Solenoid polypeptides

Abstract

The present invention provides polypeptides comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein the at least two beta solenoid domains are linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more; and a C-terminal capping sequence.

Description

[0001] SOLENOID POLYPEPTIDES

[0002] FIELD OF THE INVENTION

[0003] The present invention relates to polypeptides comprising at least two beta solenoid domains and their application in the field of synthetic fibres.

[0004] BACKGROUND TO THE INVENTION

[0005] High performance synthetic fibres, such as aramids, typically have high tensile strength (2-6 GPa) and stiffness (50-300 GPa) but low ductility, typically extending less than 5% in length before failure. These synthetic fibres are widely used in a variety of applications, as unidirectional tows, weaves, felts, and knits, either as a fabric or as a composite. Their ability to absorb impact energy, including as flexible textiles, makes them attractive in protection applications. However, their low breathability and low thermal conductivity make them uncomfortable to wear, whilst their tendency to degrade in the presence of water, heat and light reduces service lifetime particularly after washing.

[0006] In contrast, cellulosic- and protein-based natural fibres are generally comfortable to wear next to the skin due to their high water absorbency and breathability but typically have lower tensile performance than synthetic fibres. Natural silk fibres can combine both high tensile strength and comfort but these protein-based materials are difficult to produce at high molecular weight in recombinant expression systems and it is difficult to recapitulate the natural spinning mechanism. Both the molecular weight of the polymers and the spinning process are critical to achieving high performance fibres.

[0007] Despite advances in synthetic textiles, there is still a need for the sustainable and commercially viable production of fibres that combine the desirable properties of natural fibres (e.g. breathable and water absorbent) with the high performance aspects of synthetic fibres (e.g. high tensile strength and stiffness).

