 106 M-1s-1, about 105 M-1s-1 to about 107 M-1s-1, about 106 M-1s-1 to about 108 M-1s-1, about 104 M-1s-1 to about 107 M-1s-1, or about 105 M-1s-1 to about 108 M-1s-1. In some embodiments, the Kon of the binding between the antibody moiety and the target antigen (e.g., TIGIT or PVRIG) is no more than about any one of 103 M-1s-1, 104 M-1s-1, 105 M-1s-1, 106 M-1s-1, 107 M-1s-1 or 108 M-1s-1. In some embodiments, the target antigen (e.g., TIGIT or PVRIG) is human antigen.

[0266] In some embodiments, the Koff of the binding between the antibody moiety and the target antigen (e.g., TIGIT or PVRIG) is about 1 s-1 to about 10-6 s-1, about 1 s-1 to about 10-2 s-1, about 10-2 s-1 to about 10-3 s-1, about 10-3 s-1 to about 10-4 s-1, about 10-4 s-1 to about 10-5 s-1, about 10-5 s-1 to about 10-6 s-1, about 1 s-1 to about 10-5 s-1, about 10-2 s-1 to about 10-6 s-1, about 10-3 s-1 to about 10-6 s-1, about 10-4 s-1 to about 10-6 s-1, about 10-2 s-1 to about 10-5 s-1, or about 10-3 s-1 to about 10-5 s-1. In some embodiments, the Koff of the binding between the antibody moiety and the target antigen (e.g., TIGIT or PVRIG) is at least about any one of 1 s-1, 10-2 s-1, 10-3 s-1, 10-4 s-1, 10-5 s-1 or 10-6 s-1. In some embodiments, the target antigen (e.g., TIGIT or PVRIG) is human antigen. b) Chimeric or humanized antibodies

[0267] In some embodiments, the antibody moiety is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81: 6851-6855 (1984) ) . In some embodiments, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from mouse) and a human constant region. In some embodiments, a chimeric antibody is a “class switched” antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.

[0268] In some embodiments, a chimeric antibody is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived) , e.g., to restore or improve antibody specificity or affinity.

[0269] Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008) , and are further described, e.g., in Riechmann et al., Nature 332: 323-329 (1988) ; Queen et al., Proc. Nat’l Acad. Sci. USA 86: 10029-10033 (1989) ; US Patent Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., Methods 36: 25-34 (2005) (describing SDR (a-CDR) grafting) ; Padlan, Mol. Immunol. 28: 489-498 (1991) (describing “resurfacing” ) ; Dall’Acqua et al., Methods 36: 43-60 (2005) (describing “FR shuffling” ) ; and Osbourn et al., Methods 36: 61-68 (2005) and Klimka et al., Br. J. Cancer, 83: 252-260 (2000) (describing the “guided selection” approach to FR shuffling) .

[0270] Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the “best-fit” method (see, e.g., Sims et al. J. Immunol. 151: 2296 (1993) ) ; Framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89: 4285 (1992) ; and Presta et al. J. Immunol., 151: 2623 (1993) ) ; human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008) ) ; and framework regions derived from screening FR libraries (see, e.g., Baca et al., J. Biol. Chem. 272: 10678-10684 (1997) and Rosok et al., J. Biol. Chem. 271: 22611-22618 (1996) ) .

[0271] c) Human antibodies

[0272] In some embodiments, the antibody moiety is a human antibody (known as human domain antibody, or human DAb) . Human antibodies can be produced using various techniques  known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) , Lonberg, Curr. Opin. Immunol. 20: 450-459 (2008) , and Chen, Mol. Immunol. 47 (4) : 912-21 (2010) . Transgenic mice or rats capable of producing fully human single-domain antibodies (or DAb) are known in the art. See, e.g., US20090307787A1, U.S. Pat. No. 8,754,287, US20150289489A1, US20100122358A1, and WO2004049794.

[0273] Human antibodies (e.g., human DAbs) may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal’s chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, Nat. Biotech. 23: 1117-1125 (2005) . See also, e.g., U.S. Patent Nos. 6,075,181 and 6,150,584 describing XENOMOUSETM technology; U.S. Patent No. 5,770,429 describing  technology; U.S. Patent No. 7,041,870 describing K-M  technology, and U.S. Patent Application Publication No. US 2007 / 0061900, describing technology) . Human variable regions from intact antibodies generated by such animals may be further modified, e.g., by combining with a different human constant region.

[0274] Human antibodies (e.g., human DAbs) can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described (See, e.g., Kozbor J. Immunol., 133: 3001 (1984) ; Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987) ; and Boerner et al., J. Immunol., 147: 86 (1991) ) . Human antibodies generated via human B-cell hybridoma technology are also described in Li et al., Proc. Natl. Acad. Sci. USA, 103: 3557-3562 (2006) . Additional methods include those described, for example, in U.S. Patent No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26 (4) : 265-268 (2006) (describing human-human hybridomas) . Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20 (3) : 927-937 (2005) and Vollmers and  Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27 (3) : 185-91 (2005) .

[0275] Human antibodies (e.g., human DAbs) may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.

[0276] d) Library-derived antibodies

[0277] The antibody moieties may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O’Brien et al., ed., Human Press, Totowa, NJ, 2001) and further described, e.g., in the McCafferty et al., Nature 348: 552-554; Clackson et al., Nature 352: 624-628 (1991) ; Marks et al., J. Mol. Biol. 222: 581-597 (1992) ; Marks and Bradbury, in Methods in Molecular Biology 248: 161-175 (Lo, ed., Human Press, Totowa, NJ, 2003) ; Sidhu et al., J. Mol. Biol. 338 (2) : 299-310 (2004) ; Lee et al., J. Mol. Biol. 340 (5) : 1073-1093 (2004) ; Fellouse, Proc. Natl. Acad. Sci. USA 101 (34) : 12467-12472 (2004) ; and Lee et al., J. Immunol. Methods 284 (1-2) : 119-132 (2004) . Methods for constructing single-domain antibody libraries have been described, for example, see U.S. Pat. NO. 7371849.

[0278] In certain phage display methods, repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994) . Phage typically displays antibody fragments, either as scFv fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993) . Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and  Winter, J. Mol. Biol., 227: 381-388 (1992) . Patent publications describing human antibody phage libraries include, for example: US Patent No. 5, 750, 373, and US Patent Publication Nos. 2005 / 0079574, 2005 / 0119455, 2005 / 0266000, 2007 / 0117126, 2007 / 0160598, 2007 / 0237764, 2007 / 0292936, and 2009 / 0002360.

[0279] Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.

[0280] e) Substitution, insertion, deletion and variants

[0281] In some embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the HVRs (or CDRs) and FRs. Conservative substitutions are shown in Table 1 under the heading of “Preferred substitutions. ” More substantial changes are provided in Table 1 under the heading of “exemplary substitutions, ” and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained / improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.

[0282] Table 1. Amino acid substitutions

[0283] Amino acids may be grouped according to common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.

[0284] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.

[0285] One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody) . Generally, the resulting variant (s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and / or will have substantially retained certain biological properties of the parent antibody. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity) .

[0286] Alterations (e.g., substitutions) may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR “hotspots, ” i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207: 179-196 (2008) ) , and / or SDRs (a-CDRs) , with the resulting variant VH or VL being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O’Brien et al., ed., Human Press, Totowa, NJ, (2001) ) . In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis) . A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.

[0287] In some embodiments, substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs. Such alterations may be outside of HVR “hotspots” or CDRs. In some embodiments of the variant VHH sequences provided above, each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.

[0288] A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science, 244: 1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or  eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.

[0289] Amino acid sequence insertions include amino-and / or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N-or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.

[0290] f) Glycosylation variants

[0291] In some embodiments, the antibody moiety is altered to increase or decrease the extent to which the construct is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.

[0292] Where the antibody moiety comprises an Fc region, the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15: 26-32 (1997) . The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc) , galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the “stem” of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in the antibody moiety may be made in order to create antibody variants with certain improved properties.

[0293] In some embodiments, the antibody moiety has a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. For example, the amount of fucose in such antibody may be from 1%to 80%, from 1%to 65%, from 5%to 65%or from 20%to 40%. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e.g., complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008 / 077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (EU numbering of Fc region residues) ; however, Asn297 may also be located  about ± 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003 / 0157108 (Presta, L. ) ; US 2004 / 0093621 (Kyowa Hakko Kogyo Co., Ltd) . Examples of publications related to “defucosylated” or “fucose-deficient” antibody variants include: US 2003 / 0157108; WO 2000 / 61739; WO 2001 / 29246; US 2003 / 0115614; US 2002 / 0164328; US 2004 / 0093621; US 2004 / 0132140; US 2004 / 0110704; US 2004 / 0110282; US 2004 / 0109865; WO 2003 / 085119; WO 2003 / 084570; WO 2005 / 035586; WO 2005 / 035778; WO2005 / 053742; WO2002 / 031140; Okazaki et al. J. Mol. Biol. 336: 1239-1249 (2004) ; Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004) . Examples of cell lines capable of producing defucosylated antibodies include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249: 533-545 (1986) ; US Patent Application No. US 2003 / 0157108 A1, Presta, L; and WO 2004 / 056312 A1, Adams et al., especially at Example 11) , and knockout cell lines, such as alpha-1, 6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004) ; Kanda, Y. et al., Biotechnol. Bioeng., 94 (4) : 680-688 (2006) ; and WO2003 / 085107) .

[0294] In some embodiments, the antibody moiety has bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and / or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003 / 011878 (Jean-Mairet et al. ) ; US Patent No. 6,602, 684 (Umana et al. ) ; and US 2005 / 0123546 (Umana et al. ) . Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997 / 30087 (Patel et al. ) ; WO 1998 / 58964 (Raju, S. ) ; and WO 1999 / 22764 (Raju, S. ) .

[0295] g) Fc region variants

[0296] In some embodiments, one or more amino acid modifications may be introduced into the Fc region of the antibody moiety, thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.

[0297] In some embodiments, the Fc fragment possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody moiety in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious. In vitro and / or in vivo cytotoxicity assays can be conducted to confirm the reduction / depletion of CDC and / or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcγR binding (hence likely lacking ADCC activity) , but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express FcγRIII only, whereas monocytes express FcγRI, FcγRII and FcγRIII. FcR expression on hematopoietic cells is summarized in Table 2 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-492 (1991) . Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Patent No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat’l Acad. Sci. USA 83: 7059-7063 (1986) ) and Hellstrom, I et al., Proc. Nat’l Acad. Sci. USA 82: 1499-1502 (1985) ; 5,821,337 (see Bruggemann, M. et al., J. Exp. Med. 166: 1351-1361 (1987) ) . Alternatively, non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, CA; and CytoTox  non-radioactive cytotoxicity assay (Promega, Madison, WI) . Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat’ l Acad. Sci. USA 95: 652-656 (1998) . C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. See, e.g., C1q and C3c binding ELISA in WO 2006 / 029879 and WO 2005 / 100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996) ; Cragg, M.S. et al., Blood 101: 1045-1052 (2003) ; and Cragg, M.S. and M.J. Glennie, Blood 103: 2738-2743 (2004) ) . FcRn binding and in vivo clearance / half-life determinations can also be performed using methods known in the art (see, e.g., Petkova, S.B. et al., Int’l. Immunol. 18 (12) : 1759-1769 (2006) ) .

[0298] Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056) . Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270,  297 and 327, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581) .

[0299] Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Patent No. 6,737,056; WO 2004 / 056312, and Shields et al., J. Biol. Chem. 9 (2) : 6591-6604 (2001) . )

[0300] In some embodiments, the Fc fragment is an IgG1 Fc fragment. In some embodiments, the IgG1 Fc fragment comprises a L234A mutation and / or a L235A mutation. In some embodiments, the Fc fragment is an IgG2 or IgG4 Fc fragment. In some embodiments, the Fc fragment is an IgG4 Fc fragment comprising a S228P, F234A, and / or a L235A mutation.

[0301] In some embodiments, the antibody moiety comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and / or 334 of the Fc region (EU numbering of residues) .

[0302] In some embodiments, alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1q binding and / or Complement Dependent Cytotoxicity (CDC) , e.g., as described in US Patent No. 6,194,551, WO 99 / 51642, and Idusogie et al. J. Immunol. 164: 4178-4184 (2000) .