[0008] WO 2019175591 A1 discloses a concatemer of beta solenoid domains, wherein the concatemer comprises at least two beta solenoid domains, wherein the at least two beta solenoid domains are linked by a linker, and wherein each of the at least two beta solenoid domains comprise an amino acid sequence that comprises at least four units of a consensus motif. WO 2019175591 A1 also discloses a fibre comprising the concatemer, a textile comprising the concatemer or fibre, and use of the concatemer, fibre, or textile in the production of e.g. sportswear. SUMMARY OF THE INVENTION The present inventors have surprisingly found that that a linker is not required to establish functional beta solenoid concatemers and that the C-terminal capping sequence of one beta solenoid domain can be directly fused to the N-terminal capping sequence of the next beta solenoid domain. Direct fusion of functional domains without a linker may lead to many undesirable outcomes, including misfolding of the fusion proteins or low yield in protein production (see e.g. Chen, X., et al., 2013. Advanced drug delivery reviews, 65(10), pp.1357-1369). However, the present inventors have surprisingly found that concatemers of beta solenoid domains that are directly fused can be produced by microbial organisms and spun into fibres with useful properties. In one aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein the at least two beta solenoid domains are linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more; and a C-terminal capping sequence. The sequence linking the at least two beta solenoid domains may be any suitable sequence. In some embodiments, the sequence linking the at least two beta solenoid domains is not a beta solenoid domain. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of at least one C-terminal capping sequence and / or at least one N-terminal capping sequence. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of from N-terminus to C-terminus: a C-terminal capping sequence and an N-terminal capping sequence. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of a linker sequence. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of a rigid linker sequence. In some embodiments, the sequence linking the at least two beta solenoid domains is not a flexible linker. Suitably, each of the at least two beta solenoid domains are rod-shaped. In some embodiments, each of the at least beta solenoid domains have a ratio of longitudinal length to transverse length of at least 2:1. In some embodiments, each of the at least two beta solenoid domains have a cross-section selected from the group consisting of: a tesselatable cross-section, optionally a square, a rectangle, a parallelogram, a hexagon, or a triangle cross-section; a circle cross-section; or an oval cross-section. In some embodiments, each of the at least two beta solenoid domains have a cross-section selected from the group consisting of a square, a parallelogram, a hexagon, a circle, or an oval cross-section. In some embodiments, each of the at least two beta solenoid domains have a square cross- section. Suitably, each of the at least two beta solenoid domains comprise an amino acid sequence that comprises at least 10 units, at least 15 units, or at least 20 units of a beta solenoid consensus motif. In some embodiments, the beta solenoid consensus motif is AX1X2X3X4, wherein X1is any amino acid, wherein X2is L or F, wherein X3is any amino acid, and wherein X4is any amino acid. In some embodiments, X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably wherein X1is D, N, I, S, E, K, L, R, or V, more preferably wherein X1is D or N. In some embodiments, X2is L. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably wherein X3is S, E, R, T, D, H, Q, K, N, or C. In some embodiments, X4is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably wherein X4is G, E, Q, K, R, A, D, H, N, or Y. The at least two beta solenoid domains may comprise any number of beta solenoid domains. In some embodiments, the at least two beta solenoid domains comprise at least three beta solenoid domains. In some embodiments, the at least two beta solenoid domains comprise at least four beta solenoid domains. A capping sequence may prevent the polypeptide from aggregating end-to-end with other polypeptides. Suitably, a capping sequence comprises or consists of one or more alpha helix sequence. In some embodiments, an N-terminal capping sequence comprises or consists of the amino acid sequence of SEQ ID NO: 50. In some embodiments, a C-terminal capping sequence comprises or consists of the amino acid sequence of SEQ ID NO: 51. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of the amino acid sequence of SEQ ID NO: 114. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 115 to 137 or 322 to 329. In another aspect, the present invention provides a polypeptide comprising the amino acid sequence: (XMXXXXILXXYXXGXXXFXXIXLXX(I / A)XLXX(AX1X2X3X4)nAX(T / L / F)XXAX(L / F)XXA X(L / F)XXAXVXPVLWXXAXLXGAX(M / V)XXXXXXX(Y / F)XXAXX)m, wherein X is any amino acid, wherein X1is any amino acid, wherein X2is L or F, wherein X3is any amino acid, wherein X4is any amino acid, wherein m is at least 2 and wherein n is at least 10. In some embodiments, m is at least 3 or at least 4. In some embodiments, n is at least 15 or at least 20. In some embodiments, X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably wherein X1is D, N, I, S, E, K, L, R, or V, more preferably wherein X1is D or N. In some embodiments, X2is L. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably wherein X3is S, E, R, T, D, H, Q, K, N, or C. In some embodiments, X4is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably wherein X4is G, E, Q, K, R, A, D, H, N, or Y. The polypeptide of the present invention may have a molecular weight of at least 30 kDa, at least 40 kDa, at least 50 kDa, at least 60 kDa, at least 70 kDa, or at least 80 kDa. In some embodiments, the polypeptide has a molecular weight of from 30 kDa to 1000 kDa, from 40 kDa to 1000 kDa, from 50 kDa to 1000 kDa, from 60 kDa to 1000 kDa, from 70 kDa to 1000 kDa, or from 80 kDa to 1000 kDa. The polypeptide of the invention may be capable of forming a lyotropic liquid crystal mesophase. The polypeptide of the invention may be soluble at a concentration of at least 20 mg / ml, at least 30 mg / ml, at least 40 mg / ml, at least 50 mg / ml, at least 60 mg / ml, at least 70 mg / ml, at least 80 mg / ml, at least 90 mg / ml, or at least 100 mg / ml. The polypeptide of the invention may capable of being expressed by a cell or a cell-free transcription and translation system. In another aspect, the present invention provides a composition comprising the polypeptide according to the present invention. In some embodiments, the composition comprises the polypeptide at a concentration of at least 20 mg / ml, at least 30 mg / ml, at least 40 mg / ml, at least 50 mg / ml, at least 60 mg / ml, at least 70 mg / ml, at least 80 mg / ml, at least 90 mg / ml, or at least 100 mg / ml. In some embodiments, the polypeptide is not denatured. In some embodiments, the composition comprises a solvent, such as an aqueous solvent. In another aspect, the present invention provides a polynucleotide encoding the polypeptide according to the present invention. In another aspect, the present invention provides a vector comprising the polynucleotide according to the present invention. In another aspect, the present invention provides a cell comprising the polynucleotide according to the present invention or the vector according to the present invention. In another aspect, the present invention provides a fibre comprising the polypeptide according to the present invention. The fibre may be produced via a wet-spinning method. The fibre may have an average diameter of from 100 nm to 100 µm, from 500 nm to 50µm, from 1 µm to 40 µm, from 2.5 µm to 35 µm, from 5 µm to 30 µm, from 7.5 µm to 25 µm, or from 10 µm to 20 µm. The fibre may have a Young’s modulus of at least 0.5 GPa, at least 1.0 GPa, at least 2 GPa, at least 5.0 GPa, at least 10.0 GPa, at least 15.0 GPa, at least 20.0 GPa, at least 25.0 GPa, at least 30.0GPa, at least 35.0 GPa, at least 40.0 GPa, at least 50.0 GPa, at least 60.0 GPa, at least 70.0 GPa, at least 75.0 GPa, at least 80.0 GPa, at least 90.0 GPa, at least 100.0 GPa, at least 125 GPa, at least 150 GPa, at least 175 GPa, or at least 200 GPa. The fibre may have an engineered strength of: at least 0.1 GPa, at least 0.2 GPa, at least 0.3 GPa, at least 0.4 GPa, at least 0.5 GPa, at least 0.6 GPa, at least 0.7 GPa, at least 0.8 GPa, at least 0.9 GPa, at least 1.0 GPa, at least 1.1 GPa, at least 1.2 GPa, at least 1.3 GPa, at least 1.4 GPa, at least 1.5 GPa, at least 1.6 GPa, at least 1.7 GPa, at least 1.8 GPa, at least 1.9 GPa, at least 2.0 GPa, at least 2.1 GPa, at least 2.2 GPa, at least 2.3 GPa, at least 2.4 GPa, at least 2.5 GPa, at least 2.6 GPa, at least 2.7 GPa, at least 2.8 GPa, at least 2.9 GPa, at least 3.0 GPa. The fibre may have a strain to failure of at least 2%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 90%, at least 100%, at least 125%, at least 150%, at least 175%, at least 200%, at least 225%, at least 250%, at least 275%, or at least 300%. The fibre may have a toughness of at least 10 J / g, at least 20 J / g, at least 40 J / g, at least 60 J / g, at least 80 J / g, at least 100 J / g, at least 120 J / g, at least 140 J / g, at least 160 J / g, at least 180 J / g, at least 200 J / g, at least 250 J / g, at least 300 J / g, at least 350 J / g, at least 400 J / g, at least 450 J / g, at least 500 J / g, at least 550 J / g, at least 600 J / g, at least 650 J / g, at least 700 J / g, at least 750 J / g, at least 800 J / g, at least 850 J / g, at least 900 J / g, at least 950 J / g, at least 1000 J / g. In another aspect, the present invention provides yarn comprising the polypeptide according to the present invention or the fibre according to the present invention. In another aspect, the present invention provides textile comprising the polypeptide according to the present invention, the fibre according to the present invention, or the yarn according to the present invention. In another aspect, the present invention provides use of the polypeptide according to the present invention, the fibre according to the present invention, the yarn according the present invention, or the textile according to the present invention, in the production of a textile product of, wherein the textile product is selected from sportswear; materials for blast containment; materials for blade containment; textiles for parachutes; ropes; textiles for clothing; textiles for shoes; general medical textiles; wound dressings; resorbable and non- resorbable surgical sutures; resorbable and non-resorbable stents; guide-wires for surgery; biocompatible coatings for implanted medical devices; surgical meshes; and scaffolds for 3D tissue engineering. In another aspect, the present invention provides a textile product comprising the polypeptide according to the present invention, the fibre according to the present invention, the yarn according the present invention, or the textile according to the present invention, wherein the textile product is selected from sportswear; materials for blast containment; materials for blade containment; textiles for parachutes; ropes; textiles for clothing; textiles for shoes; general medical textiles; wound dressings; resorbable and non-resorbable surgical sutures; resorbable and non-resorbable stents; guide-wires for surgery; biocompatible coatings for implanted medical devices; surgical meshes; and scaffolds for 3D tissue engineering. DESCRIPTION OF DRAWINGS Figure 1 - Schematic representation of the modified polypeptide variants Schematic representation of SynRFR24.nc.x4.1 and SynRFR24.nc.x4.nolinker variant showing the arrangement of capping and linker sequences within the polypeptides. Figure 2 - Predicted local distance difference test (pLDDT) score (A) pLDDT score for SynRFR24.nc.x4.1. (B) pLDDT score for SynRFR24.nc.x4.nolinker variant. Figure 3 - SDS-PAGE analysis of SynRFR24.nc.x4.nolinker (A) SDS-PAGE analysis for whole cell lysate (WCL) and soluble (SOL) fraction of SynRFR24.nc.x4.nolinker variant expressed in E.coli. Significant levels of soluble protein were obtained for the SynRFR24.nc.x4.nolinker variant (marked by arrow and box). (B) SDS-PAGE analysis for two-step ion exchange purification of SynRFR24.nc.x4.nolinker variant. Significant levels of purified protein were obtained (marked by arrow and box). Figure 4 - Circular dichroism (CD) analysis and melt curve of SynRFR24.nc.x4.1 and SynRFR24.nc.x4.nolinker (A) CD spectra for SynRFR24.nc.x4.1 and SynRFR24.nc.x4.nolinker. (B,C) Melt curve by CD for (B) SynRFR24.nc.x4.1 and (C) SynRFR24.nc.x4.nolinker. The protein melting temperature, Tm was determined to be approximately 80ºC for both constructs. Figure 5 - Tensile testing of SynRFR24.nc.x4.nolinker Fibres were obtained by wet spinning and then air dried without tension. The fibres were then mounted on a tensile tester and tested until broken with a 10 N load cell. DETAILED DESCRIPTION Various preferred features and embodiments of the present invention will now be described by way of non-limiting examples. This disclosure is not limited by the exemplary methods and materials disclosed herein, and any methods and materials similar or equivalent to those described herein can be used in the practice or testing of embodiments of this disclosure. The skilled person will understand that they can combine all features of the invention disclosed herein without departing from the scope of the invention as disclosed. It must be noted that as used herein and in the appended claims, the singular forms "a", "an", and "the" include plural referents unless the context clearly dictates otherwise. The terms "comprising", "comprises" and "comprised of" as used herein are synonymous with "including", "includes", "containing", or "contains", and are inclusive or open-ended and do not exclude additional, non-recited members, elements or steps. The terms "comprising", "comprises" and "comprised of" also include the term "consisting of". Unless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation, respectively. Numeric ranges are inclusive of the numbers defining the range. The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that such publications constitute prior art to the claims appended hereto. All publications mentioned in the specification are herein incorporated by reference. Polypeptides The polypeptide of the present invention comprises at least two beta solenoid domains. The polypeptide of the present invention may be referred to herein as a “concatemer of beta solenoid domains”. The polypeptide may be an isolated polypeptide. The polypeptide may comprise any number of beta solenoid domains, provided that the polypeptide comprises at least two beta solenoid domains that are linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more. In preferred embodiments, each of the beta solenoid domains comprised in the polypeptide are linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more. The polypeptide may comprise at least two beta solenoid domains, at least three beta solenoid domains, at least four beta solenoid domains, at least 5 beta solenoid domains, at least 6 beta solenoid domains, at least 7 beta solenoid domains, at least 8 beta solenoid domains, at least 9 beta solenoid domains, at least 10 beta solenoid domains, at least 11 beta solenoid domains, at least 12 beta solenoid domains, at least 13 beta solenoid domains, at least 14 beta solenoid domains, at least 15 beta solenoid domains, at least 16 beta solenoid domains, at least 17 beta solenoid domains, at least 18 beta solenoid domains, at least 19 beta solenoid domains, at least 20 beta solenoid domains, at least 21 beta solenoid domains, at least 22 beta solenoid domains, at least 23 beta solenoid domains, at least 24 beta solenoid domains, at least 25 beta solenoid domains, at least 26 beta solenoid domains, at least 27 beta solenoid domains, at least 28 beta solenoid domains, at least 29 beta solenoid domains, at least 30 beta solenoid domains, at least 35 beta solenoid domains, at least 40 beta solenoid domains, at least 45 beta solenoid domains, at least 50 beta solenoid domains, at least 55 beta solenoid domains, at least 60 beta solenoid domains, at least 65 beta solenoid domains, at least 70 beta solenoid domains, at least 75 beta solenoid domains, at least 80 beta solenoid domains, at least 85 beta solenoid domains, at least 90 beta solenoid domains, at least 95 beta solenoid domains, or at least 100 beta solenoid domains. The polypeptide may comprise 100 beta solenoid domains or fewer, 95 beta solenoid domains or fewer, 90 beta solenoid domains or fewer, 85 beta solenoid domains or fewer, 80 beta solenoid domains or fewer, 75 beta solenoid domains or fewer, 70 beta solenoid domains or fewer, 65 beta solenoid domains or fewer, 60 beta solenoid domains or fewer, 55 beta solenoid domains or fewer, 50 beta solenoid domains or fewer, 45 beta solenoid domains or fewer, 40 beta solenoid domains or fewer, 35 beta solenoid domains or fewer, 30 beta solenoid domains or fewer, 29 beta solenoid domains or fewer, 28 beta solenoid domains or fewer, 27 beta solenoid domains or fewer, 26 beta solenoid domains or fewer, 25 beta solenoid domains or fewer, 24 beta solenoid domains or fewer, 23 beta solenoid domains or fewer, 22 beta solenoid domains or fewer, 21 beta solenoid domains or fewer, 20 beta solenoid domains or fewer, 19 beta solenoid domains or fewer, 18 beta solenoid domains or fewer, 17 beta solenoid domains or fewer, 16 beta solenoid domains or fewer, 15 beta solenoid domains or fewer, 14 beta solenoid domains or fewer, 13 beta solenoid domains or fewer, 12 beta solenoid domains or fewer, 11 beta solenoid domains or fewer, or 10 beta solenoid domains or fewer. The polypeptide may comprise from 2 to 100 beta solenoid domains, from 2 to 95 beta solenoid domains, from 2 to 90 beta solenoid domains, from 2 to 85 beta solenoid domains, from 2 to 80 beta solenoid domains, from 2 to 75 beta solenoid domains, from 2 to 70 beta solenoid domains, from 2 to 65 beta solenoid domains, from 2 to 60 beta solenoid domains, from 2 to 55 beta solenoid domains, from 2 to 50 beta solenoid domains, from 2 to 45 beta solenoid domains, from 2 to 40 beta solenoid domains, from 2 to 35 beta solenoid domains, from 2 to 30 beta solenoid domains, from 2 to 29 beta solenoid domains, from 2 to 28 beta solenoid domains, from 2 to 27 beta solenoid domains, from 2 to 26 beta solenoid domains, from 2 to 25 beta solenoid domains, from 2 to 24 beta solenoid domains, from 2 to 23 beta solenoid domains, from 2 to 22 beta solenoid domains, from 2 to 21 beta solenoid domains, from 2 to 20 beta solenoid domains, from 2 to 19 beta solenoid domains, from 2 to 18 beta solenoid domains, from 2 to 17 beta solenoid domains, from 2 to 16 beta solenoid domains, from 2 to 15 beta solenoid domains, from 2 to 14 beta solenoid domains, from 2 to 13 beta solenoid domains, from 2 to 12 beta solenoid domains, from 2 to 11 beta solenoid domains, from 2 to 10 beta solenoid domains, from 3 to 10 beta solenoid domains, or from 4 to 10 beta solenoid domains. The polypeptide may comprise at least three beta solenoid domains, at least four beta solenoid domains, at least 5 beta solenoid domains, at least 6 beta solenoid domains, at least 7 beta solenoid domains, at least 8 beta solenoid domains, at least 9 beta solenoid domains, at least 10 beta solenoid domains, at least 11 beta solenoid domains, at least 12 beta solenoid domains, at least 13 beta solenoid domains, at least 14 beta solenoid domains, at least 15 beta solenoid domains, at least 16 beta solenoid domains, at least 17 beta solenoid domains, at least 18 beta solenoid domains, at least 19 beta solenoid domains, at least 20 beta solenoid domains, at least 21 beta solenoid domains, at least 22 beta solenoid domains, at least 23 beta solenoid domains, at least 24 beta solenoid domains, at least 25 beta solenoid domains, at least 26 beta solenoid domains, at least 27 beta solenoid domains, at least 28 beta solenoid domains, at least 29 beta solenoid domains, at least 30 beta solenoid domains, at least 35 beta solenoid domains, at least 40 beta solenoid domains, at least 45 beta solenoid domains, at least 50 beta solenoid domains, at least 55 beta solenoid domains, at least 60 beta solenoid domains, at least 65 beta solenoid domains, at least 70 beta solenoid domains, at least 75 beta solenoid domains, at least 80 beta solenoid domains, at least 85 beta solenoid domains, at least 90 beta solenoid domains, at least 95 beta solenoid domains, or at least 100 beta solenoid domains that are linked by sequences having a minimum predicted local distance difference test (pLDDT) score of 50% or more. The polypeptide may comprise 100 beta solenoid domains or fewer, 95 beta solenoid domains or fewer, 90 beta solenoid domains or fewer, 85 beta solenoid domains or fewer, 80 beta solenoid domains or fewer, 75 beta solenoid domains or fewer, 70 beta solenoid domains or fewer, 65 beta solenoid domains or fewer, 60 beta solenoid domains or fewer, 55 beta solenoid domains or fewer, 50 beta solenoid domains or fewer, 45 beta solenoid domains or fewer, 40 beta solenoid domains or fewer, 35 beta solenoid domains or fewer, 30 beta solenoid domains or fewer, 29 beta solenoid domains or fewer, 28 beta solenoid domains or fewer, 27 beta solenoid domains or fewer, 26 beta solenoid domains or fewer, 25 beta solenoid domains or fewer, 24 beta solenoid domains or fewer, 23 beta solenoid domains or fewer, 22 beta solenoid domains or fewer, 21 beta solenoid domains or fewer, 20 beta solenoid domains or fewer, 19 beta solenoid domains or fewer, 18 beta solenoid domains or fewer, 17 beta solenoid domains or fewer, 16 beta solenoid domains or fewer, 15 beta solenoid domains or fewer, 14 beta solenoid domains or fewer, 13 beta solenoid domains or fewer, 12 beta solenoid domains or fewer, 11 beta solenoid domains or fewer, or 10 beta solenoid domains or fewer that are linked by sequences having a minimum predicted local distance difference test (pLDDT) score of 50% or more. The polypeptide may comprise from 2 to 100 beta solenoid domains, from 2 to 95 beta solenoid domains, from 2 to 90 beta solenoid domains, from 2 to 85 beta solenoid domains, from 2 to 80 beta solenoid domains, from 2 to 75 beta solenoid domains, from 2 to 70 beta solenoid domains, from 2 to 65 beta solenoid domains, from 2 to 60 beta solenoid domains, from 2 to 55 beta solenoid domains, from 2 to 50 beta solenoid domains, from 2 to 45 beta solenoid domains, from 2 to 40 beta solenoid domains, from 2 to 35 beta solenoid domains, from 2 to 30 beta solenoid domains, from 2 to 29 beta solenoid domains, from 2 to 28 beta solenoid domains, from 2 to 27 beta solenoid domains, from 2 to 26 beta solenoid domains, from 2 to 25 beta solenoid domains, from 2 to 24 beta solenoid domains, from 2 to 23 beta solenoid domains, from 2 to 22 beta solenoid domains, from 2 to 21 beta solenoid domains, from 2 to 20 beta solenoid domains, from 2 to 19 beta solenoid domains, from 2 to 18 beta solenoid domains, from 2 to 17 beta solenoid domains, from 2 to 16 beta solenoid domains, from 2 to 15 beta solenoid domains, from 2 to 14 beta solenoid domains, from 2 to 13 beta solenoid domains, from 2 to 12 beta solenoid domains, from 2 to 11 beta solenoid domains, from 2 to 10 beta solenoid domains, from 3 to 10 beta solenoid domains, or from 4 to 10 beta solenoid domains that are linked by sequences having a minimum predicted local distance difference test (pLDDT) score of 50% or more. In some embodiments, the polypeptide comprises at least two beta solenoid domains, wherein the first beta solenoid domain is linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more to the second beta solenoid domain. In some embodiments, the polypeptide comprises at least three beta solenoid domains, wherein the first beta solenoid domain is linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more to the second beta solenoid domain, and the second beta solenoid domain is linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more to the third beta solenoid domain. In some embodiments, the polypeptide comprises at least four beta solenoid domains, wherein the first beta solenoid domain is linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more to the second beta solenoid domain, the second beta solenoid domain is linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more to the third beta solenoid domain, and the third beta solenoid domain is linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more to the fourth beta solenoid domain. The polypeptide may have a molecular weight of at least 30 kDa, at least 40 kDa, at least 50 kDa, at least 60 kDa, at least 70 kDa, at least 80 kDa, at least 90 kDa, at least 100 kDa, at least 120 kDa, at least 150 kDa, at least 200 kDa, at least 250 kDa, at least 300 kDa, optinally at least 350 kDa, at least 400 kDa, at least 450 kDa, at least 500 kDa, at least 600 kDa, at least 650 kDa, at least 700 kDa, at least 800 kDa, at least 900 kDa, or at least 1000 kDa. The polypeptide may have a molecular weight of 1000 kDa or less, 900 kDa or less, 800 kDa or less, 700 kDa or less, 600 kDa or less, 500 kDa or less, 400 kDa or less, 300 kDa or less, 200 kDa or less, or 100 kDa or less. The polypeptide may have a molecular weight of from 30 kDa to 1000 kDa, from 30 kDa to 900 kDa, from 30 kDa to 800 kDa, from 30 kDa to 700 kDa, from 30 kDa to 600 kDa, from 30 kDa to 500 kDa, from 30 kDa to 400 kDa, from 30 kDa to 300 kDa, from 30 kDa to 200 kDa, or from 30 kDa to 100 kDa. The polypeptide may be capable of forming a lyotropic liquid crystal mesophase. The ability to form a lyotropic liquid crystal mesophase is associated with both the dimensions of the polypeptide and the charge associated with the polypeptide. Any method may be used to determine whether the polypeptide is capable of forming a lyotropic liquid crystal mesophase, including, for example, polarised optical microscopy. Higher surface charge increases the effective diameter of the rod-like beta solenoids or polypeptide, adjusting the aspect ratio and volume fraction of the mesogens, and hence the phase diagram as a function of concentration. The charge units referred to herein are, elementary charge units (e) which is the electric charge carried by a single proton (e), or equivalently, the magnitude of the electric charge carried by a single electron, which has charge -e. In some embodiments, the polypeptide has a high net charge, for example a net charge of at least +3 charge units, at least +5 charge units, at least +7 charge units, at least +10 charge units, at least +15 charge units, at least +20 charge units, at least +25 charge units, at least +30 charge units, at least +35 charge units, at least +40 charge units, at least +45 charge units, at least +50 charge units, at least +55 charge units, at least +60 charge units, at least +65 charge units, at least +70 charge units, at least +75 charge units, at least +80 charge units, at least +85 charge units, at least +90 charge units, at least +95 charge units, at least +100 charge units, at least +200 charge units, at least +300 charge units, at least +400 charge units, at least +500 charge units, at least +600 charge units, at least +700 charge units, at least +800 charge units, at least +900 charge units, at least +1000 charge units, at least +2000 charge units, at least +3000 charge units, at least +4000 charge units, at least +5000 charge units, at least +6000 charge units, at least +7000 charge units, at least +8000 charge units, at least +9000 charge units, or at least +10000 charge units, optionally at a pH range of 3 to 10 (e.g. pH 7). In some embodiments, the polypeptide has a high negative net charge, for example a net charge of less than -3 charge units, less than -5 charge units, less than -7 charge units, less than -10 charge units, less than -15 charge units, less than -20 charge units, less than -25 charge units, less than -30 charge units, less than -35 charge units, less than -40 charge units, less than -45 charge units, less than -50 charge units, less than -55 charge units, less than -60 charge units, less than -65 charge units, less than -70 charge units, less than -75 charge units, less than -80 charge units, less than -85 charge units, less than -90 charge units, less than -95 charge units, less than -100 charge units, less than -200 charge units, less than -300 charge units, less than -400 charge units, less than - 500 charge units, less than -600 charge units, less than -700 charge units, less than -800 charge units, less than -900 charge units, less than -1000 charge units, less than -2000 charge units, less than -3000 charge units, less than -4000 charge units, less than -5000 charge units, less than -6000 charge units, less than -7000 charge units, less than -8000 charge units, less than -9000 charge units, or less than -10000 charge units, optionally at a pH range of 3 to 10 (e.g. pH 7). The polypeptide may be soluble at high concentrations. In some embodiments, the polypeptide is soluble at a concentration of at least 20 mg / ml, at least 30 mg / ml, at least 40 mg / ml, at least 50 mg / ml, at least 60 mg / ml, at least 70 mg / ml, at least 80 mg / ml, at least 90 mg / ml, at least 100 mg / ml, at least 120 mg / ml, at least 130 mg / ml, at least 150 mg / ml, at least 170 mg / ml, at least 190 mg / ml, at least 200 mg / ml, at least 250 mg / ml, at least 300 mg / ml, at least 350 mg / ml, or at least 400 mg / ml. The polypeptide may be soluble in an aqueous solution. In some embodiments, the polypeptide is soluble in at least any solvent selected from the group consisting of: a) a buffer selected from the group consisting of any one or more of: MES, Bis-tris methane, ADA, ACES, Bis-tris propane, PIPES, MOPSO, Cholamine chloride, MOPS, BES, TES, HEPES, DIPSO, MOBS, Acetamidoglycine, TAPSO, TEA, POPSO, HEPPSO, EPS, HEPPS, Tricine, Tris, Glycinamide, Glycylglycine, HEPBS, Bicine, TAPS, AMPB, CHES, AMP, AMPSO CAPSO, CAPS, CABS, Bicine, sodium citrate buffer, sodium bicarbonate buffer, phosphate buffer, borate buffer, optionally wherein the buffer comprises one or more salts, e.g. sodium chloride and / or potassium chloride, optionally wherein the buffer is at a pH range of 3 to 10, e.g. pH 7; b) an organic solvent, optionally HFIP. In some embodiments, the polypeptide is soluble at a concentration of at least 20 mg / ml, at least 30 mg / ml, at least 40 mg / ml, at least 50 mg / ml, at least 60 mg / ml, at least 70 mg / ml, at least 80 mg / ml, at least 90 mg / ml, at least 100 mg / ml, at least 120 mg / ml, at least 130 mg / ml, at least 150 mg / ml, at least 170 mg / ml, at least 190 mg / ml, at least 200 mg / ml, at least 250 mg / ml, at least 300 mg / ml, at least 350 mg / ml, or at least 400 mg / ml in any one or more of: a) a buffer selected from the group consisting of any one or more of: MES, Bis-tris methane, ADA, ACES, Bis-tris propane, PIPES, MOPSO, Cholamine chloride, MOPS, BES, TES, HEPES, DIPSO, MOBS, Acetamidoglycine, TAPSO, TEA, POPSO, HEPPSO, EPS, HEPPS, Tricine, Tris, Glycinamide, Glycylglycine, HEPBS, Bicine, TAPS, AMPB, CHES, AMP, AMPSO CAPSO, CAPS, CABS, Bicine, sodium citrate buffer, sodium bicarbonate buffer, phosphate buffer, borate buffer, optionally wherein the buffer comprises one or more salts, e.g. sodium chloride and / or potassium chloride, optionally wherein the buffer is at a pH range of 3 to 10, e.g. pH 7; b) an organic solvent, optionally HFIP. In some embodiments, the polypeptide is not soluble in aqueous solution at a high salt concentration (e.g. at high concentrations of ammonium sulfate or other salts from the Hofmeister series known to “salt out” proteins). The polypeptide may be capable of being produced through biotechnological means, for example through protein expression systems that involve the use of microbes. In some embodiments, the polypeptide is capable of being expressed by a cell or a cell-free transcription and translation system. The cell may be any cell for example a cell that is generally used in commercial protein expression systems. The cell may be a prokaryotic cell, optionally a bacterial cell, for example an E. coli cell, a Bacillus subtilis cell, a Bacillus megaterium cell, a Vibrio natriegens cell, or a Pseudomonas fluorescens cell. The cell may also be a eukaryotic cell, optionally a yeast cell, for example Pichia pastoris or Saccharomyces cerevisiae; or an insect cell, for example a baculovirus infected insect cell; or a mammalian cell, for example a baculovirus infected mammalian cell, a HEK293 cell, a HeLa cell, or CHO cells. Suitable expression systems will be known to the skilled person. The polypeptides of the present invention may also be expressed through cell-free expression systems, for example by using E. coli lysates or rabbit reticulocyte lysates. The polypeptide may be capable of being purified, for example by ion exchange chromatography. The polypeptide may have a melting temperature of 60ºC or more. In some embodiments, the polypeptide has a melting temperature of 65ºC or more, 70ºC or more, 75ºC or more, or 80ºC or more. In some embodiments, the polypeptide has a melting temperature of 100ºC or less, 95ºC or less, 90ºC or less, 85ºC or less, or 80ºC or less. In some embodiments, the polypeptide has a melting temperature of from 60ºC to 100ºC, from 65ºC to 95ºC, or from 70ºC to 90ºC. Beta solenoid domains As used herein, a “beta solenoid domain” may refer to a protein fold comprising or consisting of repeating beta strands subunits arranged in antiparallel fashion. Example of beta solenoid domains include beta-rolls and beta-helices (see e.g. Kajava, A.V. and Steven, A.C., 2006. Advances in protein chemistry, 73, pp.55-96). Suitably, a beta solenoid domain is a linear solenoid which forms a rod-shaped structure. In some embodiments, each of the at least two beta solenoid domains are rod-shaped. As used herein, a “rod shape” may refer to a shape that is longer along one axis than in the transverse axis. Suitably, the cross-sectional shape and dimensions do not vary significantly along the length of the beta solenoid domain. For example, where the cross-section has an approximately square shape the three-dimensional shape of the beta solenoid domain may be considered to be approximately a square prism. A beta solenoid domain may have a longitudinal axis formed by the regular winding of the unit sequences and a transverse axis running perpendicular to the longitudinal axis. In some embodiments, the ratio of longitudinal length to transverse length of one of the at least two beta solenoid domains (i.e. the aspect ratio) is at least 2:1, at least 3:1, at least 4:1, at least 5:1, at least 6:1, at least 7:1, at least 8:1, at least 9:1, or at least 10:1. In some embodiments, each of the at least two beta solenoid domains have a longitudinal axis and a transverse axis and the ratio of longitudinal length to transverse length is at least 2:1, at least 3:1, at least 4:1, at least 5:1, at least 6:1, at least 7:1, at least 8:1, at least 9:1, or at least 10:1. In some embodiments, at least one or each of the at least two beta solenoid domains have an aspect ratio of 10:1 or less. The polypeptide may have an aspect ratio of from 4:1 to 1000:1. In some embodiments, the polypeptide has an aspect ratio of at least 4:1, at least 6:1, at least 8:1, at least 10:1, at least 10:1, at least 50:1, at least 100:1, at least 200:1, at least 300:1, at least 400:1, at least 500:1, at least 600:1, at least 700:1, at least 800:1, at least 900:1, or at least 1000:1. In some embodiments, the length of at least one or each of the at least two beta solenoid domains is from 5 to 4000 Angstroms in length, from 10 to 3000 Angstroms, from 15 to 2000 Angstroms, from 20 to 1000 Angstroms, from 25 to 500 Angstroms, from 30 to 250 Angstroms, from 35 to 200 Angstroms from 40 to 100 Angstroms, from 45 to 75 Angstroms, for example about 50 Angstroms. In some embodiments, the length of at least one or each of the at least two beta solenoid domains is from 35 to 200 Angstroms. At least one or each of the at least