[0303] In some embodiments, the antibody moiety variant comprising a variant Fc region comprising one or more amino acid substitutions which alters half-life and / or changes binding to the neonatal Fc receptor (FcRn) . Antibodies with increased half-lives and improved binding to the neonatal Fc receptor (FcRn) , which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117: 587 (1976) and Kim et al., J. Immunol. 24: 249 (1994) ) , are described in US2005 / 0014934A1 (Hinton et al. ) . Those antibodies comprise an Fc region with one or more substitutions therein which alters binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues, e.g., substitution of Fc region residue 434 (US Patent No. 7,371,826) .

[0304] See also Duncan &Winter, Nature 322: 738-40 (1988) ; U.S. Patent No. 5,648,260; U.S. Patent No. 5,624,821; and WO 94 / 29351 concerning other examples of Fc region variants.

[0305] h) Cysteine engineered antibody variants

[0306] In some embodiments, it may be desirable to create cysteine engineered antibody moieties, e.g., “thioMAbs, ” in which one or more residues of an antibody are substituted with cysteine residues. In particular embodiments, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. In some embodiments, any one or more of the following residues may be substituted with cysteine: A118 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region. Cysteine engineered antibody moieties may be generated as described, e.g., in U.S. Patent No. 7,521,541.

[0307] i) Antibody derivatives

[0308] In some embodiments, the antibody moiety described herein may be further modified to comprise additional nonproteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG) , copolymers of ethylene glycol / propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1, 3, 6-trioxane, ethylene / maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers) , and dextran or poly (n-vinyl pyrrolidone) polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide / ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol) , polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and / or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in diagnosis under defined conditions, etc.

[0309] In some embodiments, the antibody moiety may be further modified to comprise one or more biologically active protein, polypeptides or fragments thereof. “Bioactive” or “biologically active” , as used herein interchangeably, means showing biological activity in the body to carry out a specific function. For example, it may mean the combination with a particular

[0310] F. Form of the TIGIT / PVRIG multispecific constructs and Exemplary TIGIT / PVRIG multispecific antibodies

[0311] biomolecule such as protein, DNA, etc., and then promotion or inhibition of the activity of such biomolecule. In some embodiments, the bioactive protein or fragments thereof include proteins and polypeptides that are administered to patients as the active drug substance for prevention of or treatment of a disease or condition, as well as proteins and polypeptides that are used for diagnostic purposes, such as enzymes used in diagnostic tests or in vitro assays, as well as proteins and polypeptides that are administered to a patient to prevent a disease such as a vaccine.

[0312] Multispecific constructs described herein can have any form as far as the construct maintains its function of binding to both TIGIT and PVRIG.

[0313] In some embodiments, the TIGIT antibody moiety comprises a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the anti-PVRIG antibody moiety is fused to the one or two heavy chains of the full-length antibody. In some embodiments, the anti-PVRIG antibody moiety is fused to N-terminus of the one or two heavy chains of the full-length antibody. In some embodiments, the anti-PVRIG antibody moiety is fused to C-terminus of the one or two heavy chains of the full-length antibody. In some embodiments, the anti-PVRIG antibody moiety is fused to the one or two light chains of the full-length antibody. In some embodiments, the anti-PVRIG antibody moiety is fused to the N-terminus of the one or two light chains of the full-length antibody. In some embodiments, the anti-PVRIG antibody moiety is fused to the C-terminus of the one or two light chains of the full-length antibody. In some embodiments, the anti-PVRIG antibody moiety is a scFv antibody such as a scFv antibody comprising a HCDR1 comprising an amino acid sequence of SEQ ID NO: 7, a HCDR2 comprising an amino acid sequence of SEQ ID NO: 8, a HCDR3 comprising an amino acid sequence of SEQ ID NO: 9, a LCDR1 comprising an amino acid sequence of SEQ ID NO: 10, a LCDR2 comprising an amino acid sequence of SEQ ID NO: 11, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 12.

[0314] In some embodiments, the anti-PVRIG antibody moiety comprises a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the anti-TIGIT antibody moiety is fused to the one or two heavy chains of the full-length antibody. In some embodiments, the anti-TIGIT antibody moiety is fused to N-terminus of the one or two heavy chains of the full-length antibody. In some embodiments, the anti-TIGIT antibody moiety is fused to C-terminus of the one or two heavy chains of the full-length antibody. In some embodiments, the anti-TIGIT antibody moiety is fused to the one or two light chains of the full-length antibody. In some embodiments, the anti-TIGIT antibody moiety is fused to the N-terminus of the one or two light chains of the full-length antibody. In some embodiments, the anti-TIGIT antibody moiety is fused to the C-terminus of the one or two light chains of the full-length antibody. In some embodiments, the anti-TIGIT antibody moiety is a scFv antibody such as a scFv antibody comprising a HCDR1 comprising an amino acid sequence of SEQ ID NO: 1, a HCDR2 comprising an amino acid sequence of SEQ ID NO: 2, a HCDR3 comprising an amino acid sequence of SEQ ID NO: 3, a LCDR1 comprising an amino acid sequence of SEQ ID NO: 4, a LCDR2 comprising an amino acid sequence of SEQ ID NO: 5, and LCDR3 comprising an amino acid sequence of SEQ ID NO: 6.

[0315] In some embodiments, the TIGIT / PVRIG-binding construct as disclosed herein comprise more than one antigen-binding moieties that specifically bind to PVRIG and / or more than one antigen-binding moieties that specifically binds to TIGIT. Usually, for a multispecific antibody, said more than one antigen-binding moieties have the same variable regions (thus targeting the same antigen / epitope) , or are completely the same in the variable regions and constant regions (if present) . For example, the antibodies may comprise two same PVRIG-binding moieties and one TIGIT-binding moiety, or one PVRIG-binding moiety and two same TIGIT-binding moieties, or two same PVRIG-binding moieties and two same TIGIT-binding moieties. In addition, where two PVRIG-binding moieties or two TIGIT-binding moieties are present, these moieties may adopt the following formats: (i) the TIGIT-binding moieties are Fabs while the PVRIG-binding moieties are scFvs, (ii) the TIGIT-binding moieties are scFvs while the PVRIG-binding moieties are Fabs, or (iii) the TIGIT-binding moieties and PVRIG-binding moieties are all Fabs.