two beta solenoid domains may comprise hidden length. Hidden length may arise from a high degree of coiling, such that when a longitudinal force is applied to the coil (i.e. when the force is applied parallel to an organised fibre comprising the beta solenoid domains), the coil extends so that the fully extended chain is many times longer than the original. A beta solenoid domain that comprises hidden length is considered to have a first compact conformation and a second extended conformation and is capable, upon application of a longitudinal force, or moving from the first conformation to the second conformation. The first conformation may comprise a high degree of coiling. At least one or each of the at least two beta solenoid domains may move between the first conformation and the second conformation when a defined force is applied parallel to the longitudinal axis of the polypeptide. In some embodiments, the length of the second conformation of a beta solenoid domain is at least 1.5 times, at least 2 times longer, at least 3 times longer, at least 4 times longer, at least 5 times longer, at least 10 times longer, at least 20 times longer, at least 30 times longer, at least 40 times longer, at least 50 times longer, or at least 100 times longer than the length of the first conformation of a beta solenoid domain. At least one or each of the at least two beta solenoid domains may be capable of forming a lyotropic liquid crystal mesophase when expressed as monomers. The ability to form a lyotropic liquid crystal mesophase is associated with both the dimensions of the beta solenoid domains and the charge associated with the beta solenoid domain. Typically, “rod- like” domains are particularly suited to the formation of nematic liquid crystals, though other more ordered systems, such as smectics, or columnar phases, may occur. The aspect ratio and persistence length are related parameters that determine the concentration for the isotropic-nematic phase transition (see e.g. Escobedo, F.A. and de Pablo, J.J., 1997. The Journal of chemical physics, 106(23), pp.9858-9868). Any method may be used to determine whether a particular beta solenoid domain is capable of forming a lyotropic liquid crystal mesophase when expressed as monomers, including, for example, polarised optical microscopy (see e.g. Liquid Crystalline Polymers, CUP, 2006, A. M. Donald, A. H. Windle, S. Hanna). In some embodiments, at least one or each of the at least two beta solenoid domains has a high net charge, for example a net charge of at least +3 charge units, at least +5 charge units, at least +7 charge units, at least +10 charge units, at least +15 charge units, at least +20 charge units, at least +25 charge units, at least +30 charge units, at least +35 charge units, at least +40 charge units, at least +45 charge units, at least +50 charge units, at least +55 charge units, at least +60 charge units, at least +65 charge units, at least +70 charge units, at least +75 charge units, at least +80 charge units, at least +85 charge units, at least +90 charge units, at least +95 charge units, or at least +100 charge units, optionally at a pH range of 3 to 10 (e.g. pH 7). In some embodiments, at least one or each of the at least two beta solenoid domains has a high negative net charge, for example a net charge of less than -3 charge units, less than -5 charge units, less than -7 charge units, less than -10 charge units, less than -15 charge units, less than -20 charge units, less than -25 charge units, less than -30 charge units, less than -35 charge units, less than -40 charge units, less than -45 charge units, less than -50 charge units, less than -55 charge units, less than -60 charge units, less than -65 charge units, less than -70 charge units, less than -75 charge units, less than -80 charge units, less than -85 charge units, less than -90 charge units, less than -95 charge units, or less than -100 charge units, optionally at a pH range of 3 to 10 (e.g. pH 7). In some embodiments, at least one or each of the at least two beta solenoid domains have a molecular weight of at least 15 kDa, at least 20 kDa, at least 25 kDa, at least 30 kDa, at least 40 kDa, at least 50 kDa, at least 60 kDa, at least 70 kDa, at least 80 kDa, at least 90 kDa, at least 100 kDa, at least 120 kDa, at least 150 kDa, at least 200 kDa, at least 250 kDa, at least 300 kDa, optinally at least 350 kDa, at least 400 kDa, at least 450 kDa, or at least 500 kDa. In some embodiments, at least one or each of the at least two beta solenoid domains have a molecular weight 500 kDa or less, 450 kDa or less, 400 kDa or less, 300 kDa or less, 350 kDa or less, 250 kDa or less, 200 kDa or less, 150 kDa or less, 100 kDa or less, 90 kDa or less, 80 kDa or less, 70 kDa or less, 60 kDa or less, or 50 kDa or less. In some embodiments, at least one or each of the at least two beta solenoid domains have a molecular weight from 15 kDa to 500 kDa, from 15 kDa to 450 kDa, from 15 kDa to 400 kDa, from 15 kDa to 350 kDa, from 15 kDa to 300 kDa, from 15 kDa to 250 kDa, from 15 kDa to 200 kDa, from 15 kDa to 150 kDa, from 15 kDa to 100 kDa, or from 15 kDa to 50 kDa. Beta solenoid consensus motifs Solenoid protein domains are a highly modular type of protein domain and typically consist of a chain of nearly identical folds, which may be referred to as a “consensus motif” or “tandem repeat”. Suitably, a beta solenoid domain may be defined by the presence of at least 4 units of a consensus motif. Each unit may conform to a particular consensus motif, but each of the at least four units may have a different sequence. Any suitable consensus motif may be used to generate the beta solenoid domains (see e.g. MacDonald, J.T., et al., 2016. Proceedings of the National Academy of Sciences, 113(37), pp.10346-10351). Examples of suitable consensus sequences are provided below. In some embodiments, the beta solenoid consensus motif is selected from any of SEQ ID NOs: 1 to 11. In some embodiments, the beta solenoid consensus motif is selected from any of SEQ ID NOs: 1 to 5. In some embodiments, the beta solenoid consensus motif is 1. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of any one or more of the following consensus sequences. In preferred embodiments, each unit within a single beta solenoid domain conforms to the same consensus sequence. In more preferred embodiments, each unit within each of the at least two beta solenoid domains conforms to the same consensus sequence. In some embodiments, the at least two beta solenoid domains each comprise or consist of units that conform to the same consensus sequence. In some embodiments, the at least two beta solenoid domains have different amino acid sequences. In some embodiments, the amino acid sequences of the at least two beta solenoid domains are identical. In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 1. Example beta solenoid consensus motif 1 (SEQ ID NO: 1) In some embodiments, X1is D, N, I, S, E, K, L, R, V, A, C, M, or T. In some embodiments, X1is D, N, I, S, E, K, L, R, or V. In some embodiments, X1is D or N. In some embodiments, X2is L or F. In some embodiments, X2is L. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, or C. In some embodiments, X4 is G, E, Q, K, R, A, D, H, N, Y, S, I, or C. In some embodiments, X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably X1is D, N, I, S, E, K, L, R, or V, more preferably, X1is D or N; (b) X2is L or F, preferably X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, or V; (b) X2is L or F; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D or N; (b) X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 2. Example beta solenoid consensus motif 2 (SEQ ID NO: 2) In some embodiments, X1is D, N, I, S, E, K, L, R, or V. In some embodiments, X1is D or N. In some embodiments, X2is L. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, or C. In some embodiments, X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D or N; (b) X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 3. Example beta solenoid consensus motif 3 (SEQ ID NO: 3) In some embodiments, X1is D, N, I, S, E, K, L, R, V, A, C, M, or T. In some embodiments, X1is D, N, I, S, E, K, L, R, or V. In some embodiments, X1is D or N. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, or C. In some embodiments, X4 is G, E, Q, K, R, A, D, H, N, Y, S, I, or C. In some embodiments, X4is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably X1is D, N, I, S, E, K, L, R, or V, more preferably, X1is D or N; (b) X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably X3is S, E, R, T, D, H, Q, K, N, or C; and (c) X4is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably X4is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, or V; (b) X3is S, E, R, T, D, H, Q, K, N, or C; and (c) X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D or N; (b) X3is S, E, R, T, D, H, Q, K, N, or C; and (c) X4is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 4. Example beta solenoid consensus motif 4 (SEQ ID NO: 4) In some embodiments, X1is D, N, I, S, E, K, L, R, or V. In some embodiments, X1is D or N. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, or C. In some embodiments, X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D or N; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 5. Example beta solenoid consensus motif 5 (SEQ ID NO: 5) In some embodiments, X4is G, E, Q, K, R, A, D, H, N, Y, S, I, or C. In some embodiments, X4is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 6. (S / G / T / A)X(A / V / G)X(G / A)XX wherein X is any amino acid Example beta solenoid consensus motif 6 (SEQ ID NO: 6) In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 7. (S / G / T / A)X(A / V / G)X(G / A)XX(S / G / T / A)*(A / V / G)*(G / A)XX wherein * is a hydrophobic amino acid, and wherein X is any amino acid Example beta solenoid consensus motif 7 (SEQ ID NO: 7) In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 8. SXAXGXXS*A*GXX wherein * is a hydrophobic amino acid, and X is any amino acid Example beta solenoid consensus motif 8 (SEQ ID NO: 8) In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 9. NXAXGXXST(I / V)(G / A)GGXX wherein X is any amino acid Example beta solenoid consensus motif 9 (SEQ ID NO: 9) In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 10. NXAXGXXSTIGGGXX wherein X is any amino acid Example beta solenoid consensus motif 10 (SEQ ID NO: 10) In some embodiments, the beta solenoid consensus motif is SEQ ID NO: 11. GXQX(V / I / L)XXGGXAXXTX(V / I / L)XXG wherein X is any amino acid Example beta solenoid consensus motif 11 (SEQ ID NO: 11) A beta solenoid domain which comprises or consists of units that conform to the consensus motif of SEQ ID NOs: 1-5 may generate a beta solenoid domain with a square or approximately square cross-section. A beta solenoid domain which comprises or consists of units that conform to the consensus motif of SEQ ID NOs: 6-10 may generate an oval or approximately oval shaped cross-section. A beta solenoid domain which comprises or consists of units that conform to the consensus motif of SEQ ID NO: 11 may generate a triangular or approximately triangular cross-section. One unit of the consensus sequence of SEQ ID NOs: 1-5 may represent one side of the four sides of the square cross-section; one unit of the consensus motif of SEQ ID NO: 6 may represent half a turn of the beta solenoid helix; one unit of the consensus motif of SEQ ID NO: 7 may represent one turn of the beta solenoid helix; one unit of the consensus motif of SEQ ID NO: 8 may represent one turn of the beta solenoid helix; one unit of the consensus motif of SEQ ID NO: 9 may represent one turn of the beta solenoid helix; and one unit of the consensus motif of SEQ ID NO: 10 may represent one turn of the beta solenoid helix. The at least two beta solenoid domains may have a cross-section that allows for a degree of tessellation or efficient packing. In some embodiments, the consensus motif of the units of the beta solenoid domains is selected such that a tesselatable cross-section is formed, for example a square, a rectangle, a parallelogram, a hexagon, a triangle, or other tesselatable cross-section. In some embodiments, the consensus motif forms a square or rectangular, or triangular cross-section. In some embodiments, the consensus motif forms a square cross- section. In other embodiments, the consensus motif forms a non-tesselatable cross section, such as a circle cross-section or an oval cross-section. The number of units of the consensus motif may be varied. For example, the number of units of the consensus motif may be to achieve the desired aspect ratio of at least one or each of the at least two beta solenoid domains. Units of the consensus motif may be arranged consecutively (i.e. tandemly), wherein one or more of the units of the consensus motif follows directly on from a first consensus motif. However, the units of the consensus motif may also comprise additional sequences between the units. Preferably, the units of the consensus motif are arranged consecutively. In some embodiments, the at least two beta solenoid domains each have the same number of units of a consensus motif. In other embodiments, the at least two beta solenoid domains do not have the same number of units of a consensus motif. In some embodiments, at least one of the at least two beta solenoid domains comprises or consists of at least 4 units, at least 5 units, at least 6 units, at least 7 units, at least 8 units, at least 9 units, at least 10 units, at least 11 units, at least 12 units, at least 13 units, at least 14 units, at least 15 units, at least 16 units, at least 17 units, at least 18 units, at least 19 units, at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, at least 27 units, at least 28 units, at least 29 units, at least 30 units, at least 40 units, at least 50 units, at least 60 units, at least 70 units, at least 80 units, at least 90 units, at least 100 units, or at least 200 units of a consensus motif. In some embodiments, each of the at least two beta solenoid domains comprise or consist of at least 4 units, at least 5 units, at least 6 units, at least 7 units, at least 8 units, at least 9 units, at least 10 units, at least 11 units, at least 12 units, at least 13 units, at least 14 units, at least 15 units, at least 16 units, at least 17 units, at least 18 units, at least 19 units, at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, at least 27 units, at least 28 units, at least 29 units, at least 30 units, at least 40 units, at least 50 units, at least 60 units, at least 70 units, at least 80 units, at least 90 units, at least 100 units, or at least 200 units of a consensus motif. In another embodiment, at least one of the at least two beta solenoid domains comprises or consists of less than 3000 units, less than 2000 units, less than 1000 units, less than 500 units, less than 400 units, less than 300 units, less than 200 units, less than 100 units, less than 90 units, less than 80 units, less than 70 units, less than 60 units, less than 50 units, less than 40 units, less than 30 units, less than 29 units, less than 28 units, less than 27 units, less than 26 units, less than 25 units, less than 24 units, less than 23 units, less than 22 units, less than 21 units, less than 20 units, less than 19 units, less than 18 units, less than 17 units, less than 16 units, less than 15 units, less than 14 units, less than 13 units, less than 12 units, less than 11 units, less than 10 units, less than 9 units, less than 8 units, less than 7 units, or less than 6 units of a consensus motif. In another embodiment, each of the at least two beta solenoid domains comprise or consist of less than 3000 units, less than 2000 units, less than 1000 units, less than 500 units, less than 400 units, less than 300 units, less than 200 units, less than 100 units, less than 90 units, less than 80 units, less than 70 units, less than 60 units, less than 50 units, less than 40 units, less than 30 units, less than 29 units, less than 28 units, less than 27 units, less than 26 units, less than 25 units, less than 24 units, less than 23 units, less than 22 units, less than 21 units, less than 20 units, less than 19 units, less than 18 units, less than 17 units, less than 16 units, less than 15 units, less than 14 units, less than 13 units, less than 12 units, less than 11 units, less than 10 units, less than 9 units, less than 8 units, less than 7 units, or less than 6 units of a consensus motif. In some embodiments, at least one of the at least two beta solenoid domains comprises or consists of from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30 units of a consensus motif. In some embodiments, each of the at least two beta solenoid domains comprise or consist of from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30 units of a consensus motif. Example beta solenoid domains An example of a consensus beta solenoid domain is provided in SEQ ID NO: 12. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of the amino acid sequence of SEQ ID NO: 12. Example consensus beta solenoid domain 1 (SEQ ID NO: 12) In some embodiments, X1is D, N, I, S, E, K, L, R, V, A, C, M, or T. In some embodiments, X1is D, N, I, S, E, K, L, R, or V. In some embodiments, X1is D or N. In some embodiments, X2is L. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, or C. In some embodiments, X4is G, E, Q, K, R, A, D, H, N, Y, S, I, or C. In some embodiments, X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably X1is D, N, I, S, E, K, L, R, or V, more preferably, X1is D or N; (b) X2is L or F, preferably X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, or V; (b) X2is L or F; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D or N; (b) X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments, n is at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, or at least 200. In some embodiments, n is less than 3000, less than 2000, less than 1000, less than 500, less than 400, less than 300, less than 200, less than 100, less than 90, less than 80, less than 70, less than 60, less than 50, less than 40, less than 30, less than 29, less than 28, less than 27, less than 26, less than 25, less than 24, less than 23, less than 22, less than 21, less than 20, less than 19, less than 18, less than 17, less than 16, less than 15, less than 14, less than 13, less than 12, less than 11, less than 10, less than 9, less than 8, less than 7, or less than 6. In some embodiments, n is from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30. Another example of a consensus beta solenoid domain is provided in SEQ ID NO: 13. In some embodiments, at least one of the at least two beta solenoid domains, or each of the at least two beta solenoid domains comprise or consist of the amino acid sequence of SEQ ID NO: 13. Example consensus beta solenoid domain 2 (SEQ ID NO: 13) In some embodiments, X1a, X1b, X1c, X1d, X1e, X1f, X1g, X1h, X1i, X1j, X1k, X1l, X1m, X1n, X1o, X1p, X1q, X1r, X1s, and X1t, are each independently selected from D, N, I, S, E, K, L, R, and V. In some embodiments, X2a, X2b, X2c, X2d, X2e, X2f, X2g, X2h, X2i, X2j, X2k, X2l, X2m, X2n, X2o, X2p, X2q, X2r, X2s, and X2t, are each L. In some embodiments, X3a, X3b, X3c, X3d, X3e, X3f, X3g, X3h, X3i, X3j, X3k, X3l, X3m, X3n, X3o, X3p, X3q, X3r, X3s, and X3t are each independently selected from S, E, R, T, D, H, Q, K, N, and C. In some embodiments, X4a, X4b, X4c, X4d, X4e, X4f, X4g, X4h, X4i, X4j, X4k, X4l, X4m, X4n, X4o, X4p, X4q, X4r, X4s, and X4t are each independently selected from G, E, Q, K, R, A, D, H, N, and Y. In some embodiments, (a) X1a, X1b, X1c, X1d, X1e, X1f, X1g, X1h, X1i, X1j, X1k, X1l, X1m, X1n, X1o, X1p, X1q, X1r, X1s, and X1t are each independently selected from D, N, I, S, E, K, L, R, and V; (b) X2a, X2b, X2c, X2d, X2e, X2f, X2g, X2h, X2i, X2j, X2k, X2l, X2m, X2n, X2o, X2p, X2q, X2r, X2s, and X2t are each L; (c) X3a, X3b, X3c, X3d, X3e, X3f, X3g, X3h, X3i, X3j, X3k, X3l, X3m, X3n, X3o, X3p, X3q, X3r, X3s, and X3t are each independently selected from S, E, R, T, D, H, Q, K, N, and C; and (d) X4a, X4b, X4c, X4d, X4e, X4f, X4g, X4h, X4i, X4j, X4k, X4l, X4m, X4n, X4o, X4p, X4q, X4r, X4s, and X4t are each independently selected from G, E, Q, K, R, A, D, H, N, and Y. Other examples of beta solenoid domains are provided in SEQ ID NOs: 14 to 49 and 258 to 282. ASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEAN LSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLT RANLEQADLSG Example beta solenoid domain 1 (SEQ ID NO: 14) AKLAKANLSNANLKKARLQNANLANAKLQNANLENANLAGANLKKANLRGANLHGADLAGAN LKGADLREADLRNADLRKANLTGAKLKNAKLEGANLADATLKDANLHGAKLKNANLARANLE RADLRNADLTG Example beta solenoid domain 2 (SEQ ID NO: 15) AKLAGADLSNAKLHNANLENADLKGANLAGANLQKANLHGADLTNADLRKANLANANLANAN LEGARLADADLRNADLRGAKLKRADLENADLTGANLKGANLEGARLERANLKKARLQNAKLA GADLRNARLAG Example beta solenoid domain 3 (SEQ ID NO: 16) ATLAGANLTGAKLHNARLENADLKDAKLARANLQKANLRGANLRNADLREADLANANLARAD LTGAKLADADLRNADLREANLKNANLARANLKGANLHGANLHGARLEKANLENANLQNANLQ NANLANADLRG Example beta solenoid domain 4 (SEQ ID NO: 17) AKLAGADLSNADLRNANLQNANLANANLENADLENADLKGARLENANLRRANLRGANLAEAR LEKADLRNANLANADLRRANLRNAELQNADLQGANLEGADLTGANLKGAKLKNANLQNARLA KADLRNADLTG Example beta solenoid domain 5 (SEQ ID NO: 18) AELAGANLAGANLKNANLRNANLKDADLRKANLQKADLKGANLQNARLQGANLENANLAGAR LQGANLAKADLRGADLRNANLTNARLEKADLTDADLHGARLQGADLHGANLERARLQNANLA EADLRNANLTG Example beta solenoid domain 6 (SEQ ID NO: 19) ATLAGADLSNANLKQADLARANLKDANLQNANLKNAKLEGANLAKANLEKANLHGANLARAD LTGANLANAKLENADLRKADLTNADLTNADLRGADLEGANLHGANLKGANLRKAKLKRAELQ NADLRNADLTG Example beta solenoid domain 7 (SEQ ID NO: 20) ATLAGAKLRNANLHNARLQNANLANADLQQADLEEANLHGANLANANLEEANLRRADLANAD LTGANLANADLRQADLRGANLRNARLQKANLADADLHGADLHGANLEGANLRRARLENAKLA NADLRNADLKG Example beta solenoid domain 8 (SEQ ID NO: 21) ATLAGADLSKANLHRADLKNANLKGANLEKADLREADLHGADLTNANLHGARLARADLANAN LKGADLANADLREANLHGADLTNARLQNARLQDADLHGANLTGARLHGADLTNARLQRADLS KADLRNANLEG Example beta solenoid domain 9 (SEQ ID NO: 22) ATLAGADLRNANLKNANLQKANLANANLRNANLQGADLAKARLENADLHGARLAKANLAGAN LHGADLANADLRNANLRNADLRNARLERADLAGADLEGANLHGANLREARLENANLKRANLQ NANLANADLTG Example beta solenoid domain 10 (SEQ ID NO: 23) ATLAGAKLEGADLTRAKLKDANLAKANLRNANLQEANLKGANLRNADLAGANLERANLAKAD LHGANLANADLREADLRNANLDNADLRNADLTGADLEGASLHGANLKKARLENARLRRARLE NANLAKANLTG Example beta solenoid domain 11 (SEQ ID NO: 24) ATLAGADLSGADLHNADLQNAKLKGANLEKARLRRANLRGADLTNANLRGADLEEADLAGAR LHGANLARARLANADLRNADLRNANLREADLTGANLHGANLHGADLERANLTNADLENARLE RANLAEANLQD Example beta solenoid domain 12 (SEQ ID NO: 25) ATLKGANLQDANLQEANLQNANLQGARLSNADLRRADLEGANLENADLSGARLQEANLAGAR LEGADLADADLRGADLRNADLTNARLERANLADADLHGADLHGAKLHGANLERARLENARLE NADLRNAKLAG Example beta solenoid domain 13 (SEQ ID NO: 26) ATLAGADLSNANLENADLQNADLANAKLQNANLARANLHGADLRNADLEGADLAEANLANAN LEGADLANADLRNADLRGANLTNARLQNANLTGANLRGANLHGADLHGAKLRKADLEKARLE NADLRKADLKG Example beta solenoid domain 14 (SEQ ID NO: 27) AKLAGADLRDADLQRANLENADLANAKLKNANLEQANLEGANLENANLAKADLRNANLARAD LTGADLSNADLRGADLRKANLTNADLTNADLEGADLTDARLQGANLHGANLTNANLARANLA GADLRNAKLSG Example beta solenoid domain 15 (SEQ ID NO: 28) ATLSGAKLEGANLKRADLRNANLSKADLRNANLQQANLQGADLENADLQGANLEEANLAKAN LTGANLSNADLRKADLRNANLKDADLENADLEGANLHGADLHGAKLHGADLTRADLENARLE NADLRNARLNG Example beta solenoid domain 16 (SEQ ID NO: 29) AELAGADLANANLHRANLENANLANAKLEEANLEEANLAGADLRNANLQRANLARADLAGAD LTGANLAEADLREARLQKANLENADLTNADLTGADLEGARLHGANLEGANLTNANLRKANLE NADLRNADLTG Example beta solenoid domain 17 (SEQ ID NO: 30) AELAGADLSGADLTRADLRDANLANADLQEANLAEAKLQGANLENANLARADLSRANLAGAD LHGANLAEADLRNADLRNANLQNADLRKARLQGADLEGANLEGANLHGADLENADLARADLQ KADLRNANLTG Example beta solenoid domain 18 (SEQ ID NO: 31) ATLADADLSDARLHRADLQDADLENANLENADLSEANLRGADLRNANLRKADLARADLAGAN LHGADLANAKLAEADLRDADLRNANLENADLTGANLQGARLEGAKLHGANLTNANLKDADLS GADLRDANLTG Example beta solenoid domain 19 (SEQ ID NO: 32) ATLKGANLQGARLHNADLEEAELKDANLAEADLQNANLRRADLTNADLANANLHGANLAEAN LHGANLAGADLRNADLENADLRNANLEDADLKGANLHGANLQGANLEGARLQNANLKNARLA EADLRNADLKG Example beta solenoid domain 20 (SEQ ID NO: 33) AELAGADLSNADLRNAKLENANLADANLENADLENANLRGADLENADLRRADLHGADLAKAN LEGANLAEADLRNADLRNANLTNADLKNADLEGADLHGARLEGANLEGANLENADLANADLS DADLRKADLTG Example beta solenoid domain 21 (SEQ ID NO: 34) AELAGADLSDANLEQANLQNANLANANLENANLQDADLHGARLQNADLRGANLEDADLANAR LEGANLAEADLRRADLRGADLTNADLEDADLEGANLHGARLEGANLRGANLTDARLENADLS GADLRNANLEG Example beta solenoid domain 22 (SEQ ID NO: 35) AELAGADLANANLHRANLENANLANAKLEEANLEEANLAGADLRNANLQRANLARADLAGAD LTGANLAEADLREARLQSANLENADLTNADLTGADLEGARLHGANLEGANLTNANLRKANLE NADLRNADLTG Example beta solenoid domain 23 (SEQ ID NO: 36) ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEAN LTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQ Example beta solenoid domain 24 (SEQ ID NO: 37) ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEAN LTQANLKDANLSDANLEQANLNNANLSEAMLTRANLEQ Example beta solenoid domain 25 (SEQ ID NO: 38) ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEAN LTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGADLNGADLKQADLSGADLGGANLN NANLSEAMLTRANLEQ Example beta solenoid domain 25 (SEQ ID NO: 39) ANLHHANLSRANLRSADLRNANLSHANLKGANLEEANLEAANLRGANLAGANLSGADLQEAN LTQAQLGGWSDNGETGADLSDANLEQADLAGADLYGAVLDGANLHGANLNNANLDNAMLTRA NLEQ Example beta solenoid domain 26 (SEQ ID NO: 40) ANLHHANLSRANLRSADLRNANLSHANLRGANLEEANLEAANLRGADLIGANLSGADLQEAN LTQAQLGLGVEDGGLGADLSDANLEQADLAGANLAGAVLDGANLHGANLNNANLDYAMLTRA NLEQ Example beta solenoid domain 27 (SEQ ID NO: 41) ANLHHANLSRANLRSADLRNANLSHANLRGANLEEANLEAANLRGADLVGANLSGADLQEAN LTQAQLGGVYRLGEPGADLSDANLEQADLAGANLMGAVLDGANLHGANLNNANLDYAMLTRA NLEQ Example beta solenoid domain 28 (SEQ ID NO: 42) ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLRGANLSGADLQEAN LTQAKLGTWSSSGLTGADLSDANLEQADLAGADLKGAVLDGANLHGANLNNANLDYAMLTRA NLEQ Example beta solenoid domain 29 (SEQ ID NO: 43) ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGANLVGANLSGADLQEAN LTQAMLGQTYPWGTVGADLSDANLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRA NLEQ Example beta solenoid domain 30 (SEQ ID NO: 44) ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLAGANLSGADLQEAN LTQAMLGKDEDGVVYGADLSDANLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRA NLEQ Example beta solenoid domain 31 (SEQ ID NO: 45) ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGALLTGANLSGADLQEAN LTQAWLGRDPRLGLSGADLSDANLEQADLAGAQLKGAVLDGANLHGANLNNANLDNAMLTRA NLEQ Example beta solenoid domain 32 (SEQ ID NO: 46) ANLHHANLSRANLRSADLRNANLSHANLKGANLEEANLEAANLRGANLAGANLSGADLQEAN LTQADLGGPPDEGKTGADLSDANLEQADLAGAQLYGAVLDGANLHGANLNNANLDYAMLTRA NLEQ Example beta solenoid domain 33 (SEQ ID NO: 47) ANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLRGANLSGADLQEAN LTQAKLGGYDDEGLGGADLSDANLEQADLAGAELFGAVLDGANLHGANLNNANLDKAMLTRA NLEQ Example beta solenoid domain 34 (SEQ ID NO: 48) ANLHHANLSRANLRSADLRNANLSHANLEGANLEEANLEAANLRGARLAGANLSGADLQEAN LTQANLGGPPDDGDPGADLSDANLEQADLAGANLAGAVLDGANLHGANLNNANLDNAMLTRA NLEQ Example beta solenoid domain 35 (SEQ ID NO: 49) ADLEAANLKYANLHEADLSRANLTGANLTNANLHQANLTGANLSHANLSHAVLTNANLSGAD LSEANLEGANLAGADLRGANLQDANLQEANLDQASLRGANLRQANLHSAMLSEADLNRADLE GADLSDANLSG Example beta solenoid domain 36 (SEQ ID NO: 258) ADLSHADLSRADLKGANLSGADLDHAVLREANLAQANLSGANLESANLHEADLNQAMLSGAN LTGASLRRADLSEANLQGANLRGANLEAANLSNANLQNADLSYANLEEANLTDANLEDANLH QANLHGANLTG Example beta solenoid domain 37 (SEQ ID NO: 259) ANLTQANLRSANLSGANLTRANLHNADLEGANLQGANLEDADLSHANLTDADLKNANLEGAV LSGANLEEANLSQANLQYADLSHANLSRAMLHQASLAGANLSGADLHEANLREADLNAANLE EANLSGADLDG Example beta solenoid domain 38 (SEQ ID NO: 260) ADLSQANLTQADLSGANLQYAVLRRADLTNADLENANLEDANLHGADLSSANLDHAMLSGAS LNDANLRQANLSEANLSGANLKGANLSGADLHGANLEHANLQRANLEAADLSEANLTGANLH EANLAHANLRG Example beta solenoid domain 39 (SEQ ID NO: 261) AVLQSANLEQANLSGANLSGANLRQANLSGANLTGASLHEANLEGADLSNADLTAANLKNAD LSRANLSYANLNDADLSEADLSGANLRGANLRDANLDGADLHGANLARAMLEHADLTQANLH HANLQEANLSE Example beta solenoid domain 40 (SEQ ID NO: 262) ANLQNANLEEANLSGADLSYANLKEADLSSANLRQASLHGANLHGANLAEANLRRADLRQAN LSHANLEGADLSEAVLEGANLNNANLSDANLEGANLSQADLTGADLQGANLHRANLTDANLS GADLSHAMLDA Example beta solenoid domain 41 (SEQ ID NO: 263) ANLQDANLSEANLKGADLSGANLHRANLSHAVLTQANLEGANLHGANLRHADLHDADLAGAD LRRANLQEANLSQANLEYAMLSQANLEEANLSGANLENADLSEADLDAANLESASLTGANLR GADLNGANLSN Example beta solenoid domain 42 (SEQ ID NO: 264) ADLENANLTEANLRDANLEGAVLSHANLSGANLSRANLTGANLKSANLQEANLTDADLRGAN LHYADLSGADLNQANLQNADLEGANLRQANLSGANLSEANLHGADLAQASLDRANLEGADLS AANLTEAMLSH Example beta solenoid domain 43 (SEQ ID NO: 265) ASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEAN LSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLT RANLEQADLSH Example beta solenoid domain 44 (SEQ ID NO: 266) ANLAQANLHEANLSSANLRGANLSEANLRGADLSHADLSGADLRQANLTAANLHGAMLHGAV LTGADLNYANLQRANLTGANLEDADLSQANLSEANLHNANLQDADLSGASLSHANLDEANLE RADLKGANLEN Example beta solenoid domain 45 (SEQ ID NO: 267) ANLSEANLRGANLEDADLEGAVLQQANLHGANLRGADLRYANLHRANLSEADLRHANLSGAD LEQADLSSADLTEANLSNANLSRADLHGANLKGANLTEAMLSDASLDAANLTHANLSGANLQ NANLNGANLAQ Example beta solenoid domain 46 (SEQ ID NO: 268) ANLQEAVLEYANLHNANLAQADAHHANLSQANLEGANLHGAMLSGANLESANLKDADASGAN LSEANLDEADASNANLRGADLTRANLSQANLNGADLQGADASDANLRAANLEHADLTRANLS GANLTEASLRG Example beta solenoid domain 47 (SEQ ID NO: 269) ANLSGADLKQANLSRANLSGANLANAVLQQANLSSANLDYANLTGANFQEANLHEANLNGAD LTGANLRQANLSRADLTGANLHDANLHEANLSEADLEGADLSGANLRAADFEDANLENADLS HAMLRHASLEG Example beta solenoid domain 48 (SEQ ID NO: 270) ADLRHANLRGANLSDADLSQANLTGANLEAANLSGASLEGANLQNANLEQANLDDAMLSGAN LHRANLHHADLSNANLKGANLAGANLTRADLTSAVLHEANLQEANLNGADLSGADLSEANLR YANLSQADLEG Example beta solenoid domain 49 (SEQ ID NO: 271) ANLSRAVLRGADLSQANLDQADLKNANLSGANLRGANLHEANLRNADLQRANLNQANLRGAD LTGANLESADLHAANLSDAMLSEANLEGADLAGANLTEANLEHANLSGANLEHANLTYASLS EADLQGANLSD Example beta solenoid domain 50 (SEQ ID NO: 272) ANLTGANLSGADLTQANLSNASLERANLSNANLHEADLEYADLEQANLSAANLEGANLTEAN LNHANLREADLDGADLQRANLSGADLTQAMLSGAVLRGANLHSANLKDANLAGANLQHADLH DANLTEANLRG Example beta solenoid domain 51 (SEQ ID NO: 273) ASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEAN LSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLT RANLEQADLSQ Example beta solenoid domain 52 (SEQ ID NO: 274) ASLTSANLSAADLRGANLQHANLSDADLSEANLSGAVLHHANLSEANLANADLTQANLKQAD LERADLHGANLTEAMLDEADLNNANLEGANLQQANLSGADLSEANLSGANLHGANLRDANLE RANLEEANLRY Example beta solenoid domain 53 (SEQ ID NO: 275) ANLEGAMLQHADLHEANLSDASLHQANLTEANLQEANLSGANLTGANLNNADATRANLADAN LSQADADRANLEEADLSGANLSYANLEAADLHGANLSGANLSGAVLRSANLKNADLSGANLR QANLEHADLRG Example beta solenoid domain 54 (SEQ ID NO: 276) ADLEGASLHHANFSEANLENANLSGANLSEANLQAADLAGANLDGANLHDANLSEANLSQAN FKQANLSRANLQGADLHGADLTDANLNEAVAENAMLRYANLTGANLTRANLEHADASGADLS SANLRQADLRG Example beta solenoid domain 55 (SEQ ID NO: 277) ANLHYADLRGADLSQANLKEANLSQANLSSANLNGADLTAANLEEANLTRANLSGANLEEAN LHGANLTGADLRGANLHGANLEDANLERASLDNANLSGADLQDANLHHAMLREADLAQAVLQ HADLHNANLSG Example beta solenoid domain 56 (SEQ ID NO: 278) ADLSEANLRDANLANAMLQGANLSEANLTHADLRDANLEAADLSRANLQGADLENADLEEAN LRYASLHGANLSQANLKQANLSGANLHGANLHGANLNDAVLSGADLTRANLTQADLEEANLS SANLDGANLSG Example beta solenoid domain 57 (SEQ ID NO: 279) ANLEGANLEGANLSQANLKNANLSEADLAHANLRHANLEGADLTEAVLSAANLSGADLSGAD LEQANLTEANLHDANLNYADLRRANLSGANLTRADLHNANLQEASLSGANLHSADLSQANLD GAMLTGANLQD Example beta solenoid domain 58 (SEQ ID NO: 280) ANLHEANLEQADLSHASLADANLQGANLNQANLEGANLRGADLSSADLENANLTRANLHRAN LTGADLRQANLSGANLSGAVLSYANLEAANLRQADLHNANLQEAMLSEANLSGANLSHANLK GADLTGADLDE Example beta solenoid domain 59 (SEQ ID NO: 281) ANLSHANLSEADLERANLSNANLTQADLERADLEQADLSGANLRGANLAGANLQEAMLSGAS LQNANLTYANLNDANLSSADLREANLHDANLDHANLEDANLRGAVLTGANLSQADLHGADLH DANLKAANLSE Example beta solenoid domain 60 (SEQ ID NO: 282) In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 14 to 49. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 258 to 282. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 14 to 49. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 258 to 282. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 14 to 49, and at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, or 27 units of any of SEQ ID NOs: 1 to 5. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 258 to 282, and at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, or 27 units of any of SEQ ID NOs: 1 to 5. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 14 to 49, and at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, or 27 units of any of SEQ ID NOs: 1 to 5. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 258 to 282, and at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, or 27 units of any of SEQ ID NOs: 1 to 5. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of the amino acid sequence of any of SEQ ID NOs: 14 to 49. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of the amino acid sequence of any of SEQ ID NOs: 258 to 282. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 14 to 35. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 14 to 35. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 14 to 35, and at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, or 27 units of any of SEQ ID NOs: 1 to 5. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 14 to 35, and at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, or 27 units of any of SEQ ID NOs: 1 to 5. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 14 to 35, and at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, or 27 units of SEQ ID NO: 1. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 14 to 35, and at least 20 units, at least 21 units, at least 24 units, at least 25 units, at least 26 units, or 27 units of SEQ ID NO: 1. In some embodiments, at least one or each of the at least two beta solenoid domains comprise or consist of the amino acid sequence of any of SEQ ID NOs: 14 to 35. Capping sequences The polypeptide of the present invention comprises an N-terminal capping sequence and a C-terminal capping sequence. The polypeptide of the present invention may comprise an N-terminal capping sequence and a C-terminal capping sequence flanking the at least two beta solenoid domains. As used herein, “capping sequences” may be sequences provided at the ends of a polypeptide (e.g. comprising two or more beta solenoid domains) to prevent the polypeptide (e.g. comprising two or more beta solenoid domains) from aggregating end-to-end. The skilled person is able to design capping sequences and there are a number of different ways in which this can be achieved. For example, a terminal repeat similar to the consensus sequence of the units of the beta solenoid domain may be used but in which the solvent exposed residues that would normally be buried are instead mutated to polar or charged residues, which is considered to help in shielding the hydrophobic core. Another approach is to disrupt the normal hydrogen bonding backbone pattern of the terminal repeat by adding a proline residue or forming a beta- bulge. Yet a further approach is to design the sequence of the beta solenoid so that part of the polypeptide chain folds over and covers the end. For example, the capping sequences may form alpha helices which cover the ends of the beta- helices. Such capping sequences can be found in nature or designed de novo by, for example, redesigning natural sequences using computational protein design methods. In preferred embodiments, a capping sequence comprises or consists of one or more alpha helix. Examples of consensus capping sequences are provided in SEQ ID NOs: 50 and 51. The sequence of SEQ ID NO: 50 is suitable for capping the N-terminus of a beta solenoid domain. The sequence of SEQ ID NO: 51 is suitable for capping the C-terminus of a beta solenoid domain. In some embodiments, an N-terminal capping sequence comprises or consists of the amino acid sequence of SEQ ID NO: 50. Example N-terminal capping sequences are provided in SEQ ID NOs: 52 to 74 and 283 to 287. RMRRDEILEEYRRGRRNFQHINLQEIELTN Example N-terminal capping sequence 1 (SEQ ID NO: 52) SMGKNEILNQYKNGRHDFSGINLAKADLEN Example N-terminal capping sequence 2 (SEQ ID NO: 53) TMQTKQILKEYKKGRTNFSGINLANANLKN Example N-terminal capping sequence 3 (SEQ ID NO: 54) TMRTKDILKQYNNGRHNFSGIDLANADLEK Example N-terminal capping sequence 4 (SEQ ID NO: 55) TMQTNQILKEYKNGRHNFSKINLANANLQN Example N-terminal capping sequence 5 (SEQ ID NO: 56) SMGTKEILNEYKKGRKKFANINLANADLSN Example N-terminal capping sequence 6 (SEQ ID NO: 57) TMRRDDILREYNNGRHNFSGINLAKADLRD Example N-terminal capping sequence 7 (SEQ ID NO: 58) NMKTNKILKNYKKGRHDFTGIDLANADLEN Example N-terminal capping sequence 8 (SEQ ID NO: 59) SMQADQILQQYDNGRRNFSGIDLENADLRN Example N-terminal capping sequence 9 (SEQ ID NO: 60) TMRTNEILQEYKNGRHNFEGIDLANANLQN Example N-terminal capping sequence 10 (SEQ ID NO: 61) SMHASEILQEYDNGRHDFRGIKLEDADLSG Example N-terminal capping sequence 11 (SEQ ID NO: 62) TMRTKDILKEYNKGRHDFSGINLRNANLRN Example N-terminal capping sequence 12 (SEQ ID NO: 63) HMQTNQILEEYNRGRHNFAGIDLQGADLRN Example N-terminal capping sequence 13 (SEQ ID NO: 64) TMSTNEILNEYKKGRHDFSGINLKDADLSN Example N-terminal capping sequence 14 (SEQ ID NO: 65) SMTTDKILEEYNKGRTDFRDIDLQNANLQN Example N-terminal capping sequence 15 (SEQ ID NO: 66) SMHASKILQEYNNGRHDFANIDLAKANLEN Example N-terminal capping sequence 16 (SEQ ID NO: 67) SMQTEQILQEYNRGRTDFAKIDLENANLKN Example N-terminal capping sequence 17 (SEQ ID NO: 68) TMATDKILQQYKDGQHDFSGIDLANADLSK Example N-terminal capping sequence 18 (SEQ ID NO: 69) SMQTNQILKEYNKGRHNFSGIDLQNADLSG Example N-terminal capping sequence 19 (SEQ ID NO: 70) TMGTNEILQQYKNGQHDFADIDLKNANLQK Example N-terminal capping sequence 20 (SEQ ID NO: 71) SMSANAILEAYDRGQRDFSKINLANANLSK Example N-terminal capping sequence 21 (SEQ ID NO: 72) SMHEDEILDEYNNGRKNFSGIDLQGADLED Example N-terminal capping sequence 22 (SEQ ID NO: 73) HMNVGEILRHYAAGKRNFQHINLQEIELTN Example N-terminal capping sequence 23 (SEQ ID NO: 74) SLTAAEVLALKAAGERDFSGADLSGIDLSG Example N-terminal capping sequence 24 (SEQ ID NO: 283) SLTAEEILARKAAGEKDFSGADLSHVNLSN Example N-terminal capping sequence 25 (SEQ ID NO: 284) RMRRDEILEEYRRGRRNFQHINLQEIELTR Example N-terminal capping sequence 26 (SEQ ID NO: 285) SLSAEEILQLKAAGETDFSGADLSNVDLSN Example N-terminal capping sequence 27 (SEQ ID NO: 286) RMRRDEILEEYRRGRRNFQHINLQEIELTH Example N-terminal capping sequence 28 (SEQ ID NO: 287) In some embodiments, an N-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 52 to 74. In some embodiments, an N-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 283 to 287. In some embodiments, an N-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 74. In some embodiments, an N-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 283 to 287. In some embodiments, an N-terminal capping sequence comprises or consists of the amino acid sequence of any of SEQ ID NOs: 52 to 74. In some embodiments, an N-terminal capping sequence comprises or consists of the amino acid sequence of any of SEQ ID NOs: 283 to 287. In some embodiments, an N-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 52 to 73. In some embodiments, an N-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 73. In some embodiments, an N-terminal capping sequence comprises or consists of the amino acid sequence of any of SEQ ID NOs: 52 to 73. In some embodiments, a C-terminal capping sequence comprises or consists of the amino acid sequence of SEQ ID NO: 51. Example C-terminal capping sequences are provided in SEQ ID NOs: 75 to 97 and 288 to 291. ARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARG Example C-terminal capping sequence 1 (SEQ ID NO: 75) AKTKGANLRKANLEGAKLDPVLWRTANLKGARMSKKQAQEYQRANG Example C-terminal capping sequence 2 (SEQ ID NO: 76) ADTRGANLDDAKLEGAELRPVLWRTASLSGARMSKKQKQQYQRANG Example C-terminal capping sequence 3 (SEQ ID NO: 77) AKTTGANLKRANLKGATLDPVLWRTANLEGAKMKKEQKKEYKRARG Example C-terminal capping sequence 4 (SEQ ID NO: 78) AKTTGAELRNADLRGAKLDPVLWRTAKLTGAQMTKKQKKEYQRARG Example C-terminal capping sequence 5 (SEQ ID NO: 79) AKTKGADLARADLRGAKLRPVLWNTARLEGAQMTKEQKKEYQRANG Example C-terminal capping sequence 6 (SEQ ID NO: 80) AETTGAKLARADLRGAKLRPVLWNTATLTGAQMTTKQKQQYKRANG Example C-terminal capping sequence 7 (SEQ ID NO: 81) AKTKGAKLSGADLRGAKLDPVLWNTAKLQGAKMTDNQRNEYKRANG Example C-terminal capping sequence 8 (SEQ ID NO: 82) ANTQGAKLDNADLRGAKLRPVLWNTASLQGAKMQKKQKEQYKRAKG Example C-terminal capping sequence 9 (SEQ ID NO: 83) AETEGADLRRADLRGATLDPVLWNKADLKGAQMKDNQRKEYKRANG Example C-terminal capping sequence 10 (SEQ ID NO: 84) ANTQDANLQNADLRGATLDPVLWNTANLNGAQMTDKQKQEYQRANG Example C-terminal capping sequence 11 (SEQ ID NO: 85) AETTGAKLDNADLRGAKLDPVLWNTASLSGAQMTTAQAEQYERANG Example C-terminal capping sequence 12 (SEQ ID NO: 86) AKTTGADLANADLRGATLDPVLWRTARLTGAQMKTEQKNQYKRANG Example C-terminal capping sequence 13 (SEQ ID NO: 87) ADTRGADLRNANLRGATLDPVLWNTADLTGAQMEAEQKKEYNRARG Example C-terminal capping sequence 14 (SEQ ID NO: 88) ANTSGADLRNADLRGATLDPVLWNTANLKGAKMEDNQKAEYERANG Example C-terminal capping sequence 15 (SEQ ID NO: 89) ANTSGADLENADLRGAELQPVLWRTARLQGAQMETAQKEEYKRANG Example C-terminal capping sequence 16 (SEQ ID NO: 90) ANTKGANLDNADLRGATLDPVLWRTASLQGAKMTTRQAEEYDRARG Example C-terminal capping sequence 17 (SEQ ID NO: 91) AETTGANLNNADLRGATLDPVLWNTASLEGAQMKKEQKKEYKRANG Example C-terminal capping sequence 18 (SEQ ID NO: 92) ANTQGANLDNADLRGATLDPVLWNTASLEGAQMTTEEAKEYQRANG Example C-terminal capping sequence 19 (SEQ ID NO: 93) AETEGAELNDADLRGAELAPVLWNTASLEGAKMEEKQEQQYDRARG Example C-terminal capping sequence 20 (SEQ ID NO: 94) AETTGADLNNADLRGATLDPVLWNTAKLQGAQMTTNQKAEYQRANG Example C-terminal capping sequence 21 (SEQ ID NO: 95) ANTRGARLQDADLRGAKLRPVLWNTANLEGAQMQTNQKAEYQRANG Example C-terminal capping sequence 22 (SEQ ID NO: 96) ARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example C-terminal capping sequence 23 (SEQ ID NO: 97) AKTTGADLSGANLEGATVDLSFYTEAKLTGATFSADQKKALARAKG Example C-terminal capping sequence 24 (SEQ ID NO: 288) ANVQGANLSEANLEGAKVDLSFFTQAALEGAKFSEEQKKLLERAKG Example C-terminal capping sequence 25 (SEQ ID NO: 289) ANVEGANLSEANLEGAKFDLSLYRQANLEGAKLTPEQLELKLRALG Example C-terminal capping sequence 26 (SEQ ID NO: 290) ANVQGANLSGANLEGAKVDLSFFTQANLEGAKFSEEQLRLLERAKG Example C-terminal capping sequence 27 (SEQ ID NO: 291) In some embodiments, a C-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 75 to 97. In some embodiments, a C-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 288 to 291. In some embodiments, a C-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 97. In some embodiments, a C-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 288 to 291. In some embodiments, a C-terminal capping sequence comprises or consists of the amino acid sequence of any of SEQ ID NOs: 75 to 97. In some embodiments, a C-terminal capping sequence comprises or consists of the amino acid sequence of any of SEQ ID NOs: 288 to 291. In some embodiments, a C-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 75 to 96. In some embodiments, a C-terminal capping sequence comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 96. In some embodiments, a C-terminal capping sequence comprises or consists of the amino acid sequence of any of SEQ ID NOs: 75 to 96. Example capped beta solenoid domains In some embodiments, at least one or each of the at least two beta solenoid domains is flanked by an N-terminal capping sequence and / or a C-terminal capping sequence. In some embodiments, at least one or each of the at least two beta solenoid domains is flanked by an N-terminal capping sequence and a C-terminal capping sequence. In preferred embodiments, each of the at least two beta solenoid domains is flanked by an N-terminal capping sequence and a C-terminal capping sequence. In more preferred embodiments, each of the beta solenoid domains comprised in the polypeptide is flanked by an N-terminal capping sequence and a C-terminal capping sequence. Beta solenoid domains which are flanked by an N-terminal capping sequence and a C- terminal capping sequence may be referred to herein as “capped beta solenoid domains”. A capped beta solenoid domain may comprise or consist of an N-terminal capping sequence (NCAP), a sequence that comprises at least 4 units of a beta solenoid consensus motif (UNITS), and a C-terminal cap sequence (CCAP). A capped beta solenoid domain may comprise or consist of the following from N-terminus to C-terminus: NCAP – UNITSn– CCAP, wherein n is at least 4. In some embodiments, UNITS comprises or consists of the beta solenoid consensus motif of any of SEQ ID NOs: 1 to 11. In some embodiments, UNITS comprises or consists of the beta solenoid consensus motif of any of SEQ ID NOs: 1 to 5. In some embodiments, UNITS comprises or consists of the beta solenoid consensus motif of SEQ ID NO: 1. In some embodiments, UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 12 or 13. In some embodiments, NCAP comprises of consists of the consensus sequence of SEQ ID NO: 50. In some embodiments, NCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 52 to 74 or 283 to 287. In some embodiments, NCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 74 or 283 to 287. In some embodiments, NCAP comprises or consists of the amino acid sequence of any of SEQ ID NOs: 52 to 74 or 283 to 287. In some embodiments, NCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 52 to 73. In some embodiments, NCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 73. In some embodiments, NCAP comprises or consists of the amino acid sequence of any of SEQ ID NOs: 52 to 73. In some embodiments, CCAP comprises of consists of the consensus sequence of SEQ ID NO: 51. In some embodiments, CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 75 to 97 and 288 to 291. In some embodiments, CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 97 and 288 to 291. In some embodiments, CCAP comprises or consists of the amino acid sequence of any of SEQ ID NOs: 75 to 97 and 288 to 291. In some embodiments, CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 75 to 96. In some embodiments, CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 96. In some embodiments, CCAP comprises or consists of the amino acid sequence of any of SEQ ID NOs: 75 to 96. In some embodiments, n is at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, or at least 200. In some embodiments, n is less than 3000, less than 2000, less than 1000, less than 500, less than 400, less than 300, less than 200, less than 100, less than 90, less than 80, less than 70, less than 60, less than 50, less than 40, less than 30, less than 29, less than 28, less than 27, less than 26, less than 25, less than 24, less than 23, less than 22, less than 21, less than 20, less than 19, less than 18, less than 17, less than 16, less than 15, less than 14, less than 13, less than 12, less than 11, less than 10, less than 9, less than 8, less than 7, or less than 6. In some embodiments, n is from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30. In some embodiments, (i) (a) UNITS consists of the beta solenoid consensus motif of any of SEQ ID NOs: 1 to 11, preferably any of SEQ ID NOs: 1 to 5, more preferably SEQ ID NO: 1; (b) NCAP comprises of consists of the consensus sequence of SEQ ID NO: 50, preferably NCAP comprises of consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 74 or 283 to 287, more preferably NCAP comprises of consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 73; and (c) CCAP comprises of consists of the consensus sequence of SEQ ID NO: 51, preferably CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 97 and 288 to 291, more preferably CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 96; and (ii) n is from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30. In some embodiments: (1) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 14; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (2) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 15; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 53; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 76; (3) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 16; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 54; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 77; (4) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 17; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 55; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 78; (5) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 18; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 56; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 79; (6) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 19; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 57; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 80; (7) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 20; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 58; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 81; (8) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 21; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 59; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 82; (9) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 22; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 60; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 83; (10) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 23; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 61; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 84; (11) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 24; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 62; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 85; (12) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 25; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 63; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 86; (13) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 26; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 64; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 87; (14) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 27; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 65; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 88; (15) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 28; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 66; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 89; (16) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 29; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 67; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 90; (17) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 30; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 68; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 91; (18) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 31; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 69; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 92; (19) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 32; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 70; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 93; (20) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 33; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 71; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 94; (21) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 34; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 72; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 95; or (22) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 35; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 73; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 96. In some embodiments: (23) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 258; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (24) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 259; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 283; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 288; (25) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 260; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (26) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 261; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (27) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 262; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (28) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 263; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (29) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 264; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (30) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 265; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (31) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 266; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 289; (32) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 14; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 284; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (33) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 14; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (34) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 267; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (35) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 268; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (36) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 269; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 285; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (37) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 270; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 285; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (38) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 271; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (39) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 14; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 286; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (40) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 272; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (41) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 273; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (42) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 274; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 290; (43) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 275; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (44) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 276; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 287; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (45) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 277; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 287; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (46) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 278; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (47) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 266; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 291; (48) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 279; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (49) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 280; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; (50) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 281; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; or (51) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 282; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; and CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75. In some embodiments: (1) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 14; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (2) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 15; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 53; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 76; (3) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 16; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 54; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 77; (4) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 17; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 55; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 78; (5) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 18; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 56; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 79; (6) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 19; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 57; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 80; (7) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 20; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 58; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 81; (8) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 21; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 59; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 82; (9) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 22; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 60; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 83; (10) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 23; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 61; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 84; (11) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 24; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 62; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 85; (12) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 25; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 63; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 86; (13) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 26; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 64; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 87; (14) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 27; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 65; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 88; (15) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 28; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 66; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 89; (16) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 29; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 67; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 90; (17) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 30; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 68; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 91; (18) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 31; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 69; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 92; (19) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 32; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 70; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 93; (20) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 33; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 71; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 94; (21) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 34; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 72; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 95; or (22) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 35; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 73; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 96. In some embodiments: (23) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 258; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (24) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 259; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 283; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 288; (25) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 260; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (26) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 261; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (27) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 262; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (28) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 263; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (29) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 264; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (30) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 265; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (31) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 266; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 289; (32) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 14; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 284; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (33) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 14; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (34) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 267; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (35) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 268; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (36) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 269; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 285; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (37) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 270; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 285; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (38) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 271; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (39) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 14; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 286; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (40) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 272; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (41) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 273; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (42) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 274; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 290; (43) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 275; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (44) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 276; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 287; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (45) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 277; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 287; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (46) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 278; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (47) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 266; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 291; (48) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 279; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (49) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 280; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; (50) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 281; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; or (51) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 282; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; and CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75. An example of a consensus capped beta solenoid domain having the sequence NCAP – UNITSn – CCAP is provided in SEQ ID NO: 98. XMXXXXILXXYXXGXXXFXXIXLXX(I / A)XLXX(AXXXX)AX(T / L / F)XXAX(L / F) XXAX(L / F)XXAXVXPVLWXXAXLXGAX(M / V)XXXXXXX(Y / F)XXAXX wherein X is any amino acid, wherein X is any amino acid, wherein X is L or F, wherein X is any amino acid, wherein X is any amino acid, and wherein n is at least 4. Example NCAP – UNITS – CCAP sequence (SEQ ID NO: 98) In some embodiments, X1is D, N, I, S, E, K, L, R, V, A, C, M, or T. In some embodiments, X1is D, N, I, S, E, K, L, R, or V. In some embodiments, X1is D or N. In some embodiments, X2is L or F. In some embodiments, X2is L. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, or C. In some embodiments, X4 is G, E, Q, K, R, A, D, H, N, Y, S, I, or C. In some embodiments, X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably X1is D, N, I, S, E, K, L, R, or V, more preferably, X1is D or N; (b) X2is L or F, preferably X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, or V; (b) X2is L or F; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D or N; (b) X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments, n is at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, or at least 200. In some embodiments, n is less than 3000, less than 2000, less than 1000, less than 500, less than 400, less than 300, less than 200, less than 100, less than 90, less than 80, less than 70, less than 60, less than 50, less than 40, less than 30, less than 29, less than 28, less than 27, less than 26, less than 25, less than 24, less than 23, less than 22, less than 21, less than 20, less than 19, less than 18, less than 17, less than 16, less than 15, less than 14, less than 13, less than 12, less than 11, less than 10, less than 9, less than 8, less than 7, or less than 6. In some embodiments, n is from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30. In some embodiments, (i) (a) X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably X1is D, N, I, S, E, K, L, R, or V, more preferably, X1is D or N; (b) X2is L or F, preferably X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably X4is G, E, Q, K, R, A, D, H, N, or Y; and (ii) n is from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to SEQ ID NO: 98. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 98. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence similarity to SEQ ID NO: 98. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence identity to SEQ ID NO: 98. In some embodiments, a capped beta solenoid domain comprises or consists of the sequence of SEQ ID NO: 98. Example capped beta solenoid domain sequences are provided in SEQ ID NOs: 99 to 113 and 293 to 321. RMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARGKSDDG Example capped beta solenoid domain sequence 1 (SEQ ID NO: 99) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPV LWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 2 (SEQ ID NO: 100) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDASLHGATVDPV LWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 3 (SEQ ID NO: 101) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQANLN NANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAF AAAHG Example capped beta solenoid domain sequence 4 (SEQ ID NO: 102) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGADLNGADLKQADLSGADLGGANLNNANLSEAMLTRANLEQADLSGA RTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 5 (SEQ ID NO: 103) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLKGANLEEANLEAANLRGANLAGANLSGADLQEANLTQAQLGGWSDNGETGADLSDA NLEQADLAGADLYGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 6 (SEQ ID NO: 104) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLRGANLEEANLEAANLRGADLIGANLSGADLQEANLTQAQLGLGVEDGGLGADLSDA NLEQADLAGANLAGAVLDGANLHGANLNNANLDYAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 7 (SEQ ID NO: 105) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLRGANLEEANLEAANLRGADLVGANLSGADLQEANLTQAQLGGVYRLGEPGADLSDA NLEQADLAGANLMGAVLDGANLHGANLNNANLDYAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 8 (SEQ ID NO: 106) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLRGANLSGADLQEANLTQAKLGTWSSSGLTGADLSDA NLEQADLAGADLKGAVLDGANLHGANLNNANLDYAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 9 (SEQ ID NO: 107) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGANLVGANLSGADLQEANLTQAMLGQTYPWGTVGADLSDA NLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 10 (SEQ ID NO: 108) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLAGANLSGADLQEANLTQAMLGKDEDGVVYGADLSDA NLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 11 (SEQ ID NO: 109) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGALLTGANLSGADLQEANLTQAWLGRDPRLGLSGADLSDA NLEQADLAGAQLKGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 12 (SEQ ID NO: 110) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLKGANLEEANLEAANLRGANLAGANLSGADLQEANLTQADLGGPPDEGKTGADLSDA NLEQADLAGAQLYGAVLDGANLHGANLNNANLDYAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 13 (SEQ ID NO: 111) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLRGANLSGADLQEANLTQAKLGGYDDEGLGGADLSDA NLEQADLAGAELFGAVLDGANLHGANLNNANLDKAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 14 (SEQ ID NO: 112) HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLEGANLEEANLEAANLRGARLAGANLSGADLQEANLTQANLGGPPDDGDPGADLSDA NLEQADLAGANLAGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLVGARVDVDQAVAFAAAHG Example capped beta solenoid domain sequence 15 (SEQ ID NO: 113) RMRRDEILEEYRRGRRNFQHINLQEIELTNADLEAANLKYANLHEADLSRANLTGANLTNAN LHQANLTGANLSHANLSHAVLTNANLSGADLSEANLEGANLAGADLRGANLQDANLQEANLD QASLRGANLRQANLHSAMLSEADLNRADLEGADLSDANLSGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 16 (SEQ ID NO: 293) SLTAAEVLALKAAGERDFSGADLSGIDLSGADLSHADLSRADLKGANLSGADLDHAVLREAN LAQANLSGANLESANLHEADLNQAMLSGANLTGASLRRADLSEANLQGANLRGANLEAANLS NANLQNADLSYANLEEANLTDANLEDANLHQANLHGANLTGAKTTGADLSGANLEGATVDLS FYTEAKLTGATFSADQKKALARAKG Example capped beta solenoid domain sequence 17 (SEQ ID NO: 294) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLTQANLRSANLSGANLTRANLHNADLEGAN LQGANLEDADLSHANLTDADLKNANLEGAVLSGANLEEANLSQANLQYADLSHANLSRAMLH QASLAGANLSGADLHEANLREADLNAANLEEANLSGADLDGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 18 (SEQ ID NO: 295) RMRRDEILEEYRRGRRNFQHINLQEIELTNADLSQANLTQADLSGANLQYAVLRRADLTNAD LENANLEDANLHGADLSSANLDHAMLSGASLNDANLRQANLSEANLSGANLKGANLSGADLH GANLEHANLQRANLEAADLSEANLTGANLHEANLAHANLRGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 19 (SEQ ID NO: 296) RMRRDEILEEYRRGRRNFQHINLQEIELTNAVLQSANLEQANLSGANLSGANLRQANLSGAN LTGASLHEANLEGADLSNADLTAANLKNADLSRANLSYANLNDADLSEADLSGANLRGANLR DANLDGADLHGANLARAMLEHADLTQANLHHANLQEANLSEARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 20 (SEQ ID NO: 297) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLQNANLEEANLSGADLSYANLKEADLSSAN LRQASLHGANLHGANLAEANLRRADLRQANLSHANLEGADLSEAVLEGANLNNANLSDANLE GANLSQADLTGADLQGANLHRANLTDANLSGADLSHAMLDAARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 21 (SEQ ID NO: 298) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLQDANLSEANLKGADLSGANLHRANLSHAV LTQANLEGANLHGANLRHADLHDADLAGADLRRANLQEANLSQANLEYAMLSQANLEEANLS GANLENADLSEADLDAANLESASLTGANLRGADLNGANLSNARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 22 (SEQ ID NO: 299) RMRRDEILEEYRRGRRNFQHINLQEIELTNADLENANLTEANLRDANLEGAVLSHANLSGAN LSRANLTGANLKSANLQEANLTDADLRGANLHYADLSGADLNQANLQNADLEGANLRQANLS GANLSEANLHGADLAQASLDRANLEGADLSAANLTEAMLSHARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 23 (SEQ ID NO: 300) RMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSHANVQGANLSEANLEGAKVDLS FFTQAALEGAKFSEEQKKLLERAKG Example capped beta solenoid domain sequence 24 (SEQ ID NO: 301) SLTAEEILARKAAGEKDFSGADLSHVNLSNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 25 (SEQ ID NO: 302) RMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 26 (SEQ ID NO: 303) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLAQANLHEANLSSANLRGANLSEANLRGAD LSHADLSGADLRQANLTAANLHGAMLHGAVLTGADLNYANLQRANLTGANLEDADLSQANLS EANLHNANLQDADLSGASLSHANLDEANLERADLKGANLENARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 27 (SEQ ID NO: 304) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLSEANLRGANLEDADLEGAVLQQANLHGAN LRGADLRYANLHRANLSEADLRHANLSGADLEQADLSSADLTEANLSNANLSRADLHGANLK GANLTEAMLSDASLDAANLTHANLSGANLQNANLNGANLAQARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 28 (SEQ ID NO: 305) RMRRDEILEEYRRGRRNFQHINLQEIELTRANLQEAVLEYANLHNANLAQADAHHANLSQAN LEGANLHGAMLSGANLESANLKDADASGANLSEANLDEADASNANLRGADLTRANLSQANLN GADLQGADASDANLRAANLEHADLTRANLSGANLTEASLRGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 29 (SEQ ID NO: 306) RMRRDEILEEYRRGRRNFQHINLQEIELTRANLSGADLKQANLSRANLSGANLANAVLQQAN LSSANLDYANLTGANFQEANLHEANLNGADLTGANLRQANLSRADLTGANLHDANLHEANLS EADLEGADLSGANLRAADFEDANLENADLSHAMLRHASLEGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 30 (SEQ ID NO: 307) RMRRDEILEEYRRGRRNFQHINLQEIELTNADLRHANLRGANLSDADLSQANLTGANLEAAN LSGASLEGANLQNANLEQANLDDAMLSGANLHRANLHHADLSNANLKGANLAGANLTRADLT SAVLHEANLQEANLNGADLSGADLSEANLRYANLSQADLEGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 31 (SEQ ID NO: 308) SLSAEEILQLKAAGETDFSGADLSNVDLSNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 32 (SEQ ID NO: 309) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLSRAVLRGADLSQANLDQADLKNANLSGAN LRGANLHEANLRNADLQRANLNQANLRGADLTGANLESADLHAANLSDAMLSEANLEGADLA GANLTEANLEHANLSGANLEHANLTYASLSEADLQGANLSDARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 33 (SEQ ID NO: 310) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLTGANLSGADLTQANLSNASLERANLSNAN LHEADLEYADLEQANLSAANLEGANLTEANLNHANLREADLDGADLQRANLSGADLTQAMLS GAVLRGANLHSANLKDANLAGANLQHADLHDANLTEANLRGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 34 (SEQ ID NO: 311) RMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSQANVEGANLSEANLEGAKFDLS LYRQANLEGAKLTPEQLELKLRALG Example capped beta solenoid domain sequence 35 (SEQ ID NO: 312) RMRRDEILEEYRRGRRNFQHINLQEIELTNASLTSANLSAADLRGANLQHANLSDADLSEAN LSGAVLHHANLSEANLANADLTQANLKQADLERADLHGANLTEAMLDEADLNNANLEGANLQ QANLSGADLSEANLSGANLHGANLRDANLERANLEEANLRYARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 36 (SEQ ID NO: 313) RMRRDEILEEYRRGRRNFQHINLQEIELTHANLEGAMLQHADLHEANLSDASLHQANLTEAN LQEANLSGANLTGANLNNADATRANLADANLSQADADRANLEEADLSGANLSYANLEAADLH GANLSGANLSGAVLRSANLKNADLSGANLRQANLEHADLRGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 37 (SEQ ID NO: 314) RMRRDEILEEYRRGRRNFQHINLQEIELTHADLEGASLHHANFSEANLENANLSGANLSEAN LQAADLAGANLDGANLHDANLSEANLSQANFKQANLSRANLQGADLHGADLTDANLNEAVAE NAMLRYANLTGANLTRANLEHADASGADLSSANLRQADLRGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 38 (SEQ ID NO: 315) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLHYADLRGADLSQANLKEANLSQANLSSAN LNGADLTAANLEEANLTRANLSGANLEEANLHGANLTGADLRGANLHGANLEDANLERASLD NANLSGADLQDANLHHAMLREADLAQAVLQHADLHNANLSGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 39 (SEQ ID NO: 316) RMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSHANVQGANLSGANLEGAKVDLS FFTQANLEGAKFSEEQLRLLERAKG Example capped beta solenoid domain sequence 40 (SEQ ID NO: 317) RMRRDEILEEYRRGRRNFQHINLQEIELTNADLSEANLRDANLANAMLQGANLSEANLTHAD LRDANLEAADLSRANLQGADLENADLEEANLRYASLHGANLSQANLKQANLSGANLHGANLH GANLNDAVLSGADLTRANLTQADLEEANLSSANLDGANLSGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 41 (SEQ ID NO: 318) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLEGANLEGANLSQANLKNANLSEADLAHAN LRHANLEGADLTEAVLSAANLSGADLSGADLEQANLTEANLHDANLNYADLRRANLSGANLT RADLHNANLQEASLSGANLHSADLSQANLDGAMLTGANLQDARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 42 (SEQ ID NO: 319) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLHEANLEQADLSHASLADANLQGANLNQAN LEGANLRGADLSSADLENANLTRANLHRANLTGADLRQANLSGANLSGAVLSYANLEAANLR QADLHNANLQEAMLSEANLSGANLSHANLKGADLTGADLDEARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 43 (SEQ ID NO: 320) RMRRDEILEEYRRGRRNFQHINLQEIELTNANLSHANLSEADLERANLSNANLTQADLERAD LEQADLSGANLRGANLAGANLQEAMLSGASLQNANLTYANLNDANLSSADLREANLHDANLD HANLEDANLRGAVLTGANLSQADLHGADLHDANLKAANLSEARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARG Example capped beta solenoid domain sequence 44 (SEQ ID NO: 321) In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 99 to 113. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 293 to 321. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 99 to 113. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 293 to 321. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence similarity to any of SEQ ID NOs: 99 to 113. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence similarity to any of SEQ ID NOs: 293 to 321. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence identity to any of SEQ ID NOs: 99 to 113. In some embodiments, a capped beta solenoid domain comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence identity to any of SEQ ID NOs: 293 to 321. In some embodiments, a capped beta solenoid domain comprises or consists of the sequence of any of SEQ ID NOs: 99 to 113. In some embodiments, a capped beta solenoid domain comprises or consists of the sequence of any of SEQ ID NOs: 293 to 321. Linking sequences In one aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein the predicted local distance difference test (pLDDT) score between the at least two beta solenoid domains is 50% or more; and a C-terminal capping sequence. The Local Distance Difference Test (LDDT) is a superposition-free score that evaluates local distance differences of all atoms in a model, including validation of stereochemical plausibility (see e.g. Mariani, V., et al., 2013. Bioinformatics, 29(21), pp.2722-2728). Regions with low pLDDT (e.g. less than 50%) may be considered to be intrinsically disordered (see e.g. Tunyasuvunakool, K., et al., 2021. Nature, 596(7873), pp.590-596 and Ruff, K.M. and Pappu, R.V., 2021. Journal of Molecular Biology, 433(20), p.167208). A structural prediction model (e.g. ESMFold, AlphaFold2, or RoseTTAFold see e.g. Lin, Z., et al., 2022. BioRxiv, 2022, p.500902) may be used to determine the pLDDT of the sequence linking the at least two beta solenoid domains. The pLDDT score may vary across the sequence linking the at least two beta solenoid domains. In some embodiments, the pLDDT score between the at least two beta solenoid domains is 50% or more, 51% or more, 52% or more, 53% or more, 54% or more, or 55% or more. In some embodiments, the pLDDT score between the at least two beta solenoid domains is 90% or less, 89% or less, 88% or less, 87% or less, 86% or less, 85% or less, 84% or less, 83% or less, 82% or less, 81% or less, 80% or less, 79% or less, 78% or less, 77% or less, 76% or less, 75% or less, 74% or less, 73% or less, 72% or less, 71% or less, 70% or less, 69% or less, 68% or less, 67% or less, 66% or less, or 65% or less. In some embodiments, the pLDDT score between the at least two beta solenoid domains is from 50% to 90%, from 50% to 89%, from 50% to 88%, from 50% to 87%, from 50% to 86% from 50% to 85%, from 50% to 84%, from 50% to 83%, from 50% to 82%, from 50% to 81%, from 50% to 80%, from 50% to 79%, from 50% to 78%, from 50% to 77%, from 50% to 76%, from 50% to 75%, from 50% to 74%, from 50% to 73%, from 50% to 72%, from 50% to 71%, from 50% to 70%, from 50% to 69%, from 50% to 68%, from 50% to 67%, or from 50% to 66%, or from 50% to 65%. In preferred embodiments, the at least two beta solenoid domains are linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more. In some embodiments, the sequence linking the beta solenoid domains has a minimum pLDDT score of 50% or more, 51% or more, 52% or more, 53% or more, 54% or more, or 55% or more. In some embodiments, the sequence linking the beta solenoid domains has a maximum pLDDT score of 90% or less, 89% or less, 88% or less, 87% or less, 86% or less, 85% or less, 84% or less, 83% or less, 82% or less, 81% or less, 80% or less, 79% or less, 78% or less, 77% or less, 76% or less, 75% or less, 74% or less, 73% or less, 72% or less, 71% or less, 70% or less, 69% or less, 68% or less, 67% or less, 66% or less, or 65% or less. In some embodiments, the sequence linking the beta solenoid domains has a pLDDT score of between 50% and 90%, between 50% and 89%, between 50% and 88%, between 50% and 87%, between 50% and 86% between 50% and 85%, between 50% and 84%, between 50% and 83%, between 50% and 82%, between 50% and 81%, between 50% and 80%, between 50% and 79%, between 50% and 78%, between 50% and 77%, between 50% and 76%, between 50% and 75%, between 50% and 74%, between 50% and 73%, between 50% and 72%, between 50% and 71%, between 50% and 70%, between 50% and 69%, between 50% and 68%, between 50% and 67%, or between 50% and 66%, or between 50% and 65%. In some embodiments, the sequence linking the at least two beta solenoid domains is not a beta solenoid domain. In some embodiments, the sequence linking the at least two beta solenoid domains does not consist of a beta solenoid domain. In some embodiments, the sequence linking the at least two beta solenoid domains does not comprise a beta solenoid domain. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of one or more capping sequences and / or one or more linker sequences (e.g. one or more rigid linker sequences). In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of one or more capping sequences. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of one or more linker sequences (e.g. one or more rigid linker sequences). In some embodiments, the sequence linking the at least two beta solenoid domains is not a flexible linker. In some embodiments, the sequence linking the at least two beta solenoid domains does not consist of a flexible linker. In some embodiments, the sequence linking the at least two beta solenoid domains does not comprise a flexible linker. Capping sequences The at least two beta solenoid domains may be linked by a sequence comprising or consisting of one or more capping sequences. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of at least one C-terminal capping sequence. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of at least one N-terminal capping sequence. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of at least one C-terminal capping sequence and at least one N-terminal capping sequence. In some embodiments, the sequence linking the at least two beta solenoid domains comprises or consists of from N-terminus to C-terminus: a C-terminal capping sequence and an N-terminal capping sequence. In some embodiments, the sequence linking the at least two beta solenoid domains consists of one C-terminal capping sequence and one N-terminal capping sequence. In some embodiments, the sequence linking the at least two beta solenoid domains consists of from N-terminus to C-terminus: a C-terminal capping sequence and an N-terminal capping sequence. In another aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein a C-terminal capping sequence of the first beta solenoid domain is directly fused to a N- terminal capping sequence of the second beta solenoid domain; and a C-terminal capping sequence. In some embodiments, each of the at least two beta solenoid domains are capped beta solenoid domains. In another aspect, the present invention provides a polypeptide comprising at least two capped beta solenoid domains, wherein the at least two capped beta solenoid domains are directly fused. As used herein, “directly fused” may mean that the sequences or domains are covalently linked by a peptide bond. For example, the C-terminal residue of a first beta solenoid domain may be covalently linked by a peptide bond to the N-terminal residue of a second beta solenoid domain. In some embodiments, the polypeptide comprises at least two capped beta solenoid domains, wherein C-terminal capping sequence of the first beta solenoid domain is directly fused to the N-terminal capping sequence of the second beta solenoid domain. In some embodiments, the polypeptide comprises at least three capped beta solenoid domains, wherein the C-terminal capping sequence of the first beta solenoid domain is directly fused to the N-terminal capping sequence of the second beta solenoid domain, and the C-terminal capping sequence of the second beta solenoid domain is directly fused to the N-terminal capping sequence of the third beta solenoid domain. In some embodiments, the polypeptide comprises at least four capped beta solenoid domains, wherein the C-terminal capping sequence of the first beta solenoid domain is directly fused to the N-terminal capping sequence of the second beta solenoid domain, the C-terminal capping sequence of the second beta solenoid domain is directly fused to the N-terminal capping sequence of the third beta solenoid domain, and the C-terminal capping sequence of the third beta solenoid domain is directly fused to the N-terminal capping sequence of the fourth beta solenoid domain. A consensus sequence consisting of a C-terminal capping sequence directly fused to an N- capping sequence is provided by SEQ ID NO: 114. In some embodiments, the polypeptide comprises the amino acid sequence of SEQ ID NO: 114. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of the amino acid sequence of SEQ ID NO: 114. Consensus directly fused capping sequences (SEQ ID NO: 114) Examples of directly fused capping sequences are provided in SEQ ID NOs: 115 to 137 and 322 to 329. ARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRR NFQHINLQEIELTN Example directly fused capping sequences 1 (SEQ ID NO: 115) AKTKGANLRKANLEGAKLDPVLWRTANLKGARMSKKQAQEYQRANGSMGKNEILNQYKNGRH DFSGINLAKADLEN Example directly fused capping sequences 2 (SEQ ID NO: 116) ADTRGANLDDAKLEGAELRPVLWRTASLSGARMSKKQKQQYQRANGTMQTKQILKEYKKGRT NFSGINLANANLKN Example directly fused capping sequences 3 (SEQ ID NO: 117) AKTTGANLKRANLKGATLDPVLWRTANLEGAKMKKEQKKEYKRARGTMRTKDILKQYNNGRH NFSGIDLANADLEK Example directly fused capping sequences 4 (SEQ ID NO: 118) AKTTGAELRNADLRGAKLDPVLWRTAKLTGAQMTKKQKKEYQRARGTMQTNQILKEYKNGRH NFSKINLANANLQN Example directly fused capping sequences 5 (SEQ ID NO: 119) AKTKGADLARADLRGAKLRPVLWNTARLEGAQMTKEQKKEYQRANGSMGTKEILNEYKKGRK KFANINLANADLSN Example directly fused capping sequences 6 (SEQ ID NO: 120) AETTGAKLARADLRGAKLRPVLWNTATLTGAQMTTKQKQQYKRANGTMRRDDILREYNNGRH NFSGINLAKADLRD Example directly fused capping sequences 7 (SEQ ID NO: 121) AKTKGAKLSGADLRGAKLDPVLWNTAKLQGAKMTDNQRNEYKRANGNMKTNKILKNYKKGRH DFTGIDLANADLEN Example directly fused capping sequences 8 (SEQ ID NO: 122) ANTQGAKLDNADLRGAKLRPVLWNTASLQGAKMQKKQKEQYKRAKGSMQADQILQQYDNGRR NFSGIDLENADLRN Example directly fused capping sequences 9 (SEQ ID NO: 123) AETEGADLRRADLRGATLDPVLWNKADLKGAQMKDNQRKEYKRANGTMRTNEILQEYKNGRH NFEGIDLANANLQN Example directly fused capping sequences 10 (SEQ ID NO: 124) ANTQDANLQNADLRGATLDPVLWNTANLNGAQMTDKQKQEYQRANGSMHASEILQEYDNGRH DFRGIKLEDADLSG Example directly fused capping sequences 11 (SEQ ID NO: 125) AETTGAKLDNADLRGAKLDPVLWNTASLSGAQMTTAQAEQYERANGTMRTKDILKEYNKGRH DFSGINLRNANLRN Example directly fused capping sequences 12 (SEQ ID NO: 126) AKTTGADLANADLRGATLDPVLWRTARLTGAQMKTEQKNQYKRANGHMQTNQILEEYNRGRH NFAGIDLQGADLRN Example directly fused capping sequences 13 (SEQ ID NO: 127) ADTRGADLRNANLRGATLDPVLWNTADLTGAQMEAEQKKEYNRARGTMSTNEILNEYKKGRH DFSGINLKDADLSN Example directly fused capping sequences 14 (SEQ ID NO: 128) ANTSGADLRNADLRGATLDPVLWNTANLKGAKMEDNQKAEYERANGSMTTDKILEEYNKGRT DFRDIDLQNANLQN Example directly fused capping sequences 15 (SEQ ID NO: 129) ANTSGADLENADLRGAELQPVLWRTARLQGAQMETAQKEEYKRANGSMHASKILQEYNNGRH DFANIDLAKANLEN Example directly fused capping sequences 16 (SEQ ID NO: 130) ANTKGANLDNADLRGATLDPVLWRTASLQGAKMTTRQAEEYDRARGSMQTEQILQEYNRGRT DFAKIDLENANLKN Example directly fused capping sequences 17 (SEQ ID NO: 131) AETTGANLNNADLRGATLDPVLWNTASLEGAQMKKEQKKEYKRANGTMATDKILQQYKDGQH DFSGIDLANADLSK Example directly fused capping sequences 18 (SEQ ID NO: 132) ANTQGANLDNADLRGATLDPVLWNTASLEGAQMTTEEAKEYQRANGSMQTNQILKEYNKGRH NFSGIDLQNADLSG Example directly fused capping sequences 19 (SEQ ID NO: 133) AETEGAELNDADLRGAELAPVLWNTASLEGAKMEEKQEQQYDRARGTMGTNEILQQYKNGQH DFADIDLKNANLQK Example directly fused capping sequences 20 (SEQ ID NO: 134) AETTGADLNNADLRGATLDPVLWNTAKLQGAQMTTNQKAEYQRANGSMSANAILEAYDRGQR DFSKINLANANLSK Example directly fused capping sequences 21 (SEQ ID NO: 135) ANTRGARLQDADLRGAKLRPVLWNTANLEGAQMQTNQKAEYQRANGSMHEDEILDEYNNGRK NFSGIDLQGADLED Example directly fused capping sequences 22 (SEQ ID NO: 136) ARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGHMNVGEILRHYAAGKR NFQHINLQEIELTN Example directly fused capping sequences 23 (SEQ ID NO: 137) AKTTGADLSGANLEGATVDLSFYTEAKLTGATFSADQKKALARAKGSLTAAEVLALKAAGER DFSGADLSGIDLSG Example directly fused capping sequences 24 (SEQ ID NO: 322) ANVQGANLSEANLEGAKVDLSFFTQAALEGAKFSEEQKKLLERAKGRMRRDEILEEYRRGRR NFQHINLQEIELTN Example directly fused capping sequences 25 (SEQ ID NO: 323) ARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGSLTAEEILARKAAGEK DFSGADLSHVNLSN Example directly fused capping sequences 26 (SEQ ID NO: 324) ARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRR NFQHINLQEIELTR Example directly fused capping sequences 27 (SEQ ID NO: 325) ARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGSLSAEEILQLKAAGET DFSGADLSNVDLSN Example directly fused capping sequences 28 (SEQ ID NO: 326) ANVEGANLSEANLEGAKFDLSLYRQANLEGAKLTPEQLELKLRALGRMRRDEILEEYRRGRR NFQHINLQEIELTN Example directly fused capping sequences 29 (SEQ ID NO: 327) ARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRR NFQHINLQEIELTH Example directly fused capping sequences 30 (SEQ ID NO: 328) ANVQGANLSGANLEGAKVDLSFFTQANLEGAKFSEEQLRLLERAKGRMRRDEILEEYRRGRR NFQHINLQEIELTN Example directly fused capping sequences 31 (SEQ ID NO: 329) In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of an amino sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 115 to 137. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of an amino sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 322 to 329. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of an amino sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 115 to 137. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of an amino sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 322 to 329. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of the amino acid sequence of any of SEQ ID NOs: 115 to 137. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of the amino acid sequence of any of SEQ ID NOs: 322 to 329. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of an amino sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to SEQ ID NO: 115. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of an amino sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 115. In some embodiments, the polypeptide comprises at least one copy, at least two copies, or at least three copies of the amino acid sequence of SEQ ID NO: 115. Rigid linkers The at least two beta solenoid domains may be linked by a sequence comprising or consisting of one or more linker. Fusing the at least two beta solenoid domains with a linker may provide greater control. In the absence of a linker, fusing two rigid protein domains with just a single peptide bond creates a point of minimal flexibility. The degree of rotation allowed by this single peptide bond is influenced by several factors, including steric hindrance from adjacent amino acid residues and potential electrostatic or hydrophobic interactions between the fused domains. Additionally, the overall folding and tertiary structure of the domains can also have an impact on the mobility at the junction. Use of a linker may provide greater control regarding the mobility at the junction between the beta solenoid domains. The presence of a linker allows each of the linked components to act somewhat independently of one another whilst being spatially restricted and retaining connectivity. Typically, linkers are formed from amino acids, however, other means of linking protein domains are known. Linkers are commonly used to link protein domains, for example when tagging a protein with GFP (see e.g. Chen, X., et al., 2013. Advanced drug delivery reviews, 65(10), pp.1357-1369). In some embodiments, the at least two beta solenoid domains are linked by a sequence comprising or consisting of one or more rigid linker. In some embodiments, the at least two beta solenoid domains are linked by a rigid linker. Suitable rigid linker sequences are known in the art (see e.g. Chen, X., et al., 2013. Advanced drug delivery reviews, 65(10), pp.1357- 1369) and may include alpha helix-forming linkers or proline-rich linkers. Many natural inter- domain linkers consist of Pro, Arg, Phe, Thr, Glu, and Gln residues that act as rigid spacers (see e.g. Reddy et al., 2013. Protein science, 22(2), pp.153-167). Examples of alpha helix-forming linkers include (EAAAK)n, wherein n is from 1 to 5 (SEQ ID NO: 138), (EAAAR)n, wherein n is from 1 to 5 (SEQ ID NO: 139), (AAAAK)n, wherein n is from 1 to 5 (SEQ ID NO: 140), A(EAAAK)nA, wherein n is from 2 to 5 (SEQ ID NO: 141), and A(EAAAK)4ALEA(EAAAK)4A (SEQ ID NO: 142). Examples of proline-rich linkers may include PAPAP (SEQ ID NO: 143), (XP)n, wherein n is from 5 to 17 (SEQ ID NO: 144), (Ala-Pro)n, wherein n is from 5 to 17 (SEQ ID NO: 145), and (Pro)n, wherein n is from 5 to 30 (SEQ ID NO: 146). In some embodiments, the at least two beta solenoid domains are linked by an amino acid sequence comprising or consisting of any of SEQ ID NOs: 138 to 146. In one aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein the at least two beta solenoid domains are linked by an amino acid sequence comprising or consisting of any of SEQ ID NOs: 138 to 146; and a C-terminal capping sequence. In another aspect, the present invention provides a polypeptide comprising at least two capped beta solenoid domains, wherein the at least two capped beta solenoid domains are linked by an amino acid sequence comprising or consisting of any of SEQ ID NOs: 138 to 146. Other linkers In one aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein a C-terminal capping sequence of the first beta solenoid domain is linked without a linker to a N-terminal capping sequence of the second beta solenoid domain; and a C-terminal capping sequence. In another aspect, the present invention provides a polypeptide comprising at least two capped beta solenoid domains, wherein the at least two capped beta solenoid domains are linked without a linker. In another aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein a C-terminal capping sequence of the first beta solenoid domain is linked to a N-terminal capping sequence of the second beta solenoid domain, wherein the first beta solenoid domain and the second beta solenoid domain are not linked by a flexible linker; and a C- terminal capping sequence. In another aspect, the present invention provides a polypeptide comprising at least two capped beta solenoid domains, wherein the at least two capped beta solenoid domains are not linked by a flexible linker. Flexible linkers are generally composed of small, non-polar (e.g. Gly) or polar (e.g. Ser) amino acids, which do not have bulky side chains. The small size of these amino acids provides flexibility, and allows for mobility of the connecting functional domains. The incorporation of Ser can maintain the stability of the linker in aqueous solutions by forming hydrogen bonds with the water molecules, and therefore reduces the unfavorable interaction between the linker and the protein moieties (see e.g. Chen, X., et al., 2013. Advanced drug delivery reviews, 65(10), pp.1357-1369). The polypeptide may have a reduced overall abundance of glycine and / or serine compared to a polypeptide comprising beta solenoid domains linked by a flexible linker. In some embodiments, the polypeptide has a glycine abundance of 7.5% or less, 7.4% or less, 7.3% or less, 7.2% or less, 7.1% or less, or 7.0% or less. In some embodiments, the polypeptide has a serine abundance of 5.9% or less or 5.8% or less. In some embodiments, the polypeptide has a total glycine / serine abundance of 13.8% or less, 13.7% or less, 13.6% or less, 13.5% or less, 13.4% or less, 13.3% or less, 13.2% or less, 13.1% or less, 13.0% or less, 12.9% or less, 12.8% or less, or 12.7% or less. The polypeptide may have a reduced local abundance of glycine and / or serine compared to a polypeptide comprising beta solenoid domains linked by a flexible linker. This may be determined, for example, by a moving average of the glycine and / or serine abundance (e.g. using a window size of ten amino acids). In some embodiments, the polypeptide comprises no regions of ten amino acids having three or more glycine residues. In some embodiments, the polypeptide comprises no regions of ten amino acids having four or more total glycine / serine residues. A linker may comprise or consist of (G / A / S / T)x, wherein x is 3 or greater, for example wherein x is from 3 to 16, or wherein x is 4 or greater, for example wherein x is from 4 to 16. A linker may comprise or consist of (G / A / S)x, wherein x is 3 or greater, for example wherein x is from 3 to 16, or wherein x is 4 or greater, for example wherein x is from 4 to 16. In one aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein a C-terminal capping sequence of the first beta solenoid domain is linked to a N-terminal capping sequence of the second beta solenoid domain, wherein the first beta solenoid domain and the second beta solenoid domain are not linked by a linker comprising or consisting of (G / A / S / T)x or (G / A / S)x, wherein x is 3 or greater; and a C-terminal capping sequence. In another aspect, the present invention provides a polypeptide comprising at least two capped beta solenoid domains, wherein the at least two capped beta solenoid domains are not linked by a linker comprising or consisting of (G / A / S / T)x or (G / A / S)x, wherein x is 3 or greater. Example flexible linkers include poly-glycine linkers, poly-alanine linkers, poly-serine linkers, glycine-rich linkers, alanine-rich linkers, serine-rich linkers, glycine- and alanine-rich linkers, glycine- and serine-rich linkers, and glycine / alanine / serine-rich linkers. In one aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein a C-terminal capping sequence of the first beta solenoid domain is linked to a N-terminal capping sequence of the second beta solenoid domain, wherein the first beta solenoid domain and the second beta solenoid domain are not linked by a poly-glycine linker, a poly- alanine linker, a poly-serine linker, a glycine rich linker, an alanine-rich linker, a serine-rich linker, a glycine- and alanine-rich linker, or a glycine / alanine / serine rich linker; and a C- terminal capping sequence. In another aspect, the present invention provides a polypeptide comprising at least two capped beta solenoid domains, wherein the at least two capped beta solenoid domains are not linked by a poly-glycine linker, a poly-alanine linker, a poly-serine linker, a glycine rich linker, an alanine-rich linker, a serine-rich linker, a glycine- and alanine-rich linker, or a glycine / alanine / serine rich linker. In another aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein a C-terminal capping sequence of the first beta solenoid domain is linked to a N-terminal capping sequence of the second beta solenoid domain, wherein the first beta solenoid domain and the second beta solenoid domain are not linked by a poly-glycine linker, a poly- alanine linker, a glycine rich linker, an alanine-rich linker, a glycine- and alanine-rich linker, or a glycine / alanine / serine rich linker; and a C-terminal capping sequence. In another aspect, the present invention provides a polypeptide comprising at least two capped beta solenoid domains, wherein the at least two capped beta solenoid domains are not linked by a poly-glycine linker, a poly-alanine linker, a glycine rich linker, an alanine-rich linker, a glycine- and alanine-rich linker, or a glycine / alanine / serine rich linker. A poly-glycine linker may consist of (Gly)x, wherein x is 3 or greater, for example wherein x is from 3 to 8, or 4 or greater, for example wherein x is from 4 to 8. A poly-alanine linker may consist of (Ala)x, wherein x is 3 or greater, for example wherein x is from 3 to 8, or 4 or greater, for example wherein x is from 4 to 8. A poly-serine linker may consist of (Ser)x, wherein x is 3 or greater, for example wherein x is from 3 to 8, or 4 or greater, for example wherein x is from 4 to 8. A glycine-rich linker may comprise 2 or more glycine residues, for example from 2 to 8 glycine residues, 3 or more glycine residues, for example from 3 to 8 glycine residues, or 4 or more glycine residues, for example from 4 to 8 glycine residues. An alanine-rich linker may comprise 2 or more alanine residues, for example from 2 to 8 alanine residues, 3 or more alanine residues, for example from 3 to 8 alanine residues, or 4 or more alanine residues, for example from 4 to 8 alanine residues. A serime-rich linker may comprise 2 or more serine residues, for example from 2 to 8 serine residues, 3 or more serine residues, for example from 3 to 8 serine residues, or 4 or more serine residues, for example from 4 to 8 serine residues. A glycine- and alanine-rich linker may comprise or consist of 3 or more total glycine / alanine residues, for example from 3 to 8 total glycine / alanine residues, or 4 or more total glycine / alanine residues, for example from 4 to 8 total glycine / alanine residues. A glycine- and serine-rich linker may comprise or consist of 3 or more total glycine / serine residues, for example from 3 to 8 total glycine / serine residues, or 4 or more total glycine / serine residues, for example from 4 to 8 total glycine / serine residues. A glycine / alanine / serine-rich linker may comprise or consist of 3 or more total glycine / alanine / serine residues, for example from 3 to 8 total glycine / alanine / serine residues, or 4 or more total glycine / alanine / serine residues, for example from 4 to 8 total glycine / alanine / serine residues. Example flexible linkers may comprise of consist of any of the following amino acid sequences: (Gly) (Gly) (SEQ ID NO: 147) (Gly) (SEQ ID NO: 148) (Gly) (SEQ ID NO: 149) (Gly) (SEQ ID NO: 150) (Gly) (SEQ ID NO: 151) (Ala) (Ala) (SEQ ID NO: 152) (Ala) (SEQ ID NO: 153) (Ala) (SEQ ID NO: 154) (Ala) (SEQ ID NO: 155) (Ala) (SEQ ID NO: 156) (Ser) (Ser) (SEQ ID NO: 157) (Ser) (SEQ ID NO: 158) (Ser) (SEQ ID NO: 159) (Ser) (SEQ ID NO: 160) (Ser) (SEQ ID NO: 161) (GS) (GS) (SEQ ID NO: 162) (GS) (SEQ ID NO: 163) (GS) (SEQ ID NO: 164) (AG) (AG) (SEQ ID NO: 165) (AG) (SEQ ID NO: 166) (AG) (SEQ ID NO: 167) (TG) (TG) (SEQ ID NO: 168) (TG) (SEQ ID NO: 169) (TG) (SEQ ID NO: 170) (GGS) (GGS) (SEQ ID NO: 171) (GGS) (SEQ ID NO: 172) (GGS) (SEQ ID NO: 173) (TGS) (TGS) (SEQ ID NO: 174) (TGS) (SEQ ID NO: 175) (TGS) (SEQ ID NO: 176) (GGGS) (SEQ ID NO: 177) (GGGS) (SEQ ID NO: 178) (GGGS) (SEQ ID NO: 179) (GGGS) (SEQ ID NO: 180) (GGGGS) (SEQ ID NO: 181) (GGGGS) (SEQ ID NO: 182) (GGGGS) (SEQ ID NO: 183) (GGGGS) (SEQ ID NO: 184) (GSSGSS) (SEQ ID NO: 185) (GSSGSS) (SEQ ID NO: 186) (GSSGSS) (SEQ ID NO: 187) (GSSGSS) (SEQ ID NO: 188) (GSGSGS) (SEQ ID NO: 189) (GSGSGS) (SEQ ID NO: 190) (GSGSGS) (SEQ ID NO: 191) (GSGSGS) (SEQ ID NO: 192) (GSSSSSS) (SEQ ID NO: 193) (GSSSSSS) (SEQ ID NO: 194) (GSSSSSS) (SEQ ID NO: 195) (GSSSSSS) (SEQ ID NO: 196) GGGSAGGGS (SEQ ID NO: 197) GGGSAAGGGS (SEQ ID NO: 198) GGGSAAAGGGS (SEQ ID NO: 199) GGGSAAAAGGGS (SEQ ID NO: 200) GGGSAAAAAGGGS (SEQ ID NO: 201) GGGSAAAAAAGGGS (SEQ ID NO: 202) GGGGSAGGGGS (SEQ ID NO: 203) GGGGSAAGGGGS (SEQ ID NO: 204) GGGGSAAAGGGGS (SEQ ID NO: 205) GGGGSAAAAGGGGS (SEQ ID NO: 206) GGGGSAAAAAGGGGS (SEQ ID NO: 207) GGGGSAAAAAAGGGGS(SEQ ID NO: 208) GGGGSLVPRGSGGGGS(SEQ ID NO: 209) GGGGSLVPRGSGGGG (SEQ ID NO: 210) GGSGGHMGSGG (SEQ ID NO: 211) In one aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein a C-terminal capping sequence of the first beta solenoid domain is linked to a N-terminal capping sequence of the second beta solenoid domain, wherein the first beta solenoid domain and the second beta solenoid domain are not linked by any of the flexible linkers above (including any of SEQ ID NOs: 147 to 211). In another aspect, the present invention provides a polypeptide comprising at least two capped beta solenoid domains, wherein the at least two beta solenoid domains are not linked by any of the flexible linkers above (including any of SEQ ID NOs: 147 to 211). In another aspect, the present invention provides a polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein a C-terminal capping sequence of the first beta solenoid domain is linked to a N-terminal capping sequence of the second beta solenoid domain, wherein the first beta solenoid domain and the second beta solenoid domain are not linked by GGGS (SEQ ID NO: 177) or GGGSAAAAAAGGGS (SEQ ID NO: 202). In another aspect, the present invention provides a polypeptide comprising at least two capped beta solenoid domains, wherein the at least two capped beta solenoid domains are not linked by GGGS (SEQ ID NO: 177) or GGGSAAAAAAGGGS (SEQ ID NO: 202). Other polypeptide sequences The polypeptide may further comprise one or more tag sequences. The tag sequence may be at the N-terminus or C-terminus of the polypeptide. Tag sequences (also known as “tagging sequences”) are commonly used for purification or visualisation of a protein, for example on a western blot or through fluorescence microscopy. Examples of useful tag sequences include, but are not limited to, Albumin-binding protein (ABP), Alkaline Phosphatase (AP), AU1 epitope, AU5 epitope, Bacteriophage T7 epitope (17- tag), Bacteriophage V5 epitope (V5-tag), Biotin-carboxy carrier protein (BCCP), Bluetongue virus tag (B-tag), Calmodulin binding peptide (CBP), Chloramphenicol Acetyl Transferase (CAT), Cellulose binding domain (CBP), Chitin binding domain (CBD), Choline- binding domain (CBD), Dihydrofolate reductase (DHFR), E2 epitope, FLAG epitope, Galactose-binding protein (GBP), Green fluorescent protein (GFP), Glu-Glu (EE-tag), Glutathione S-transferase (GST), Human influenza hemagglutinin (HA), HaloTag®, Histidine affinity tag (HAT), Horseradish Peroxidase (HRP), HSV epitope, Ketosteroid isomerase (KSI), KT3 epitope, LacZ, Luciferase, Maltose-binding protein (MBP), Myc epitope, NusA, PDZ domain, PDZ ligand, Polyarginine (Arg-tag), Polyaspartate (Asp-tag, Polycysteine (Cys- tag), Polyhistidine (His- tag), Polyphenylalanine (Phe-tag), Profinity eXact, Protein C S1-tag, S-tag, Streptavadin-binding peptide (SBP), Staphylococcal protein A (Protein A), Staphylococcal protein G (Protein G), Strep-tag, Streptavadin, Small Ubiquitin-like Modifier (SUMO), Tandem Affinity Purification (TAP), T7 epitope, Thioredoxin (Trx), TrpE, Ubiquitin, Universal (see e.g. Kimple, M.E., et al., 2013. Current protocols in protein science, 73(1), pp.9-9). In some embodiments, the tag sequence is a His-tag. A His-tag may comprise or consist of 5-10 histidine residues, for example (His)6(SEQ ID NO: 212). In some embodiments, the tag sequence is a Gly-His-tag (e.g. GHHHH (SEQ ID NO: 213), GHHHHHH (SEQ ID NO: 214), or GSSHHHHHH (SEQ ID NO: 215)). In some embodiments, the polypeptide comprises a tag sequence and a protease cleavage site, e.g. at the N-terminus of the polypeptide. The protease cleavage site may be used to cleave the tag sequence once the polypeptide has been purified. In some embodiments, the protease cleavage site is a thrombin cleavage site, e.g. LVPRGS (SEQ ID NO: 216) or a TEV protease site, e.g. ENLYFQS (SEQ ID NO: 217). In some embodiments, the protease cleavage site is a thrombin cleavage site, e.g. LVPRGS (SEQ ID NO: 216). In some embodiments, the polypeptide comprises a His-tag and a thrombin cleavage site. An example amino acid sequence comprising a His-tag and a thrombin cleavage site is provided in SEQ ID NO: 218. In some embodiments, the tag sequence comprises or consists of an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence similarity to SEQ ID NO: 218. In some embodiments, the tag sequence comprises or consists of an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to SEQ ID NO: 218. In some embodiments, the tag sequence comprises or consists the amino acid sequence of SEQ ID NO: 218. MGSSHHHHHHSSGLVPRGS Example His-tag and a thrombin cleavage site (SEQ ID NO: 218) The polypeptide may further comprise one or more tail sequences. Suitably, the one or more tail sequences are at the C-terminus of the polypeptide. As used herein, a “tail sequence” may refer to an optional hydrophilic sequence, with a flexible structure, which can serve the purpose of increasing protein solubility and / or inhibiting crystallisation. Typically, tail sequences are from 1 to 10 amino acids in length (e.g. 5 amino acids in length) and comprise from 1 to 10 amino acids (e.g.3, 4, or 5 amino acids) selected from the group consisting of charged, polar, glycine and alanine residues. Example tail sequences are provided in SEQ ID NOs: 219 to 240. Example tail sequence 1 KSDDG (SEQ ID NO: 219) Example tail sequence 2 KQTEG (SEQ ID NO: 220) Example tail sequence 3 KQTKG (SEQ ID NO: 221) Example tail sequence 4 QQTNG (SEQ ID NO: 222) Example tail sequence 5 KTTEG (SEQ ID NO: 223) Example tail sequence 6 QQDNG (SEQ ID NO: 224) Example tail sequence 7 QQDEG (SEQ ID NO: 225) Example tail sequence 8 QKDNG (SEQ ID NO: 226) Example tail sequence 9 KQDNG (SEQ ID NO: 227) Example tail sequence 10 QEDKG (SEQ ID NO: 228) Example tail sequence 11 RKTNG (SEQ ID NO: 229) Example tail sequence 12 KSTDG (SEQ ID NO: 230) Example tail sequence 13 QKDNG (SEQ ID NO: 231) Example tail sequence 14 QETRG (SEQ ID NO: 232) Example tail sequence 15 QQDKG (SEQ ID NO: 233) Example tail sequence 16 QSDDG (SEQ ID NO: 234) Example tail sequence 17 QEDKG (SEQ ID NO: 235) Example tail sequence 18 QSDDG (SEQ ID NO: 236) Example tail sequence 19 KEDRG (SEQ ID NO: 237) Example tail sequence 20 QSDDG (SEQ ID NO: 238) Example tail sequence 21 QSDDG (SEQ ID NO: 239) Example tail sequence 22 QQTNG (SEQ ID NO: 240) In some embodiments, a tail sequence comprises or consists of an amino acid sequence having at least 80% sequence similarity to any of SEQ ID NOs: 219 to 240. In some embodiments, a tail sequence comprises or consists of an amino acid sequence having at least 80% sequence