[0316] In some specific embodiments, the TIGIT / PVRIG-binding construct comprises a TIGIT-binding moiety in a Fab format comprising a first heavy chain variable domain (VH1) operably linked to an antibody heavy chain CH1 domain (VH1-CH1) , and a first light chain variable domain  (VL1) operably linked to an antibody light chain constant (CL) domain (VL1-CL) , and the PVRIG-binding moiety is in scFv format comprising a second heavy chain variable domain (VH2) operably linked to a second light chain variable domain (VL2) (VH2-VL2) . The PVRIG-binding scFv may be located at the N-terminal or C-terminal of the heavy chain or light chain of the multispecific construct, and within the scFv, VH2 may be at the N-terminal of VL2 or vice versa. In some embodiments, the domains are operably linked by a linker. In some embodiments, the linker is a polypeptide linker.

[0317] In some specific embodiments, the TIGIT-binding moiety is in Fab format comprising a first heavy chain variable domain (VH1) operably linked to an antibody heavy chain CH1 domain (VH1-CH1) , and a first light chain variable domain (VL1) operably linked to an antibody light chain constant (CL) domain (VL1-CL) , and the PVRIG-binding moiety is in scFv format comprising a second heavy chain variable domain (VH2) operably linked to a second light chain variable domain (VL2) (VH2-VL2) . In some embodiments, the PVRIG-binding scFv is located C-terminal of the heavy chain of the multispecific construct, and within the scFv, VH2 may be at the N-terminal of VL2 or vice versa. In some embodiments, the domains are operably linked by a linker. In some embodiments, the linker is a polypeptide linker.

[0318] In some embodiments, the PVRIG scFv comprises (and in some embodiments consists of) the amino acid sequence of SEQ ID NO: 24, or a variant thereof having at least about at least 85%, 90%, or 95%sequence identity (preferably, at least 90%, more preferably, at least 95% (e.g., 95%, 96%, 97%, 98%, or 99%) ) sequence identity. In some embodiments, the PVRIG scFv comprises the amino acid sequence of SEQ ID NO: 24. In some embodiments, the PVRIG scFv is the amino acid sequence of SEQ ID NO: 24.

[0319] In some embodiments, the PVRIG-binding scFv is located at the C terminus of the heavy chain of the multispecific construct, and within the scFv, VH2 is N-terminal of VL2 (VH2-VL2) . In some embodiments, the multispecific construct comprises (and in some embodiments consists of) the amino acid sequence of SEQ ID NO: 17, or a variant thereof having at least about at least 85%, 90%, or 95%sequence identity (preferably, at least 90%, more preferably, at least 95%(e.g., 95%, 96%, 97%, 98%, or 99%) ) sequence identity. In some embodiments, the construct comprises the amino acid sequence SEQ ID NO: 17. In some embodiments, the construct is the amino acid sequence SEQ ID NO: 17.

[0320] In some embodiments, the VL1-CL1 of the TIGIT-binding moiety comprises (and in some embodiments consists of) the amino acid sequence of SEQ ID NO: 18, or a variant thereof having at least about at least 85%, 90%, or 95%sequence identity (preferably, at least 90%, more preferably, at least 95% (e.g., 95%, 96%, 97%, 98%, or 99%) ) sequence identity. In some embodiments, the construct comprises the amino acid sequence SEQ ID NO: 18. In some embodiments, the construct is the amino acid sequence SEQ ID NO: 18.

[0321] In some specific embodiments, the TIGIT-binding moiety is in scFv format comprising a first VH operably linked to a first VL (VH1-VL1) , and the PVRIG-binding moiety is in Fab format comprising a second VH operably linked to an antibody heavy chain CH1 domain (VH2-CH1) , and a second VL operably linked to an antibody light chain constant (CL) domain (VL2-CL) . The TIGIT-binding scFv may be located at the N-terminal or C-terminal of the heavy chain or light chain of the multispecific construct, and within the scFv, VH1 may be at the N-terminal of VL1 or vice versa. In some embodiments, the domains are operably linked by a linker. In some embodiments, the linker is a polypeptide linker.

[0322] In some specific embodiments, the TIGIT-binding moiety is in scFv format comprising a first VH operably linked to a first VL (VH1-VL1) , and the PVRIG-binding moiety is in Fab format comprising a second VH operably linked to an antibody heavy chain CH1 domain (VH2-CH1) , and a second VL operably linked to an antibody light chain constant (CL) domain (VL2-CL) . In some embodiments, the TIGIT-binding scFv is located at the N-terminus of the heavy chain of the multispecific construct, and within the scFv, VH1 may be at the N-terminal of VL1 or vice versa. In some specific embodiments, the TIGIT-binding moiety is in scFv format comprising a first VH operably linked to a first VL (VH1-VL1) , and the PVRIG-binding moiety is in Fab format comprising a second VH operably linked to an antibody heavy chain CH1 domain (VH2-CH1) , and a second VL operably linked to an antibody light chain constant (CL) domain (VL2-CL) .

[0323] In some specific embodiments, the TIGIT-binding moiety is in scFv format comprising a first VH operably linked to a first VL (VH1-VL1) , and the PVRIG-binding moiety is in Fab format comprising a second VH operably linked to an antibody heavy chain CH1 domain (VH2-CH1) , and a second VL operably linked to an antibody light chain constant (CL) domain (VL2-CL) . In some embodiments, the TIGIT-binding scFv is located at the N-terminus of the heavy chain of the  multispecific construct. In some embodiments, the VH1 may be at the N-terminal of VL1 within the TIGIT-binding scFv.

[0324] In some embodiments, the TIGIT-binding scFv is located at the C terminus of the heavy chain of the multispecific construct, and within the scFv, VH2 is N-terminal of VL2 (VH2-VL2) . In some embodiments, the TIGIT-binding scFv comprises (and in some embodiments consists of) the amino acid sequence of SEQ ID NO: 23, or a variant thereof having at least about at least 85%, 90%, or 95%sequence identity (preferably, at least 90%, more preferably, at least 95% (e.g., 95%, 96%, 97%, 98%, or 99%) ) sequence identity. In some embodiments, the TIGIT-binding scFv comprises the amino acid sequence SEQ ID NO: 23. In some embodiments, TIGIT-binding scFv is the amino acid sequence SEQ ID NO: 23.