identity to any of SEQ ID NOs: 219 to 240. In some embodiments, a tail sequence comprises or consists of the amino acid sequence of any of SEQ ID NOs: 219 to 240. In some embodiments, a tail sequence comprises or consists of an amino acid sequence having at least 80% sequence similarity to SEQ ID NO: 219. In some embodiments, a tail sequence comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219. In some embodiments, a tail sequence comprises or consists of the amino acid sequence of any of SEQ ID NO: 219. Example polypeptides A polypeptide according to the present invention may comprise or consist of a combination of all of, or any subset of, the following components: a tag sequence (TAG), an N-terminal capping sequence (NCAP), a sequence that comprises at least 4 units of a beta solenoid consensus motif (UNITS), a sequence linking the at least two beta solenoid domains (LINK), a C-terminal cap sequence (CCAP), and a tail sequence (TAIL). A polypeptide according to the present invention may comprise or consist of the following from N-terminus to C-terminus: NCAP – UNITSn– [LINK – UNITSn]m-1– CCAP TAG – NCAP – UNITSn– [LINK – UNITSn]m-1– CCAP NCAP – UNITSn– [LINK – UNITSn]m-1– CCAP – TAIL TAG – NCAP – UNITSn– [LINK – UNITSn]m-1– CCAP – TAIL NCAP – UNITSn– [LINK – UNITSn]m-1– CCAP – TAG NCAP – UNITSn– [LINK – UNITSn]m-1– CCAP – TAIL – TAG NCAP – UNITSn– [LINK – UNITSn]m-1– CCAP – TAG – TAIL wherein m is at least 2, wherein n is at least 4, and wherein LINK has a minimum predicted local distance difference test (pLDDT) score of 50% or more. In some embodiments, LINK is not a beta solenoid domain. In some embodiments, LINK comprises or consists of one or more capping sequences and / or one or more rigid linker sequences. In some embodiments, LINK comprises or consists of at least one C-terminal capping sequence. In some embodiments, LINK comprises or consists of at least one N-terminal capping sequence. In some embodiments, LINK comprises or consists of at least one C- terminal capping sequence and at least one N-terminal capping sequence. In some embodiments, LINK comprises or consists of from N-terminus to C-terminus: a C-terminal capping sequence and an N-terminal capping sequence. In some embodiments, LINK consists one C-terminal capping sequence and one N-terminal capping sequence. In some embodiments, LINK consists of from N-terminus to C-terminus: a C-terminal capping sequence and an N-terminal capping sequence. In some embodiments, LINK comprises or consists of the amino acid sequence of SEQ ID NO: 114. In some embodiments, LINK comprises or consists of an amino sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 115 to 137 or 322 to 329. In some embodiments, LINK comprises or consists of the amino acid sequence of any of SEQ ID NOs: 115 to 137 or 322 to 329. In some embodiments, LINK comprises or consists of an amino sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 115. In some embodiments, LINK comprises or consists of the amino acid sequence of SEQ ID NO: 115. In some embodiments, LINK comprises or consists of a rigid linker sequence. In some embodiments, each of the at least two bet solenoid domains is flanked by an N- terminal capping sequence and a C-terminal capping sequence. In some embodiments, the polypeptide of the present invention comprise of consists of the following from N-terminus to C-terminus: [NCAP – UNITSn– CCAP]mTAG – [NCAP – UNITSn– CCAP]m[NCAP – UNITSn– CCAP]m– TAIL TAG – [NCAP – UNITSn– CCAP]m– TAIL [NCAP – UNITSn– CCAP]m– TAG [NCAP – UNITSn– CCAP]m– TAIL – TAG [NCAP – UNITSn – CCAP]m – TAG – TAIL wherein m is at least 2, and wherein n is at least 4. In some embodiments, UNITS comprises or consists of the beta solenoid consensus motif of any of SEQ ID NOs: 1 to 11. In some embodiments, UNITS comprises or consists of the beta solenoid consensus motif of any of SEQ ID NOs: 1 to 5. In some embodiments, UNITS comprises or consists of the beta solenoid consensus motif of SEQ ID NO: 1. In some embodiments, UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 12 or 13. In some embodiments, NCAP comprises of consists of the consensus sequence of SEQ ID NO: 50. In some embodiments, NCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 52 to 74 or 283 to 287. In some embodiments, NCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 74 or 283 to 287. In some embodiments, NCAP comprises or consists of the amino acid sequence of any of SEQ ID NOs: 52 to 74 or 283 to 287. In some embodiments, NCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 52 to 73. In some embodiments, NCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 73. In some embodiments, NCAP comprises or consists of the amino acid sequence of any of SEQ ID NOs: 52 to 73. In some embodiments, CCAP comprises of consists of the consensus sequence of SEQ ID NO: 51. In some embodiments, CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 75 to 97 and 288 to 291. In some embodiments, CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 97 and 288 to 291. In some embodiments, CCAP comprises or consists of the amino acid sequence of any of SEQ ID NOs: 75 to 97 and 288 to 291. In some embodiments, CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 75 to 96. In some embodiments, CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 96. In some embodiments, CCAP comprises or consists of the amino acid sequence of any of SEQ ID NOs: 75 to 96. In some embodiments, TAG comprises or consists of an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence similarity to SEQ ID NO: 218. In some embodiments, TAG comprises or consists of an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to SEQ ID NO: 218. In some embodiments, TAG comprises or consists of the amino acid sequence of SEQ ID NO: 218. In some embodiments, TAIL comprises or consists of an amino acid sequence having at least 80% sequence similarity to any of SEQ ID NOs: 219 to 240. In some embodiments, TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to any of SEQ ID NOs: 219 to 240. In some embodiments, TAIL comprises or consists of the amino acid sequence of any of SEQ ID NOs: 219 to 240. In some embodiments, m is at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, or at least 100. In some embodiments, m is 100 or less, 95 or less, 90 or less, 85 or less, 80 or less, 75 or less, 70 or less, 65 or less, 60 or less, 55 or less, 50 or less, 45 or less, 40 or less, 35 or less, 30 or less, 29 or less, 28 or less, 27 or less, 26 or less, 25 or less, 24 or less, 23 or less, 22 or less, 21 or less, 20 or less, 19 or less, 18 or less, 17 or less, 16 or less, 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, or 8 or less. In some embodiments, m is from 2 to 100, from 2 to 95, from 2 to 90, from 2 to 85, from 2 to 80, from 2 to 75, from 2 to 70, from 2 to 65, from 2 to 60, from 2 to 55, from 2 to 50, from 2 to 45, from 2 to 40, from 2 to 35, from 2 to 30, from 2 to 29, from 2 to 28, from 2 to 27, from 2 to 26, from 2 to 25, from 2 to 24, from 2 to 23, from 2 to 22, from 2 to 21, from 2 to 20, from 2 to 19, from 2 to 18, from 2 to 17, from 2 to 16, from 2 to 15, from 2 to 14, from 2 to 13, from 2 to 12, from 2 to 11, from 2 to 10, from 2 to 9, from 2 to 8, from 3 to 8, or from 4 to 8. In some embodiments, n is at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, or at least 200. In some embodiments, n is less than 3000, less than 2000, less than 1000, less than 500, less than 400, less than 300, less than 200, less than 100, less than 90, less than 80, less than 70, less than 60, less than 50, less than 40, less than 30, less than 29, less than 28, less than 27, less than 26, less than 25, less than 24, less than 23, less than 22, less than 21, less than 20, less than 19, less than 18, less than 17, less than 16, less than 15, less than 14, less than 13, less than 12, less than 11, less than 10, less than 9, less than 8, less than 7, or less than 6. In some embodiments, n is from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30. In some embodiments, (i) (a) UNITS consists of the beta solenoid consensus motif of any of SEQ ID NOs: 1 to 11, preferably any of SEQ ID NOs: 1 to 5, more preferably SEQ ID NO: 1; (b) NCAP comprises of consists of the consensus sequence of SEQ ID NO: 50, preferably NCAP comprises of consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 74 or 283 to 287, more preferably NCAP comprises of consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 52 to 73; (c) CCAP comprises of consists of the consensus sequence of SEQ ID NO: 51, preferably CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 97 and 288 to 291, more preferably CCAP comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 75 to 96; (d) TAG comprises or consists of an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to SEQ ID NO: 218, preferably TAG comprises or consists of the amino acid sequence of SEQ ID NO: 218; and (e) TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to any of SEQ ID NOs: 219 to 240, preferably TAIL comprises or consists of the amino acid sequence of any of SEQ ID NOs: 219 to 240; (ii) m is from 2 to 100, from 2 to 95, from 2 to 90, from 2 to 85, from 2 to 80, from 2 to 75, from 2 to 70, from 2 to 65, from 2 to 60, from 2 to 55, from 2 to 50, from 2 to 45, from 2 to 40, from 2 to 35, from 2 to 30, from 2 to 29, from 2 to 28, from 2 to 27, from 2 to 26, from 2 to 25, from 2 to 24, from 2 to 23, from 2 to 22, from 2 to 21, from 2 to 20, from 2 to 19, from 2 to 18, from 2 to 17, from 2 to 16, from 2 to 15, from 2 to 14, from 2 to 13, from 2 to 12, from 2 to 11, from 2 to 10, from 2 to 9, from 2 to 8, from 3 to 8, or from 4 to 8; and (iii) n is from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30. In some embodiments: (1) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 14; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (2) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 15; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 53; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 76; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 220; (3) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 16; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 54; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 77; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 221; (4) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 17; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 55; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 78; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 222; (5) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 18; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 56; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 79; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 223; (6) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 19; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 57; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 80; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 224; (7) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 20; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 58; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 81; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 225; (8) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 21; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 59; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 82; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 226; (9) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 22; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 60; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 83; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 227; (10) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 23; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 61; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 84; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 228; (11) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 24; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 62; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 85; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 229; (12) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 25; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 63; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 86; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 230; (13) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 26; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 64; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 87; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 231; (14) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 27; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 65; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 88; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 232; (15) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 28; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 66; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 89; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 233; (16) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 29; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 67; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 90; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 234; (17) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 30; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 68; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 91; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 235; (18) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 31; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 69; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 92; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 236; (19) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 32; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 70; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 93; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 237; (20) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 33; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 71; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 94; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 238; (21) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 34; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 72; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 95; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 239; or (22) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 35; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 73; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 96; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 240. In some embodiments: (23) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 258; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (24) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 259; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 283; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 288; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (25) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 260; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (26) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 261; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (27) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 262; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (28) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 263; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (29) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 264; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (30) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 265; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (31) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 266; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 289; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (32) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 14; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 284; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (33) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 14; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 234; (34) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 267; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (35) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 268; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (36) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 269; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 285; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (37) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 270; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 285; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (38) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 271; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (39) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 14; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 286; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (40) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 272; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (41) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 273; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (42) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 274; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 290; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (43) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 275; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (44) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 276; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 287; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (45) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 277; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 287; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (46) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 278; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (47) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 266; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 291; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (48) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 279; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (49) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 280; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; (50) UNITSncomprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 281; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219; or (51) UNITSn comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 282; NCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 52; CCAP comprises or consists of an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 75; and TAIL comprises or consists of an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 219. In some embodiments: (1) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 14; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (2) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 15; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 53; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 76; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 220; (3) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 16; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 54; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 77; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 221; (4) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 17; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 55; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 78; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 222; (5) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 18; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 56; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 79; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 223; (6) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 19; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 57; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 80; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 224; (7) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 20; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 58; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 81; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 225; (8) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 21; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 59; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 82; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 226; (9) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 22; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 60; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 83; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 227; (10) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 23; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 61; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 84; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 228; (11) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 24; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 62; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 85; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 229; (12) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 25; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 63; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 86; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 230; (13) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 26; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 64; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 87; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 231; (14) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 27; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 65; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 88; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 232; (15) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 28; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 66; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 89; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 233; (16) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 29; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 67; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 90; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 234; (17) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 30; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 68; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 91; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 235; (18) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 31; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 69; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 92; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 236; (19) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 32; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 70; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 93; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 237; (20) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 33; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 71; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 94; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 238; (21) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 34; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 72; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 95; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 239; or (22) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 35; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 73; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 96; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 240. In some embodiments: (23) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 258; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (24) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 259; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 283; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 288; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (25) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 260; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (26) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 261; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (27) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 262; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (28) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 263; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (29) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 264; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (30) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 265; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (31) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 266; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 289; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (32) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 14; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 284; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (33) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 14; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 234; (34) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 267; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (35) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 268; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (36) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 269; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 285; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (37) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 270; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 285; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (38) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 271; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (39) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 14; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 286; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (40) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 272; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (41) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 273; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (42) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 274; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 290; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (43) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 275; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (44) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 276; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 287; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (45) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 277; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 287; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (46) UNITSncomprises or consists of the amino acid sequence of SEQ ID NO: 278; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (47) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 266; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 291; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (48) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 279; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (49) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 280; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; (50) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 281; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219; or (51) UNITSn comprises or consists of the amino acid sequence of SEQ ID NO: 282; NCAP comprises or consists of the amino acid sequence of SEQ ID NO: 52; CCAP comprises or consists of the amino acid sequence of SEQ ID NO: 75; and TAIL comprises or consists of the amino acid sequence of SEQ ID NO: 219. An example of a consensus polypeptide according to the present invention having the sequence [NCAP – UNITSn– CCAP]mis provided in SEQ ID NO: 241. (XMXXXXILXXYXXGXXXFXXIXLXX(I / A)XLXX(AXXXX)AX(T / L / F)XXAX(L / F )XXAX(L / F)XXAXVXPVLWXXAXLXGAX(M / V)XXXXXXX(Y / F)XXAXX) wherein X is any amino acid, wherein X is any amino acid, wherein X is L or F, wherein X is any amino acid, wherein X is any amino acid, wherein m is at least 2, and wherein n is at least 4. Example [NCAP – UNITS – CCAP] sequence (SEQ ID NO: 241) An example of a consensus polypeptide according to the present invention having the sequence TAG – [NCAP – UNITSn– CCAP]mis provided in SEQ ID NO: 242. MGSSHHHHHHSSGLVPRGS(XMXXXXILXXYXXGXXXFXXIXLXX(I / A)XLXX(AXXXX )AX(T / L / F)XXAX(L / F)XXAX(L / F)XXAXVXPVLWXXAXLXGAX(M / V)XXXXXXX(Y / F)XXAXX) wherein X is any amino acid, wherein X is any amino acid, wherein X is L or F, wherein X is any amino acid, wherein X is any amino acid, wherein m is at least 2, and wherein n is at least 4. Example TAG – [NCAP – UNITS – CCAP] sequence (SEQ ID NO: 242) An example of a consensus polypeptide according to the present invention having the sequence [NCAP – UNITSn – CCAP]m – TAIL is provided in SEQ ID NO: 243. (XMXXXXILXXYXXGXXXFXXIXLXX(I / A)XLXX(AXXXX)AX(T / L / F)XXAX(L / F )XXAX(L / F)XXAXVXPVLWXXAXLXGAX(M / V)XXXXXXX(Y / F)XXAXX)KSDDG wherein X is any amino acid, wherein X is any amino acid, wherein X is L or F, wherein X is any amino acid, wherein X is any amino acid, wherein m is at least 2, and wherein n is at least 4. Example [NCAP – UNITS – CCAP] – TAIL sequence (SEQ ID NO: 243) An example of a consensus polypeptide according to the present invention having the sequence TAG – [NCAP – UNITSn– CCAP]m– TAIL is provided in SEQ ID NO: 244. MGSSHHHHHHSSGLVPRGS(XMXXXXILXXYXXGXXXFXXIXLXX(I / A)XLXX(AXXXX )AX(T / L / F)XXAX(L / F)XXAX(L / F)XXAXVXPVLWXXAXLXGAX(M / V)XXXXXXX(Y / F)XXAXX)KSDDG wherein X is any amino acid, wherein X is any amino acid, wherein X is L or F, wherein X is any amino acid, wherein X is any amino acid, wherein m is at least 2, and wherein n is at least 4. Example TAG - [NCAP – UNITS – CCAP] – TAIL sequence (SEQ ID NO: 244) In some embodiments, X1is D, N, I, S, E, K, L, R, V, A, C, M, or T. In some embodiments, X1is D, N, I, S, E, K, L, R, or V. In some embodiments, X1is D or N. In some embodiments, X2is L or F. In some embodiments, X2is L. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y. In some embodiments, X3is S, E, R, T, D, H, Q, K, N, or C. In some embodiments, X4is G, E, Q, K, R, A, D, H, N, Y, S, I, or C. In some embodiments, X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably X1is D, N, I, S, E, K, L, R, or V, more preferably, X1is D or N; (b) X2is L or F, preferably X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably X4 is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D, N, I, S, E, K, L, R, or V; (b) X2is L or F; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments: (a) X1is D or N; (b) X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4is G, E, Q, K, R, A, D, H, N, or Y. In some embodiments, m is at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, or at least 100. In some embodiments, m is 100 or less, 95 or less, 90 or less, 85 or less, 80 or less, 75 or less, 70 or less, 65 or less, 60 or less, 55 or less, 50 or less, 45 or less, 40 or less, 35 or less, 30 or less, 29 or less, 28 or less, 27 or less, 26 or less, 25 or less, 24 or less, 23 or less, 22 or less, 21 or less, 20 or less, 19 or less, 18 or less, 17 or less, 16 or less, 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, or 8 or less. In some embodiments, m is from 2 to 100, from 2 to 95, from 2 to 90, from 2 to 85, from 2 to 80, from 2 to 75, from 2 to 70, from 2 to 65, from 2 to 60, from 2 to 55, from 2 to 50, from 2 to 45, from 2 to 40, from 2 to 35, from 2 to 30, from 2 to 29, from 2 to 28, from 2 to 27, from 2 to 26, from 2 to 25, from 2 to 24, from 2 to 23, from 2 to 22, from 2 to 21, from 2 to 20, from 2 to 19, from 2 to 18, from 2 to 17, from 2 to 16, from 2 to 15, from 2 to 14, from 2 to 13, from 2 to 12, from 2 to 11, from 2 to 10, from 2 to 9, from 2 to 8, from 3 to 8, or from 4 to 8. In some embodiments, n is at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, or at least 200. In some embodiments, n is less than 3000, less than 2000, less than 1000, less than 500, less than 400, less than 300, less than 200, less than 100, less than 90, less than 80, less than 70, less than 60, less than 50, less than 40, less than 30, less than 29, less than 28, less than 27, less than 26, less than 25, less than 24, less than 23, less than 22, less than 21, less than 20, less than 19, less than 18, less than 17, less than 16, less than 15, less than 14, less than 13, less than 12, less than 11, less than 10, less than 9, less than 8, less than 7, or less than 6. In some embodiments, n is from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30. In some embodiments, (i) (a) X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably X1is D, N, I, S, E, K, L, R, or V, more preferably, X1is D or N; (b) X2is L or F, preferably X2is L; (c) X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably X3is S, E, R, T, D, H, Q, K, N, or C; and (d) X4 is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably X4 is G, E, Q, K, R, A, D, H, N, or Y; (ii) m is from 2 to 100, from 2 to 95, from 2 to 90, from 2 to 85, from 2 to 80, from 2 to 75, from 2 to 70, from 2 to 65, from 2 to 60, from 2 to 55, from 2 to 50, from 2 to 45, from 2 to 40, from 2 to 35, from 2 to 30, from 2 to 29, from 2 to 28, from 2 to 27, from 2 to 26, from 2 to 25, from 2 to 24, from 2 to 23, from 2 to 22, from 2 to 21, from 2 to 20, from 2 to 19, from 2 to 18, from 2 to 17, from 2 to 16, from 2 to 15, from 2 to 14, from 2 to 13, from 2 to 12, from 2 to 11, from 2 to 10, from 2 to 9, from 2 to 8, from 3 to 8, or from 4 to 8; and (iii) n is from 4 to 3000, from 5 to 2800, from 6 to 2600, from 7 to 2400, from 8 to 2200, from 9 to 2000, from 10 to 1800, from 11 to 1600, from 12 to 1400, from 13 to 1200, from 14 to 1000, from 15 to 800, from 16 to 600, from 17 to 500, from 18 to 400, from 19 to 300, from 20 to 250, from 20 to 200, from 20 to 150, from 20 to 100, from 20 to 95, from 20 to 90, from 20 to 85, from 20 to 80, from 20 to 75, from 20 to 70, from 20 to 65, from 20 to 60, from 20 to 55, from 20 to 50, from 20 to 45, from 20 to 40, from 20 to 35, or from 20 to 30. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 241 to 244. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 241 to 244 In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence similarity to any of SEQ ID NOs: 241 to 244. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence identity to any of SEQ ID NOs: 241 to 244. In some embodiments, the polypeptide comprises or consists of the sequence of any of SEQ ID NOs: 241 to 244. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to SEQ ID NO: 241. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 241. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence similarity to SEQ ID NO: 241. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence identity to SEQ ID NO: 241. In some embodiments, the polypeptide comprises or consists of the sequence of SEQ ID NO: 241. Example polypeptide sequences are provided in SEQ ID NOs: 245 to 255 and 330 to 358. RMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGAD LSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQ EANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQA DLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYR RGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLE EANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGA NLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKM EEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLS RANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDA NLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARL DDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGKSDDG Example polypeptide (no linkers) sequence 1 (SEQ ID NO: 245) MGSSHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANL HHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQ ANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGAR TTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNF QHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEA ANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGAN LNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRR EYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRS ADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDAN LEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLR GATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTN ASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEAN LSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLT RANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGKSDDG Example polypeptide (no linkers) sequence 2 (SEQ ID NO: 246) RMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNAN LSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLA GADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPV LWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGAD LSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQ EANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQA DLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYR RGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLE EANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGA NLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKM EEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLS RANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDA NLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARL DDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQ EIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGA DLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANL SEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERAR GRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNA NLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADL AGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDP VLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGA DLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADL QEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQ ADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEY RRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANL EEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDG ANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAK MEEEQRREYERARGKSDDG Example polypeptide (no linkers) sequence 3 (SEQ ID NO: 247) MGSSHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANL HHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQ ANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGAR TTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNF QHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEA ANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGAN LNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRR EYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRS ADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDAN LEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLR GATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTN ASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEAN LSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLT RANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRD EILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHAN LSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQ GAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTA SLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYAN LHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLT QANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGA RTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRN FQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLE AANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGA NLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQR REYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLR SADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDA NLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADL RGATVDPVLWRTASLRGAKMEEEQRREYERARGKSDDG Example polypeptide (no linkers) sequence 4 (SEQ ID NO: 248) MGSSHHHHHHSSGLVPRGSSMQTEQILQEYNRGRTDFAKIDLENANLKNAELAGADLANANL HRANLENANLANAKLEEANLEEANLAGADLRNANLQRANLARADLAGADLTGANLAEADLRE ARLQKANLENADLTNADLTGADLEGARLHGANLEGANLTNANLRKANLENADLRNADLTGAN TKGANLDNADLRGATLDPVLWRTASLQGAKMTTRQAEEYDRARGSMQTEQILQEYNRGRTDF AKIDLENANLKNAELAGADLANANLHRANLENANLANAKLEEANLEEANLAGADLRNANLQR ANLARADLAGADLTGANLAEADLREARLQKANLENADLTNADLTGADLEGARLHGANLEGAN LTNANLRKANLENADLRNADLTGANTKGANLDNADLRGATLDPVLWRTASLQGAKMTTRQAE EYDRARGSMQTEQILQEYNRGRTDFAKIDLENANLKNAELAGADLANANLHRANLENANLAN AKLEEANLEEANLAGADLRNANLQRANLARADLAGADLTGANLAEADLREARLQKANLENAD LTNADLTGADLEGARLHGANLEGANLTNANLRKANLENADLRNADLTGANTKGANLDNADLR GATLDPVLWRTASLQGAKMTTRQAEEYDRARGSMQTEQILQEYNRGRTDFAKIDLENANLKN AELAGADLANANLHRANLENANLANAKLEEANLEEANLAGADLRNANLQRANLARADLAGAD LTGANLAEADLREARLQKANLENADLTNADLTGADLEGARLHGANLEGANLTNANLRKANLE NADLRNADLTGANTKGANLDNADLRGATLDPVLWRTASLQGAKMTTRQAEEYDRARGQEDKG Example polypeptide (no linkers) sequence 5 (SEQ ID NO: 249) MGSSHHHHHHSSGLVPRGSTMATDKILQQYKDGQHDFSGIDLANADLSKAELAGADLSGADL TRADLRDANLANADLQEANLAEAKLQGANLENANLARADLSRANLAGADLHGANLAEADLRN ADLRNANLQNADLRKARLQGADLEGANLEGANLHGADLENADLARADLQKADLRNANLTGAE TTGANLNNADLRGATLDPVLWNTASLEGAQMKKEQKKEYKRANGTMATDKILQQYKDGQHDF SGIDLANADLSKAELAGADLSGADLTRADLRDANLANADLQEANLAEAKLQGANLENANLAR ADLSRANLAGADLHGANLAEADLRNADLRNANLQNADLRKARLQGADLEGANLEGANLHGAD LENADLARADLQKADLRNANLTGAETTGANLNNADLRGATLDPVLWNTASLEGAQMKKEQKK EYKRANGTMATDKILQQYKDGQHDFSGIDLANADLSKAELAGADLSGADLTRADLRDANLAN ADLQEANLAEAKLQGANLENANLARADLSRANLAGADLHGANLAEADLRNADLRNANLQNAD LRKARLQGADLEGANLEGANLHGADLENADLARADLQKADLRNANLTGAETTGANLNNADLR GATLDPVLWNTASLEGAQMKKEQKKEYKRANGTMATDKILQQYKDGQHDFSGIDLANADLSK AELAGADLSGADLTRADLRDANLANADLQEANLAEAKLQGANLENANLARADLSRANLAGAD LHGANLAEADLRNADLRNANLQNADLRKARLQGADLEGANLEGANLHGADLENADLARADLQ KADLRNANLTGAETTGANLNNADLRGATLDPVLWNTASLEGAQMKKEQKKEYKRANGQSDDG Example polypeptide (no linkers) sequence 6 (SEQ ID NO: 250) MGSSHHHHHHSSGLVPRGSSMHEDEILDEYNNGRKNFSGIDLQGADLEDAELAGADLSDANL EQANLQNANLANANLENANLQDADLHGARLQNADLRGANLEDADLANARLEGANLAEADLRR ADLRGADLTNADLEDADLEGANLHGARLEGANLRGANLTDARLENADLSGADLRNANLEGAN TRGARLQDADLRGAKLRPVLWNTANLEGAQMQTNQKAEYQRANGSMHEDEILDEYNNGRKNF SGIDLQGADLEDAELAGADLSDANLEQANLQNANLANANLENANLQDADLHGARLQNADLRG ANLEDADLANARLEGANLAEADLRRADLRGADLTNADLEDADLEGANLHGARLEGANLRGAN LTDARLENADLSGADLRNANLEGANTRGARLQDADLRGAKLRPVLWNTANLEGAQMQTNQKA EYQRANGSMHEDEILDEYNNGRKNFSGIDLQGADLEDAELAGADLSDANLEQANLQNANLAN ANLENANLQDADLHGARLQNADLRGANLEDADLANARLEGANLAEADLRRADLRGADLTNAD LEDADLEGANLHGARLEGANLRGANLTDARLENADLSGADLRNANLEGANTRGARLQDADLR GAKLRPVLWNTANLEGAQMQTNQKAEYQRANGSMHEDEILDEYNNGRKNFSGIDLQGADLED AELAGADLSDANLEQANLQNANLANANLENANLQDADLHGARLQNADLRGANLEDADLANAR LEGANLAEADLRRADLRGADLTNADLEDADLEGANLHGARLEGANLRGANLTDARLENADLS GADLRNANLEGANTRGARLQDADLRGAKLRPVLWNTANLEGAQMQTNQKAEYQRANGQQTNG Example polypeptide (no linkers) sequence 7 (SEQ ID NO: 251) MGSSHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNAELAGADLANANL HRANLENANLANAKLEEANLEEANLAGADLRNANLQRANLARADLAGADLTGANLAEADLRE ARLQSANLENADLTNADLTGADLEGARLHGANLEGANLTNANLRKANLENADLRNADLTGAR TTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNF QHINLQEIELTNAELAGADLANANLHRANLENANLANAKLEEANLEEANLAGADLRNANLQR ANLARADLAGADLTGANLAEADLREARLQKANLENADLTNADLTGADLEGARLHGANLEGAN LTNANLRKANLENADLRNADLTGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRR EYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNAELAGADLANANLHRANLENANLAN AKLEEANLEEANLAGADLRNANLQRANLARADLAGADLTGANLAEADLREARLQKANLENAD LTNADLTGADLEGARLHGANLEGANLTNANLRKANLENADLRNADLTGARTTGARLDDADLR GATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTN AELAGADLANANLHRANLENANLANAKLEEANLEEANLAGADLRNANLQRANLARADLAGAD LTGANLAEADLREARLQKANLENADLTNADLTGADLEGARLHGANLEGANLTNANLRKANLE NADLRNADLTGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGQEDKG Example polypeptide (no linkers) sequence 8 (SEQ ID NO: 252) MGSSHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNAELAGADLSGADL TRADLRDANLANADLQEANLAEAKLQGANLENANLARADLSRANLAGADLHGANLAEADLRN ADLRNANLQNADLRKARLQGADLEGANLEGANLHGADLENADLARADLQKADLRNANLTGAR TTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNF QHINLQEIELTNAELAGADLSGADLTRADLRDANLANADLQEANLAEAKLQGANLENANLAR ADLSRANLAGADLHGANLAEADLRNADLRNANLQNADLRKARLQGADLEGANLEGANLHGAD LENADLARADLQKADLRNANLTGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRR EYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNAELAGADLSGADLTRADLRDANLAN ADLQEANLAEAKLQGANLENANLARADLSRANLAGADLHGANLAEADLRNADLRNANLQNAD LRKARLQGADLEGANLEGANLHGADLENADLARADLQKADLRNANLTGARTTGARLDDADLR GATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTN AELAGADLSGADLTRADLRDANLANADLQEANLAEAKLQGANLENANLARADLSRANLAGAD LHGANLAEADLRNADLRNANLQNADLRKARLQGADLEGANLEGANLHGADLENADLARADLQ KADLRNANLTGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGQSDDG Example polypeptide (no linkers) sequence 9 (SEQ ID NO: 253) MGSSHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANL HHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQ ANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGAR TTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNF QHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEA ANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGAN LNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRR EYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRS ADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDAN LEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLR GATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTN ASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEAN LSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLT RANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRD EILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHAN LSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQ GAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTA SLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYAN LHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLT QANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGA RTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGKSDDG Example polypeptide (no linkers) sequence 10 (SEQ ID NO: 254) MGSSHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANL HHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQ ANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGAR TTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNF QHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEA ANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGAN LNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRR EYERARGKSDDG Example polypeptide (no linkers) sequence 11 (SEQ ID NO: 255) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNADLEAANLK YANLHEADLSRANLTGANLTNANLHQANLTGANLSHANLSHAVLTNANLSGADLSEANLEGA NLAGADLRGANLQDANLQEANLDQASLRGANLRQANLHSAMLSEADLNRADLEGADLSDANL SGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNADLEAANLKYANLHEADLSRANLTGANLTNANLHQANLTGANLSHA NLSHAVLTNANLSGADLSEANLEGANLAGADLRGANLQDANLQEANLDQASLRGANLRQANL HSAMLSEADLNRADLEGADLSDANLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNADLEAANLKYANLHEADLSRA NLTGANLTNANLHQANLTGANLSHANLSHAVLTNANLSGADLSEANLEGANLAGADLRGANL QDANLQEANLDQASLRGANLRQANLHSAMLSEADLNRADLEGADLSDANLSGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNADLEAANLKYANLHEADLSRANLTGANLTNANLHQANLTGANLSHANLSHAVLTNANL SGADLSEANLEGANLAGADLRGANLQDANLQEANLDQASLRGANLRQANLHSAMLSEADLNR ADLEGADLSDANLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 12 (SEQ ID NO: 330) MGSSHHHHHHHHHHSSGLVPRGSSLTAAEVLALKAAGERDFSGADLSGIDLSGADLSHADLS RADLKGANLSGADLDHAVLREANLAQANLSGANLESANLHEADLNQAMLSGANLTGASLRRA DLSEANLQGANLRGANLEAANLSNANLQNADLSYANLEEANLTDANLEDANLHQANLHGANL TGAKTTGADLSGANLEGATVDLSFYTEAKLTGATFSADQKKALARAKGSLTAAEVLALKAAG ERDFSGADLSGIDLSGADLSHADLSRADLKGANLSGADLDHAVLREANLAQANLSGANLESA NLHEADLNQAMLSGANLTGASLRRADLSEANLQGANLRGANLEAANLSNANLQNADLSYANL EEANLTDANLEDANLHQANLHGANLTGAKTTGADLSGANLEGATVDLSFYTEAKLTGATFSA DQKKALARAKGSLTAAEVLALKAAGERDFSGADLSGIDLSGADLSHADLSRADLKGANLSGA DLDHAVLREANLAQANLSGANLESANLHEADLNQAMLSGANLTGASLRRADLSEANLQGANL RGANLEAANLSNANLQNADLSYANLEEANLTDANLEDANLHQANLHGANLTGAKTTGADLSG ANLEGATVDLSFYTEAKLTGATFSADQKKALARAKGSLTAAEVLALKAAGERDFSGADLSGI DLSGADLSHADLSRADLKGANLSGADLDHAVLREANLAQANLSGANLESANLHEADLNQAML SGANLTGASLRRADLSEANLQGANLRGANLEAANLSNANLQNADLSYANLEEANLTDANLED ANLHQANLHGANLTGAKTTGADLSGANLEGATVDLSFYTEAKLTGATFSADQKKALARAKGK SDDG Example polypeptide (no linkers) sequence 13 (SEQ ID NO: 331) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLTQANLR SANLSGANLTRANLHNADLEGANLQGANLEDADLSHANLTDADLKNANLEGAVLSGANLEEA NLSQANLQYADLSHANLSRAMLHQASLAGANLSGADLHEANLREADLNAANLEEANLSGADL DGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLTQANLRSANLSGANLTRANLHNADLEGANLQGANLEDADLSHA NLTDADLKNANLEGAVLSGANLEEANLSQANLQYADLSHANLSRAMLHQASLAGANLSGADL HEANLREADLNAANLEEANLSGADLDGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLTQANLRSANLSGANLTRA NLHNADLEGANLQGANLEDADLSHANLTDADLKNANLEGAVLSGANLEEANLSQANLQYADL SHANLSRAMLHQASLAGANLSGADLHEANLREADLNAANLEEANLSGADLDGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLTQANLRSANLSGANLTRANLHNADLEGANLQGANLEDADLSHANLTDADLKNANL EGAVLSGANLEEANLSQANLQYADLSHANLSRAMLHQASLAGANLSGADLHEANLREADLNA ANLEEANLSGADLDGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 14 (SEQ ID NO: 332) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNADLSQANLT QADLSGANLQYAVLRRADLTNADLENANLEDANLHGADLSSANLDHAMLSGASLNDANLRQA NLSEANLSGANLKGANLSGADLHGANLEHANLQRANLEAADLSEANLTGANLHEANLAHANL RGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNADLSQANLTQADLSGANLQYAVLRRADLTNADLENANLEDANLHGA DLSSANLDHAMLSGASLNDANLRQANLSEANLSGANLKGANLSGADLHGANLEHANLQRANL EAADLSEANLTGANLHEANLAHANLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNADLSQANLTQADLSGANLQYA VLRRADLTNADLENANLEDANLHGADLSSANLDHAMLSGASLNDANLRQANLSEANLSGANL KGANLSGADLHGANLEHANLQRANLEAADLSEANLTGANLHEANLAHANLRGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNADLSQANLTQADLSGANLQYAVLRRADLTNADLENANLEDANLHGADLSSANLDHAML SGASLNDANLRQANLSEANLSGANLKGANLSGADLHGANLEHANLQRANLEAADLSEANLTG ANLHEANLAHANLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 15 (SEQ ID NO: 333) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNAVLQSANLE QANLSGANLSGANLRQANLSGANLTGASLHEANLEGADLSNADLTAANLKNADLSRANLSYA NLNDADLSEADLSGANLRGANLRDANLDGADLHGANLARAMLEHADLTQANLHHANLQEANL SEARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNAVLQSANLEQANLSGANLSGANLRQANLSGANLTGASLHEANLEGA DLSNADLTAANLKNADLSRANLSYANLNDADLSEADLSGANLRGANLRDANLDGADLHGANL ARAMLEHADLTQANLHHANLQEANLSEARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNAVLQSANLEQANLSGANLSGA NLRQANLSGANLTGASLHEANLEGADLSNADLTAANLKNADLSRANLSYANLNDADLSEADL SGANLRGANLRDANLDGADLHGANLARAMLEHADLTQANLHHANLQEANLSEARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNAVLQSANLEQANLSGANLSGANLRQANLSGANLTGASLHEANLEGADLSNADLTAANL KNADLSRANLSYANLNDADLSEADLSGANLRGANLRDANLDGADLHGANLARAMLEHADLTQ ANLHHANLQEANLSEARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 16 (SEQ ID NO: 334) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLQNANLE EANLSGADLSYANLKEADLSSANLRQASLHGANLHGANLAEANLRRADLRQANLSHANLEGA DLSEAVLEGANLNNANLSDANLEGANLSQADLTGADLQGANLHRANLTDANLSGADLSHAML DAARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLQNANLEEANLSGADLSYANLKEADLSSANLRQASLHGANLHGA NLAEANLRRADLRQANLSHANLEGADLSEAVLEGANLNNANLSDANLEGANLSQADLTGADL QGANLHRANLTDANLSGADLSHAMLDAARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLQNANLEEANLSGADLSYA NLKEADLSSANLRQASLHGANLHGANLAEANLRRADLRQANLSHANLEGADLSEAVLEGANL NNANLSDANLEGANLSQADLTGADLQGANLHRANLTDANLSGADLSHAMLDAARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLQNANLEEANLSGADLSYANLKEADLSSANLRQASLHGANLHGANLAEANLRRADL RQANLSHANLEGADLSEAVLEGANLNNANLSDANLEGANLSQADLTGADLQGANLHRANLTD ANLSGADLSHAMLDAARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 17 (SEQ ID NO: 335) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLQDANLS EANLKGADLSGANLHRANLSHAVLTQANLEGANLHGANLRHADLHDADLAGADLRRANLQEA NLSQANLEYAMLSQANLEEANLSGANLENADLSEADLDAANLESASLTGANLRGADLNGANL SNARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLQDANLSEANLKGADLSGANLHRANLSHAVLTQANLEGANLHGA NLRHADLHDADLAGADLRRANLQEANLSQANLEYAMLSQANLEEANLSGANLENADLSEADL DAANLESASLTGANLRGADLNGANLSNARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLQDANLSEANLKGADLSGA NLHRANLSHAVLTQANLEGANLHGANLRHADLHDADLAGADLRRANLQEANLSQANLEYAML SQANLEEANLSGANLENADLSEADLDAANLESASLTGANLRGADLNGANLSNARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLQDANLSEANLKGADLSGANLHRANLSHAVLTQANLEGANLHGANLRHADLHDADL AGADLRRANLQEANLSQANLEYAMLSQANLEEANLSGANLENADLSEADLDAANLESASLTG ANLRGADLNGANLSNARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 18 (SEQ ID NO: 336) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNADLENANLT EANLRDANLEGAVLSHANLSGANLSRANLTGANLKSANLQEANLTDADLRGANLHYADLSGA DLNQANLQNADLEGANLRQANLSGANLSEANLHGADLAQASLDRANLEGADLSAANLTEAML SHARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNADLENANLTEANLRDANLEGAVLSHANLSGANLSRANLTGANLKSA NLQEANLTDADLRGANLHYADLSGADLNQANLQNADLEGANLRQANLSGANLSEANLHGADL AQASLDRANLEGADLSAANLTEAMLSHARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNADLENANLTEANLRDANLEGA VLSHANLSGANLSRANLTGANLKSANLQEANLTDADLRGANLHYADLSGADLNQANLQNADL EGANLRQANLSGANLSEANLHGADLAQASLDRANLEGADLSAANLTEAMLSHARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNADLENANLTEANLRDANLEGAVLSHANLSGANLSRANLTGANLKSANLQEANLTDADL RGANLHYADLSGADLNQANLQNADLEGANLRQANLSGANLSEANLHGADLAQASLDRANLEG ADLSAANLTEAMLSHARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 19 (SEQ ID NO: 337) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLS YANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEA NLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADL SHANVQGANLSEANLEGAKVDLSFFTQAALEGAKFSEEQKKLLERAKGRMRRDEILEEYRRG RRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEA NLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANL HGANLNNANLSEAMLTRANLEQADLSHANVQGANLSEANLEGAKVDLSFFTQAALEGAKFSE EQKKLLERAKGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRA NLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANL SDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSHANVQGANLSE ANLEGAKVDLSFFTQAALEGAKFSEEQKKLLERAKGRMRRDEILEEYRRGRRNFQHINLQEI ELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADL HEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSE AMLTRANLEQADLSHANVQGANLSEANLEGAKVDLSFFTQAALEGAKFSEEQKKLLERAKGK SDDG Example polypeptide (no linkers) sequence 20 (SEQ ID NO: 338) MGSSHHHHHHHHHHSSGLVPRGSSLTAEEILARKAAGEKDFSGADLSHVNLSNASLTGADLS YANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEA NLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADL SGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGSLTAEEILARKAAG EKDFSGADLSHVNLSNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEA NLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANL HGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGSLTAEEILARKAAGEKDFSGADLSHVNLSNASLTGADLSYANLHHANLSRA NLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANL SDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGSLTAEEILARKAAGEKDFSGADLSHV NLSNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADL HEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSE AMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 21 (SEQ ID NO: 339) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLS YANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEA NLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADL SGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEA NLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANL HGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRA NLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANL SDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADL HEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSE AMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGQ SDDG Example polypeptide (no linkers) sequence 22 (SEQ ID NO: 340) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLAQANLH EANLSSANLRGANLSEANLRGADLSHADLSGADLRQANLTAANLHGAMLHGAVLTGADLNYA NLQRANLTGANLEDADLSQANLSEANLHNANLQDADLSGASLSHANLDEANLERADLKGANL ENARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLAQANLHEANLSSANLRGANLSEANLRGADLSHADLSGADLRQA NLTAANLHGAMLHGAVLTGADLNYANLQRANLTGANLEDADLSQANLSEANLHNANLQDADL SGASLSHANLDEANLERADLKGANLENARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLAQANLHEANLSSANLRGA NLSEANLRGADLSHADLSGADLRQANLTAANLHGAMLHGAVLTGADLNYANLQRANLTGANL EDADLSQANLSEANLHNANLQDADLSGASLSHANLDEANLERADLKGANLENARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLAQANLHEANLSSANLRGANLSEANLRGADLSHADLSGADLRQANLTAANLHGAML HGAVLTGADLNYANLQRANLTGANLEDADLSQANLSEANLHNANLQDADLSGASLSHANLDE ANLERADLKGANLENARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 23 (SEQ ID NO: 341) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLSEANLR GANLEDADLEGAVLQQANLHGANLRGADLRYANLHRANLSEADLRHANLSGADLEQADLSSA DLTEANLSNANLSRADLHGANLKGANLTEAMLSDASLDAANLTHANLSGANLQNANLNGANL AQARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLSEANLRGANLEDADLEGAVLQQANLHGANLRGADLRYANLHRA NLSEADLRHANLSGADLEQADLSSADLTEANLSNANLSRADLHGANLKGANLTEAMLSDASL DAANLTHANLSGANLQNANLNGANLAQARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLSEANLRGANLEDADLEGA VLQQANLHGANLRGADLRYANLHRANLSEADLRHANLSGADLEQADLSSADLTEANLSNANL SRADLHGANLKGANLTEAMLSDASLDAANLTHANLSGANLQNANLNGANLAQARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLSEANLRGANLEDADLEGAVLQQANLHGANLRGADLRYANLHRANLSEADLRHANL SGADLEQADLSSADLTEANLSNANLSRADLHGANLKGANLTEAMLSDASLDAANLTHANLSG ANLQNANLNGANLAQARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 24 (SEQ ID NO: 342) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTRANLQEAVLE YANLHNANLAQADAHHANLSQANLEGANLHGAMLSGANLESANLKDADASGANLSEANLDEA DASNANLRGADLTRANLSQANLNGADLQGADASDANLRAANLEHADLTRANLSGANLTEASL RGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTRANLQEAVLEYANLHNANLAQADAHHANLSQANLEGANLHGAMLSGA NLESANLKDADASGANLSEANLDEADASNANLRGADLTRANLSQANLNGADLQGADASDANL RAANLEHADLTRANLSGANLTEASLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTRANLQEAVLEYANLHNANLAQA DAHHANLSQANLEGANLHGAMLSGANLESANLKDADASGANLSEANLDEADASNANLRGADL TRANLSQANLNGADLQGADASDANLRAANLEHADLTRANLSGANLTEASLRGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTRANLQEAVLEYANLHNANLAQADAHHANLSQANLEGANLHGAMLSGANLESANLKDADA SGANLSEANLDEADASNANLRGADLTRANLSQANLNGADLQGADASDANLRAANLEHADLTR ANLSGANLTEASLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 25 (SEQ ID NO: 343) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTRANLSGADLK QANLSRANLSGANLANAVLQQANLSSANLDYANLTGANFQEANLHEANLNGADLTGANLRQA NLSRADLTGANLHDANLHEANLSEADLEGADLSGANLRAADFEDANLENADLSHAMLRHASL EGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTRANLSGADLKQANLSRANLSGANLANAVLQQANLSSANLDYANLTGA NFQEANLHEANLNGADLTGANLRQANLSRADLTGANLHDANLHEANLSEADLEGADLSGANL RAADFEDANLENADLSHAMLRHASLEGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTRANLSGADLKQANLSRANLSGA NLANAVLQQANLSSANLDYANLTGANFQEANLHEANLNGADLTGANLRQANLSRADLTGANL HDANLHEANLSEADLEGADLSGANLRAADFEDANLENADLSHAMLRHASLEGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTRANLSGADLKQANLSRANLSGANLANAVLQQANLSSANLDYANLTGANFQEANLHEANL NGADLTGANLRQANLSRADLTGANLHDANLHEANLSEADLEGADLSGANLRAADFEDANLEN ADLSHAMLRHASLEGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 26 (SEQ ID NO: 344) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNADLRHANLR GANLSDADLSQANLTGANLEAANLSGASLEGANLQNANLEQANLDDAMLSGANLHRANLHHA DLSNANLKGANLAGANLTRADLTSAVLHEANLQEANLNGADLSGADLSEANLRYANLSQADL EGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNADLRHANLRGANLSDADLSQANLTGANLEAANLSGASLEGANLQNA NLEQANLDDAMLSGANLHRANLHHADLSNANLKGANLAGANLTRADLTSAVLHEANLQEANL NGADLSGADLSEANLRYANLSQADLEGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNADLRHANLRGANLSDADLSQA NLTGANLEAANLSGASLEGANLQNANLEQANLDDAMLSGANLHRANLHHADLSNANLKGANL AGANLTRADLTSAVLHEANLQEANLNGADLSGADLSEANLRYANLSQADLEGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNADLRHANLRGANLSDADLSQANLTGANLEAANLSGASLEGANLQNANLEQANLDDAML SGANLHRANLHHADLSNANLKGANLAGANLTRADLTSAVLHEANLQEANLNGADLSGADLSE ANLRYANLSQADLEGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 27 (SEQ ID NO: 345) MGSSHHHHHHHHHHSSGLVPRGSSLSAEEILQLKAAGETDFSGADLSNVDLSNASLTGADLS YANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEA NLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADL SGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGSLSAEEILQLKAAG ETDFSGADLSNVDLSNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEA NLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANL HGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGSLSAEEILQLKAAGETDFSGADLSNVDLSNASLTGADLSYANLHHANLSRA NLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANL SDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGSLSAEEILQLKAAGETDFSGADLSNV DLSNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADL HEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSE AMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 28 (SEQ ID NO: 346) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLSRAVLR GADLSQANLDQADLKNANLSGANLRGANLHEANLRNADLQRANLNQANLRGADLTGANLESA DLHAANLSDAMLSEANLEGADLAGANLTEANLEHANLSGANLEHANLTYASLSEADLQGANL SDARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLSRAVLRGADLSQANLDQADLKNANLSGANLRGANLHEANLRNA DLQRANLNQANLRGADLTGANLESADLHAANLSDAMLSEANLEGADLAGANLTEANLEHANL SGANLEHANLTYASLSEADLQGANLSDARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLSRAVLRGADLSQANLDQA DLKNANLSGANLRGANLHEANLRNADLQRANLNQANLRGADLTGANLESADLHAANLSDAML SEANLEGADLAGANLTEANLEHANLSGANLEHANLTYASLSEADLQGANLSDARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLSRAVLRGADLSQANLDQADLKNANLSGANLRGANLHEANLRNADLQRANLNQANL RGADLTGANLESADLHAANLSDAMLSEANLEGADLAGANLTEANLEHANLSGANLEHANLTY ASLSEADLQGANLSDARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 29 (SEQ ID NO: 347) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLTGANLS GADLTQANLSNASLERANLSNANLHEADLEYADLEQANLSAANLEGANLTEANLNHANLREA DLDGADLQRANLSGADLTQAMLSGAVLRGANLHSANLKDANLAGANLQHADLHDANLTEANL RGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLTGANLSGADLTQANLSNASLERANLSNANLHEADLEYADLEQA NLSAANLEGANLTEANLNHANLREADLDGADLQRANLSGADLTQAMLSGAVLRGANLHSANL KDANLAGANLQHADLHDANLTEANLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLTGANLSGADLTQANLSNA SLERANLSNANLHEADLEYADLEQANLSAANLEGANLTEANLNHANLREADLDGADLQRANL SGADLTQAMLSGAVLRGANLHSANLKDANLAGANLQHADLHDANLTEANLRGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLTGANLSGADLTQANLSNASLERANLSNANLHEADLEYADLEQANLSAANLEGANL TEANLNHANLREADLDGADLQRANLSGADLTQAMLSGAVLRGANLHSANLKDANLAGANLQH ADLHDANLTEANLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 30 (SEQ ID NO: 348) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLS YANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEA NLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADL SQANVEGANLSEANLEGAKFDLSLYRQANLEGAKLTPEQLELKLRALGRMRRDEILEEYRRG RRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEA NLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANL HGANLNNANLSEAMLTRANLEQADLSQANVEGANLSEANLEGAKFDLSLYRQANLEGAKLTP EQLELKLRALGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRA NLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANL SDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSQANVEGANLSE ANLEGAKFDLSLYRQANLEGAKLTPEQLELKLRALGRMRRDEILEEYRRGRRNFQHINLQEI ELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADL HEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSE AMLTRANLEQADLSQANVEGANLSEANLEGAKFDLSLYRQANLEGAKLTPEQLELKLRALGK SDDG Example polypeptide (no linkers) sequence 31 (SEQ ID NO: 349) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTSANLS AADLRGANLQHANLSDADLSEANLSGAVLHHANLSEANLANADLTQANLKQADLERADLHGA NLTEAMLDEADLNNANLEGANLQQANLSGADLSEANLSGANLHGANLRDANLERANLEEANL RYARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNASLTSANLSAADLRGANLQHANLSDADLSEANLSGAVLHHANLSEA NLANADLTQANLKQADLERADLHGANLTEAMLDEADLNNANLEGANLQQANLSGADLSEANL SGANLHGANLRDANLERANLEEANLRYARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTSANLSAADLRGANLQHA NLSDADLSEANLSGAVLHHANLSEANLANADLTQANLKQADLERADLHGANLTEAMLDEADL NNANLEGANLQQANLSGADLSEANLSGANLHGANLRDANLERANLEEANLRYARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNASLTSANLSAADLRGANLQHANLSDADLSEANLSGAVLHHANLSEANLANADLTQANL KQADLERADLHGANLTEAMLDEADLNNANLEGANLQQANLSGADLSEANLSGANLHGANLRD ANLERANLEEANLRYARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 32 (SEQ ID NO: 350) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTHANLEGAMLQ HADLHEANLSDASLHQANLTEANLQEANLSGANLTGANLNNADATRANLADANLSQADADRA NLEEADLSGANLSYANLEAADLHGANLSGANLSGAVLRSANLKNADLSGANLRQANLEHADL RGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTHANLEGAMLQHADLHEANLSDASLHQANLTEANLQEANLSGANLTGA NLNNADATRANLADANLSQADADRANLEEADLSGANLSYANLEAADLHGANLSGANLSGAVL RSANLKNADLSGANLRQANLEHADLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTHANLEGAMLQHADLHEANLSDA SLHQANLTEANLQEANLSGANLTGANLNNADATRANLADANLSQADADRANLEEADLSGANL SYANLEAADLHGANLSGANLSGAVLRSANLKNADLSGANLRQANLEHADLRGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTHANLEGAMLQHADLHEANLSDASLHQANLTEANLQEANLSGANLTGANLNNADATRANL ADANLSQADADRANLEEADLSGANLSYANLEAADLHGANLSGANLSGAVLRSANLKNADLSG ANLRQANLEHADLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 33 (SEQ ID NO: 351) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTHADLEGASLH HANFSEANLENANLSGANLSEANLQAADLAGANLDGANLHDANLSEANLSQANFKQANLSRA NLQGADLHGADLTDANLNEAVAENAMLRYANLTGANLTRANLEHADASGADLSSANLRQADL RGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTHADLEGASLHHANFSEANLENANLSGANLSEANLQAADLAGANLDGA NLHDANLSEANLSQANFKQANLSRANLQGADLHGADLTDANLNEAVAENAMLRYANLTGANL TRANLEHADASGADLSSANLRQADLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTHADLEGASLHHANFSEANLENA NLSGANLSEANLQAADLAGANLDGANLHDANLSEANLSQANFKQANLSRANLQGADLHGADL TDANLNEAVAENAMLRYANLTGANLTRANLEHADASGADLSSANLRQADLRGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTHADLEGASLHHANFSEANLENANLSGANLSEANLQAADLAGANLDGANLHDANLSEANL SQANFKQANLSRANLQGADLHGADLTDANLNEAVAENAMLRYANLTGANLTRANLEHADASG ADLSSANLRQADLRGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 34 (SEQ ID NO: 352) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLHYADLR GADLSQANLKEANLSQANLSSANLNGADLTAANLEEANLTRANLSGANLEEANLHGANLTGA DLRGANLHGANLEDANLERASLDNANLSGADLQDANLHHAMLREADLAQAVLQHADLHNANL SGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLHYADLRGADLSQANLKEANLSQANLSSANLNGADLTAANLEEA NLTRANLSGANLEEANLHGANLTGADLRGANLHGANLEDANLERASLDNANLSGADLQDANL HHAMLREADLAQAVLQHADLHNANLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLHYADLRGADLSQANLKEA NLSQANLSSANLNGADLTAANLEEANLTRANLSGANLEEANLHGANLTGADLRGANLHGANL EDANLERASLDNANLSGADLQDANLHHAMLREADLAQAVLQHADLHNANLSGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLHYADLRGADLSQANLKEANLSQANLSSANLNGADLTAANLEEANLTRANLSGANL EEANLHGANLTGADLRGANLHGANLEDANLERASLDNANLSGADLQDANLHHAMLREADLAQ AVLQHADLHNANLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 35 (SEQ ID NO: 353) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLS YANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEA NLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADL SHANVQGANLSGANLEGAKVDLSFFTQANLEGAKFSEEQLRLLERAKGRMRRDEILEEYRRG RRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEA NLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANL HGANLNNANLSEAMLTRANLEQADLSHANVQGANLSGANLEGAKVDLSFFTQANLEGAKFSE EQLRLLERAKGRMRRDEILEEYRRGRRNFQHINLQEIELTNASLTGADLSYANLHHANLSRA NLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANL SDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSHANVQGANLSG ANLEGAKVDLSFFTQANLEGAKFSEEQLRLLERAKGRMRRDEILEEYRRGRRNFQHINLQEI ELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADL HEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSE AMLTRANLEQADLSHANVQGANLSGANLEGAKVDLSFFTQANLEGAKFSEEQLRLLERAKGK SDDG Example polypeptide (no linkers) sequence 36 (SEQ ID NO: 354) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNADLSEANLR DANLANAMLQGANLSEANLTHADLRDANLEAADLSRANLQGADLENADLEEANLRYASLHGA NLSQANLKQANLSGANLHGANLHGANLNDAVLSGADLTRANLTQADLEEANLSSANLDGANL SGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNADLSEANLRDANLANAMLQGANLSEANLTHADLRDANLEAADLSRA NLQGADLENADLEEANLRYASLHGANLSQANLKQANLSGANLHGANLHGANLNDAVLSGADL TRANLTQADLEEANLSSANLDGANLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNADLSEANLRDANLANAMLQGA NLSEANLTHADLRDANLEAADLSRANLQGADLENADLEEANLRYASLHGANLSQANLKQANL SGANLHGANLHGANLNDAVLSGADLTRANLTQADLEEANLSSANLDGANLSGARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNADLSEANLRDANLANAMLQGANLSEANLTHADLRDANLEAADLSRANLQGADLENADL EEANLRYASLHGANLSQANLKQANLSGANLHGANLHGANLNDAVLSGADLTRANLTQADLEE ANLSSANLDGANLSGARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 37 (SEQ ID NO: 355) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLEGANLE GANLSQANLKNANLSEADLAHANLRHANLEGADLTEAVLSAANLSGADLSGADLEQANLTEA NLHDANLNYADLRRANLSGANLTRADLHNANLQEASLSGANLHSADLSQANLDGAMLTGANL QDARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLEGANLEGANLSQANLKNANLSEADLAHANLRHANLEGADLTEA VLSAANLSGADLSGADLEQANLTEANLHDANLNYADLRRANLSGANLTRADLHNANLQEASL SGANLHSADLSQANLDGAMLTGANLQDARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLEGANLEGANLSQANLKNA NLSEADLAHANLRHANLEGADLTEAVLSAANLSGADLSGADLEQANLTEANLHDANLNYADL RRANLSGANLTRADLHNANLQEASLSGANLHSADLSQANLDGAMLTGANLQDARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLEGANLEGANLSQANLKNANLSEADLAHANLRHANLEGADLTEAVLSAANLSGADL SGADLEQANLTEANLHDANLNYADLRRANLSGANLTRADLHNANLQEASLSGANLHSADLSQ ANLDGAMLTGANLQDARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 38 (SEQ ID NO: 356) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLHEANLE QADLSHASLADANLQGANLNQANLEGANLRGADLSSADLENANLTRANLHRANLTGADLRQA NLSGANLSGAVLSYANLEAANLRQADLHNANLQEAMLSEANLSGANLSHANLKGADLTGADL DEARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLHEANLEQADLSHASLADANLQGANLNQANLEGANLRGADLSSA DLENANLTRANLHRANLTGADLRQANLSGANLSGAVLSYANLEAANLRQADLHNANLQEAML SEANLSGANLSHANLKGADLTGADLDEARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLHEANLEQADLSHASLADA NLQGANLNQANLEGANLRGADLSSADLENANLTRANLHRANLTGADLRQANLSGANLSGAVL SYANLEAANLRQADLHNANLQEAMLSEANLSGANLSHANLKGADLTGADLDEARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLHEANLEQADLSHASLADANLQGANLNQANLEGANLRGADLSSADLENANLTRANL HRANLTGADLRQANLSGANLSGAVLSYANLEAANLRQADLHNANLQEAMLSEANLSGANLSH ANLKGADLTGADLDEARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 39 (SEQ ID NO: 357) MGSSHHHHHHHHHHSSGLVPRGSRMRRDEILEEYRRGRRNFQHINLQEIELTNANLSHANLS EADLERANLSNANLTQADLERADLEQADLSGANLRGANLAGANLQEAMLSGASLQNANLTYA NLNDANLSSADLREANLHDANLDHANLEDANLRGAVLTGANLSQADLHGADLHDANLKAANL SEARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRG RRNFQHINLQEIELTNANLSHANLSEADLERANLSNANLTQADLERADLEQADLSGANLRGA NLAGANLQEAMLSGASLQNANLTYANLNDANLSSADLREANLHDANLDHANLEDANLRGAVL TGANLSQADLHGADLHDANLKAANLSEARTTGARLDDADLRGATVDPVLWRTASLRGAKMEE EQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEIELTNANLSHANLSEADLERANLSNA NLTQADLERADLEQADLSGANLRGANLAGANLQEAMLSGASLQNANLTYANLNDANLSSADL REANLHDANLDHANLEDANLRGAVLTGANLSQADLHGADLHDANLKAANLSEARTTGARLDD ADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGRMRRDEILEEYRRGRRNFQHINLQEI ELTNANLSHANLSEADLERANLSNANLTQADLERADLEQADLSGANLRGANLAGANLQEAML SGASLQNANLTYANLNDANLSSADLREANLHDANLDHANLEDANLRGAVLTGANLSQADLHG ADLHDANLKAANLSEARTTGARLDDADLRGATVDPVLWRTASLRGAKMEEEQRREYERARGK SDDG Example polypeptide (no linkers) sequence 40 (SEQ ID NO: 358) In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 245 to 255. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 330 to 358. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 245 to 255. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 330 to 358. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence similarity to any of SEQ ID NOs: 245 to 255. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence similarity to any of SEQ ID NOs: 330 to 358. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence identity to any of SEQ ID NOs: 245 to 255. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence identity to any of SEQ ID NOs: 330 to 358. In some embodiments, the polypeptide comprises or consists of the sequence of any of SEQ ID NOs: 245 to 255. In some embodiments, the polypeptide comprises or consists of the sequence of any of SEQ ID NOs: 330 to 358. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence similarity to any of SEQ ID NOs: 245 to 248. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 245 to 248. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, at least 99.9%, or 100.0% sequence similarity to any of SEQ ID NOs: 245 to 248. In some embodiments, the polypeptide comprises or consists of an amino acid sequence having at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99...