[0325] In some specific embodiments, the TIGIT-binding moiety is in scFv format comprising a first VH operably linked to a first VL (VH1-VL1) , and the PVRIG-binding moiety is in Fab format comprising a second VH operably linked to an antibody heavy chain CH1 domain (VH2-CH1) , and a second VL operably linked to an antibody light chain constant (CL) domain (VL2-CL) . In some embodiments, the TIGIT-binding moiety is in scFv format comprising a first VH operably linked to a first VL (VH1-VL1) , and the PVRIG-binding moiety is in Fab format comprising a second VH operably linked to an antibody heavy chain CH1 domain (VH2-CH1) comprises (and in some embodiments consists of) the amino acid sequence of SEQ ID NO: 19, or a variant thereof having at least about at least 85%, 90%, or 95%sequence identity (preferably, at least 90%, more preferably, at least 95% (e.g., 95%, 96%, 97%, 98%, or 99%) ) sequence identity. In some embodiments, the construct comprises the amino acid sequence SEQ ID NO: 19. In some embodiments, the construct is the amino acid sequence SEQ ID NO: 19.

[0326] In some embodiments, the second VL operably linked to an antibody light chain constant (CL) domain (VL2-CL) comprises (and in some embodiments consists of) the amino acid sequence of SEQ ID NO: 20, or a variant thereof having at least about at least 85%, 90%, or 95%sequence identity (preferably, at least 90%, more preferably, at least 95% (e.g., 95%, 96%, 97%, 98%, or 99%) ) sequence identity. In some embodiments, the VL2-CL complex comprises the amino acid sequence SEQ ID NO: 20. In some embodiments, the VL2-CL comprises the amino acid sequence SEQ ID NO: 20.

[0327] The percent identity between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4: 11-17 (1988) ) which has been incorporated into the ALIGN program (version 2.0) , using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percentage of identity between two amino acid sequences can be determined by the algorithm of Needleman and Wunsch (J. Mol. Biol. 48: 444-453 (1970) ) which has been incorporated into the GAP program in the GCG software package (available at http:  / / www. gcg. com) , using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.

[0328] Additionally or alternatively, the protein sequences of the present disclosure can further be used as a “query sequence” to perform a search against public databases to, for example, identify related sequences. Such searches can be performed using the XBLAST program (version 2.0) of Altschul, et al. (1990) J. MoI. Biol. 215: 403-10. BLAST protein searches can be performed with the XBLAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to the antibody molecules of the present disclosure. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al, (1997) Nucleic Acids Res. 25 (17) : 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. See www. ncbi. nlm. nih. gov.

[0329] As one example, the construct as disclosed herein may comprise two heavy chains and two light chains, wherein the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format, and wherein from N-terminus to C-terminus: (a) the first and second heavy chains each comprises domains operably linked as in VH1-CH1-hinge-Fc-scFv, the first and second light chains each comprises domains operably linked as in VL1-CL; or (b) the first and second heavy chains each comprises domains operably linked as in scFv-VH1-CH1-hinge-Fc, the first and second light chains each comprises domains operably linked as in VL1-CL; wherein the VH1-CH1 and VL1-CL are from the TIGIT-binding moiety and the scFv (VH2-VL2 or VL2-VH2 from N to C terminus) is from the PVRIG-binding moiety.

[0330] As another example, the construct as disclosed herein may comprise two heavy chains and two light chains, wherein the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format, and wherein from N-terminus to C-terminus: (a) the first and second heavy chains each comprises domains operably linked as in VH2-CH1-hinge-Fc-scFv, the first and second  light chains each comprises domains operably linked as in VL2-CL; or (b) the first and second heavy chains each comprises domains operably linked as in scFv-VH2-CH1-hinge-Fc, the first and second light chains each comprises domains operably linked as in VL2-CL; wherein the scFv (VH1-VL1 or VL1-VH1 from N to C terminus) is from the TIGIT-binding moiety and the VH2-CH1 and VL2-CL are from the PVRIG-binding moiety.

[0331] In some specific embodiments, the TIGIT-binding moiety is in Fab format comprising a first VH operably linked to an antibody heavy chain CH1 domain (VH1-CH1) , and a first VL operably linked to an antibody light chain constant (CL) domain (VL1-CL) , and the PVRIG-binding moiety is also in Fab format comprising a second heavy chain variable domain operably linked to an antibody heavy chain CH1 domain (VH2-CH1) , and a second VL operably linked to an antibody light chain constant (CL) domain (VL2-CL) . The TIGIT-binding moieties may be located on the N-terminal and the PVRIG-binding moieties on the C-terminal of the Fc region, or the TIGIT-binding moieties may be located on the C-terminal and the PVRIG-binding moieties on the N-terminal of the Fc region, i.e. the Fc region is located between the TIGIT-binding moieties and the PVRIG-binding moieties. In some other embodiments, the TIGIT-binding moieties and the PVRIG-binding moieties are all located at the N terminal of the Fc region. For stability of dimerization, the CH1 and CL of the TIGIT-binding moieties or the PVRIG-binding moieties may be replaced by a pair of TCR constant regions, to distinguish between the TIGIT-binding Fabs and PVRIG-binding Fabs. Thus, in some embodiments, the CH1 domain is replaced by a first TCR constant region (C1, i.e. wild-type or engineered TCR beta chain constant region) and the CL domain is replaced by a second TCR constant region (C2, i.e. wild-type or engineered TCR alpha chain constant region) . Alternatively, they may be exchanged, with TCR beta chain constant region in the light chain and TCR alpha chain constant region in the heavy chain.

[0332] The TCR (T cell receptor) is a heterodimeric T cell surface protein that belongs to the immunoglobulin superfamily and is similar to a half antibody with a single heavy chain and a single light chain. A native TCR has an extracellular portion, a transmembrane portion, and an intracellular portion. The extracellular domain of a TCR has a membrane-proximal constant region and a membrane-distal variable region. The introduction of TCR constant regions to replace the commonly used CH1 and CL domains have been shown to increase the stability and expression level of the generated antibody format. A detailed description of the utility of TCR constant regions  in assembling two parental antibodies into a multispecific molecule with desired valency and functionality have been disclosed in WO2019 / 057122, the full content of which is herein incorporated by reference. The replacement by TCR constant regions results a chimeric Fab that possesses a unique light-heavy chain interface orthogonal to that of a regular antibody Fab. The assembly of the chimeric and regular Fabs in different formats can create various multispecific molecules with different structures and valences.

[0333] The pair of TCR constant regions in the chimeric Fab includes TCR alpha and beta constant regions (wild-type or preferably engineered) in the light chain and heavy chain respectively. In some embodiments, the chimeric Fab comprises a first TCR constant region and a second TCR constant region that are associated via a non-native interchain disulfide bond. The TCR constant regions may be engineered to introduce a non-native disulfide bonds between the light-heavy chain interface. In some other embodiments, the chimeric Fab comprises a pair of wild type TCR constant regions, such as wild type human TCR beta and alpha constant regions.

[0334] The sequences of constant regions of wild type human TCR beta and alpha chain can be found in NCBI accession number A0A5B9 (www. uniprot. org / uniprot / A0A5B9) and NCBI accession number P01848 (www. uniprot. org / uniprot / P01848) . The pair of TCR constant regions for constructing the multispecific antibodies herein are derived from the wild type TCR constant regions, with one or more substitutions, additions or deletions of one or more amino acids. The multispecific antibody may comprise an engineered TCR beta chain constant region and an engineered TCR alpha chain constant region (referred to as C1 and C2 herein) . As illustrated in the present application, the multispecific antibody may comprise an engineered TCR beta chain constant region (C1) with the sequence as shown in SEQ ID NO: 31 (LEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALQDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR) and an engineered TCR alpha chain constant region (C2) with the sequence as shown in SEQ ID NO: 32

[0335] (PDIQNPDCAVYQLRDSKSSDKSVCLFTDFDSQTQVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSQKSDFACANAFQNSIIPECTFFPS) . Multiple TCR constant region variants for constructing multispecific antibody formats have been disclosed in PCT / CN2021 / 072601, the full content of which is incorporated herein by reference.

[0336] As one example, the construct as disclosed herein comprise two heavy chains and four light chains, wherein the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in Fab format, and wherein from N-terminus to C-terminus: the first and second heavy chains each comprises domains operably linked as in VH1-C1-VH2-CH1-hinge-Fc or VH2-CH1-VH1-C1-hinge-Fc (VH1-C1 is from the TIGIT-binding moiety, VH2-CH1 is from the PVRIG-binding moiety) ; two light chains comprising domains operably linked as in VL1-C2 (VL1-C2 is from the TIGIT-binding moiety) ; and the other two light chains comprising domains operably linked as in VL2-CL (VL2-CL is from the PVRIG-binding moiety) . In some embodiments, the domains are operably linked by a linker. In some embodiments, the linker is a polypeptide linker.

[0337] As another example, the construct as disclosed herein comprise two heavy chains and four light chains, wherein the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in Fab format, and wherein from N-terminus to C-terminus: the first and second heavy chains each comprises domains operably linked as in VH1-C1-hinge-Fc-VH2-CH1 or VH2-CH1-hinge-Fc-VH1-C1 (VH1-C1 is from the TIGIT-binding moiety, VH2-CH1 is from the PVRIG-binding moiety) ; two light chains comprising domains operably linked as in VL1-C2 (VL1-C2 is from the TIGIT-binding moiety) ; and the other two light chains comprising domains operably linked as in VL2-CL (VL2-CL is from the PVRIG-binding moiety) .

[0338] As a further example, the construct as disclosed herein comprise two heavy chains and four light chains, wherein the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in Fab format, and wherein from N-terminus to C-terminus: the first and second heavy chains each comprises domains operably linked as in VH1-CH1-VH2-C1-hinge-Fc or VH2-C1-VH1-CH1-hinge-Fc (VH1-CH1 is from the TIGIT-binding moiety, VH2-C1 is from the PVRIG-binding moiety) ; two light chains comprising domains operably linked as in VL1-CL (VL1-CL is from the TIGIT-binding moiety) ; and the other two light chains comprising domains operably linked as in VL2-C2 (VL2-C2 is from the PVRIG-binding moiety) .

[0339] Still as a further example, the construct as disclosed herein comprise two heavy chains and four light chains, wherein the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in Fab format, and wherein from N-terminus to C-terminus: the first and second heavy chains each comprises domains operably linked as in VH1-CH1-hinge-Fc-VH2-C1 or VH2-C1-hinge-Fc-VH1-CH1 (VH1-CH1 is from the TIGIT-binding moiety, VH2-C1 is from the PVRIG- binding moiety) ; two light chains comprising domains operably linked as in VL1-CL (VL1-CL is from the TIGIT-binding moiety) ; and the other two light chains comprising domains operably linked as in VL2-C2 (VL2-C2 is from the PVRIG-binding moiety) .

[0340] In some embodiments, the construct as disclosed herein comprises one TIGIT-binding moiety and two PVRIG-binding moieties per antibody, or two TIGIT-binding moieties and one PVRIG-binding moiety per antibody. These moieties may be in Fab or scFv format.

[0341] As one example, the multispecific construct herein comprises two heavy chains ...

Claims

A method of treating cancer in an individual, comprising administering to the individual an effective amount of 1) a construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor.The method of claim 1, wherein the construct comprises a multispecific antibody comprising a TIGIT antibody moiety and a PVRIG antibody moiety, optionally wherein the construct comprises a bispecific antibody.The method of claim 1 or claim 2, wherein the TIGIT-binding moiety blocks the binding of TIGIT and CD155, and wherein the PVRIG-binding moiety blocks the binding of PVRIG and PVRL2.The method of any one of claims 1-3, wherein the TIGIT is a human TIGIT.The method of any one of claims 1-4, wherein the PVRIG is a human PVRIG.The method of any one of claims 1-5, wherein the TIGIT-binding moiety and PVRIG-binding moiety are in any of a Fab and a scFv format.The method of claim 6, wherein,the TIGIT-binding moiety is in Fab format and the PVRIG-binding moiety is in scFv format; the TIGIT-binding moiety is in scFv format and the PVRIG-binding moiety is in Fab format; or both the TIGIT-binding moiety and the PVRIG-binding moiety are in Fab format.The method of any one of claims 1-7, wherein the construct further comprises an immunoglobulin constant region, such as an IgG constant region, such as a human IgG1, IgG4, IgG2, IgG3 Fc region or a variant thereof.The method of claim 8, wherein the human IgG Fc region is a human IgG1 Fc region or a variant thereof.The method of claim 8 or claim 9, wherein the variant comprises one or more substitutions to modulate receptor binding or effector function, to promote dimerization, to prevent glycosylation, and / or to extend its half-life.The method of any one of claims 1-10, wherein the construct comprises:(a) the TIGIT-binding moiety operably linked to the Fc region and the Fc region operably linked to the PVRIG-binding moiety;(b) the TIGIT-binding moiety operably linked to the PVRIG-binding moiety and the PVRIG-binding moiety operably linked to the Fc region; or(c) the PVRIG-binding moiety operably linked to the TIGIT-binding moiety and the TIGIT-binding moiety operably linked to the Fc region.The method of any one of claims 1-11, wherein the construct comprises one, two or more TIGIT-binding moieties, as well as one, two or more PVRIG-binding moieties.The method of any one of claims 1-12, wherein the construct comprises TIGIT-binding moieties that are identical or different, and / or the PVRIG-binding moieties that are identical or different.The method of any one of claims 1-13, wherein the construct comprises a full-length TIGIT antibody comprising two heavy chains and two light chains, and an anti-PVRIG scFv, wherein the anti-PVRIG scFv is fused to the N-or C-terminus of the two heavy chains of the full-length TIGIT antibody, optionally wherein the anti-PVRIG scFv is fused to the N-or C-terminus of the two heavy chains of the full-length TIGIT antibody via a linker, optionally wherein the linker is a peptide linker, optionally wherein the linker is a GS linker.The method of any one of claims 1-13, wherein the construct comprises a full-length PVRIG antibody comprising two heavy chains and two light chains, and an anti-TIGIT scFv, wherein the anti-TIGIT scFv is fused to the N-or C-terminus of the two heavy chains of the full-length PVRIG antibody, optionally wherein the anti-TIGIT scFv is fused to the N-or C-terminus of the two heavy chains of the full-length PVRIG antibody via a linker, optionally wherein the linker is a peptide linker, optionally wherein the linker is a GS linker.The method of any one of claim 1-15, wherein the TIGIT-binding moiety comprises an antibody moiety comprising a heavy chain variable region (VH) comprising a heavy chain CDR (HCDR) 1, a HCDR2, and a HCDR3, and a light chain variable region (VL) comprising a light chain CDR (LCDR) 1, a LCDR2 and a LCDR3, wherein:the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 6, optionally wherein the substitution is a conservative substitution.The method of claim 16, wherein:the HCDR1 comprises the amino acid sequence of SEQ ID NO: 1, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 2, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 3, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 4, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 5, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 6.The method of any one of claims 1-17, wherein the PVRIG-binding moiety comprises an antibody moiety comprising a VH comprising a HCDR1, a HCDR2, and a HCDR3, and a VL comprising a LCDR1, a LCDR2 and a LCDR3, wherein:the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence with substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 12, optionally wherein the substitution is a conserved substitution.The method of claim 18, wherein:the HCDR1 comprises the amino acid sequence of SEQ ID NO: 7, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 8, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 9, the LCDR1 comprises the amino acid sequence of SEQ ID NO: 10, the LCDR2 comprises the amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 12.The method of any one of claims 1-19, wherein the VH of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 13, and / orthe VL of the TIGIT-binding moiety comprises the amino acid sequence of SEQ ID NO: 14 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 14.The method of any one of claims 1-20, wherein the VH of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 15 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 15, and / orthe VL of the PVRIG-binding moiety comprises the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence at least 85%, 90%, or 95%identical to SEQ ID NO: 16.The method of any of claims 1-21, wherein the construct comprises(i) a first and a second heavy chain that comprise SEQ ID NO: 17, and a first and a second light chain that comprise SEQ ID NO: 18; or(ii) a first and a second heavy chain that comprise SEQ ID NO: 19, and a first and a second light chain that comprise SEQ ID NO: 20.The method of any one of claims 1-22, wherein the KRAS G12C inhibitor is a small molecule.The method of claim 23, wherein the KRAS G12C inhibitor is selected from the group consisting of: sotorasib, adagrasib, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157.The method of claim 23, wherein the KRAS G12C inhibitor is represented by formula (III) or a pharmaceutically acceptable salt thereof,whereinT1 is selected from O and N;R1 is selected from C6-10 aryl and 5-to 10-membered heteroaryl, wherein the C6-10 aryl and 5-to 10-membered heteroaryl are optionally substituted with 1, 2, 3, 4 or 5 Ra;when T1 is O, R2 is not present;when T1 is N, R2 is selected from H, C1-3 alkyl, -C (=O) -C1-3 alkyl and -S (=O) 2-C1-3 alkyl, wherein the C1-3 alkyl, -C (=O) -C1-3 alkyl and -S (=O) 2-C1-3 alkyl are optionally substituted with 1, 2 or 3 Rb;R3 is C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rc;R4 is selected from H and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 Rd;R5, R6 and R7 are each independently selected from H, F, Cl, Br, I, and C1-3 alkyl, wherein the C1-3 alkyl is optionally substituted with 1, 2 or 3 F;R8 is selected from H and CH3;Ra is each independently selected from F, Cl, Br, I, OH, NH2, CN, C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl, wherein the C1-3 alkyl, C1-3 alkoxy, C2-3 alkynyl and C2-3 alkenyl are optionally substituted with 1, 2 or 3 F;Rb is each independently selected from F, Cl, Br, I, OH and NH2;Rc is each independently selected from 4-to 8-membered heterocycloalkyl, wherein the 4-to 8-membered heterocycloalkyl is optionally substituted with 1, 2 or 3 R;Rd is each independently selected from F, Cl, Br, I, OH, NH2 and CN;R is each independently selected from H, F, Cl, Br, OH, CN, C1-3 alkyl, C1-3 alkoxy and -C1-3 alkyl-O-C (=O) -C1-3 alkylamino;provided that when R1 is naphthyl, the naphthyl is optionally substituted with F, Cl, Br, OH, NH2, CF3, CH2CH3 and -C≡CH, and R5, R6 and R7 are each independently H, optionally wherein the compound is Compound 17.The method of any one of claims 1-25, wherein the construct is a) administered intravenously or subcutaneously, and / or b) administered once every two weeks.The method of any one of claims 1-26, wherein the KRAS G12C inhibitor is a) administered orally, and / or b) administered daily.The method of any one of claims 1-27, wherein the cancer comprises one or more cancer cells that express a KRAS G12C mutant protein.The method of any one of claims 1-28, wherein the cancer is colon cancer, lung cancer, breast cancer, ovarian cancer, melanoma, bladder cancer, renal cell carcinoma, liver cancer, prostate cancer, stomach cancer, pancreatic cancer, lymphoma, leukemia, uterine cancer, cervical cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, gastric cancer, colorectal cancer, kidney cancer, clear cell renal carcinoma, head and neck cancer, germ cell cancer, bone cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, mesothelioma, chronic lymphocytic leukemia, diffuse large B cell lymphoma, follicular lymphoma, Hodgkin lymphoma, myeloma, and sarcoma.The method of any one of claims 1-29, wherein the cancer is advanced, unresectable, and / or metastatic solid tumor.The method of any one of claims 1-30, wherein the construct and the KRAS G12C inhibitor are administered simultaneously.The method of any one of claims 1-30, wherein the construct and the KRAS G12C inhibitor are administered concurrently.The method of any one of claims 1-30, wherein the construct and the KRAS G12C inhibitor are administered sequentially.The method of any one of claims 1-33, further comprising administering to the individual an effective amount of a third therapy.The method of claim 34, wherein the third therapy comprises another anti-cancer agent.The method of claim 35, wherein the anti-cancer agent is selected from the group consisting of an immune checkpoint inhibitor, a cytotoxic agent, a cytostatic agent, an anti-angiogenic agent, a debulking agent, a chemotherapeutic agent, an antibody-drug conjugate, radiotherapy and radiotherapeutic agents, a targeted anti-cancer agent, BRMs, a therapeutic antibody, a cancer vaccine, cytokines, hormone therapies, radiation therapy, and anti-metastatic agents.The method of any one of claims 1-36, wherein the individual is a human.The method of any one of claims 1-37, wherein the method comprises selecting the individual for treatment based on the presence of one or more cancer cells that express a KRAS G12C mutant protein.A kit for treating cancer in an individual, comprising:1) construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety; and 2) KRAS G12C inhibitor.The kit of claim 39, wherein the construct binds human PVRIG and / or human TIGIT.The kit of claim 39 or claim 40, wherein the construct that binds TIGIT is an anti-TIGIT antibody or an immunologically active fragment thereof.The kit of any one of claims 39-41, wherein the construct that binds PVRIG is an anti-PVRIG antibody or an immunologically active fragment thereof.The kit of any of claims 39-42, wherein the anti-TIGIT antibody or immunologically active fragment thereof comprises(a) a VH that comprises (1) a CDR-H1 comprising SEQ ID NO: 1; (2) a CDR-H2 comprising SEQ ID NO: 2; and (3) a CDR-H3 comprising SEQ ID NO: 3 and(b) a VL that comprises (1) a CDR-L1 comprising SEQ ID NO: 4; (2) a CDR-L2 comprising SEQ ID NO: 5; and (3) a CDR-L3 comprising SEQ ID NO: 6, wherein the CDR sequences are defined according to the Kabat numbering system.The kit of any of claims 39-43, wherein the anti-PVRIG antibody or immunologically active fragment thereof comprises1. (a) a VH that comprises (1) a CDR-H1 comprising SEQ ID NO: 7; (2) a CDR-H2 comprising SEQ ID NO: 8; and (3) a CDR-H3 comprising SEQ ID NO: 9 and2. (b) a VL that comprises (1) a CDR-L1 comprising SEQ ID NO: 10; (2) a CDR-L2 comprising SEQ ID NO: 11; and (3) a CDR-L3 comprising SEQ ID NO: 12, wherein the CDR sequences are defined according to the Kabat numbering system.The kit of any one of claims 39-44, wherein the VH domain of the anti-TIGIT antibody or immunologically active fragment thereof comprises an amino acid sequence that has at least 85%identity to SEQ ID NO: 13, and the VL of the anti-TIGIT antibody or immunologically active fragment thereof comprises an amino acid sequence that has at least 85%identity to SEQ ID NO: 14.The kit of any one of claims 39-44, wherein the VH domain of the anti-TIGIT antibody or immunologically active fragment thereof comprises an amino acid sequence that has at least 85%identity to SEQ ID NO: 15, and the VL of the anti-TIGIT antibody or immunologically active fragment thereof comprises an amino acid sequence that has at least 85%identity to SEQ ID NO: 16.The kit of any of claims 39-46, wherein the construct comprises(i) a first and a second heavy chain that comprise SEQ ID NO: 17, and a first and a second light chain that comprise SEQ ID NO: 18; or(ii) a first and a second heavy chain that comprise SEQ ID NO: 19, and a first and a second light chain that comprise SEQ ID NO: 20.The kit of any one of claims 39-47, wherein the KRAS G12C inhibitor is an antibody, a peptide, a protein, an antisense oligonucleotide, or a small molecule that inhibits the activity of the KRAS G12C mutant protein.The kit of claim 48, wherein the KRAS G12C inhibitor is a small molecule inhibitor.The kit of claim 49, wherein the small molecule is selected from the group consisting of: Compound 17, sotorasib, adagrasib, JAB-21822, GDC-6036, JDQ443, D-1553, GH35, GFH925, BPI-421286, and LY3537982, RMC-6291, HBI-2438, BI 1823911, MK-1084, and JNJ-74699157.The kit of claim 49, wherein the small molecule is Compound 17.The kit of any one of claims 39-51, wherein the cancer comprises one or more cancer cells that express a KRAS G12C mutant protein.Use of construct comprising a TIGIT-binding moiety and a PVRIG-binding moiety for the manufacture of a medicament for treating a cancer, wherein the treatment is in combination with a KRAS G12C inhibitor.

Images