Claims

CLAIMS 1. A polypeptide comprising from N-terminus to C-terminus: an N-terminal capping sequence; at least two beta solenoid domains, wherein the at least two beta solenoid domains are linked by a sequence having a minimum predicted local distance difference test (pLDDT) score of 50% or more, wherein the sequence linking the at least two beta solenoid domains is not a beta solenoid domain; and a C-terminal capping sequence.

2. The polypeptide according to claim 1, wherein the sequence linking the at least two beta solenoid domains comprises or consists of at least one C-terminal capping sequence and / or at least one N-terminal capping sequence.

3. The polypeptide according to claim 1 or 2, wherein the sequence linking the at least two beta solenoid domains comprises or consists of from N-terminus to C-terminus: a C-terminal capping sequence and an N-terminal capping sequence.

4. The polypeptide according to any preceding claim, wherein the sequence linking the at least two beta solenoid domains comprises or consists of a linker sequence, preferably wherein the sequence linking the at least two beta solenoid domains comprises or consists of a rigid linker sequence.

5. The polypeptide according to any preceding claim, wherein each of the at least two beta solenoid domains are rod-shaped.

6. The polypeptide according to any preceding claim, wherein each of the at least beta solenoid domains have a ratio of longitudinal length to transverse length of at least 2:

1.

7. The polypeptide according to any preceding claim, wherein each of the at least two beta solenoid domains have a cross-section selected from the group consisting of: a tesselatable cross-section, optionally a square, a rectangle, a parallelogram, a hexagon, or a triangle cross-section; a circle cross-section; or an oval cross-section.

8. The polypeptide according to any preceding claim, wherein each of the at least two beta solenoid domains have a cross-section selected from the group consisting of a square, a parallelogram, a hexagon, a circle, or an oval cross-section, optionally wherein each of the at least two beta solenoid domains have a square cross-section.

9. The polypeptide according to any preceding claim, wherein each of the at least two beta solenoid domains comprise an amino acid sequence that comprises at least 10 units, at least 15 units, or at least 20 units of a beta solenoid consensus motif.

10. The polypeptide according to any preceding claim, wherein the beta solenoid consensus motif is AX1X2X3X4, wherein X1is any amino acid, wherein X2is L or F, wherein X3is any amino acid, and wherein X4is any amino acid.

11. The polypeptide according to claim 10, wherein X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably wherein X1is D, N, I, S, E, K, L, R, or V, more preferably wherein X1is D or N.

12. The polypeptide according to claim 10 or 11, wherein X2is L.

13. The polypeptide according to any of claims 10 to 12, wherein X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably wherein X3is S, E, R, T, D, H, Q, K, N, or C.

14. The polypeptide according to any of claims 10 to 13, wherein X4is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably wherein X4is G, E, Q, K, R, A, D, H, N, or Y.

15. The polypeptide according to any preceding claim, wherein the at least two beta solenoid domains comprise at least three beta solenoid domains, or wherein the at least two beta solenoid domains comprise at least four beta solenoid domains.

16. The polypeptide according to any preceding claim, wherein a capping sequence prevents the beta solenoid domain from aggregating end-to-end with other beta solenoid domains.

17. The polypeptide according to any preceding claim, wherein a capping sequence comprises or consists of one or more alpha helix sequence.

18. The polypeptide according to any preceding claim, wherein an N-terminal capping sequence comprises or consists of the amino acid sequence of SEQ ID NO: 50 and / or wherein a C-terminal capping sequence comprises or consists of the amino acid sequence of SEQ ID NO:

51.

19. The polypeptide according to any preceding claim, wherein the polypeptide comprises at least one copy, at least two copies, or at least three copies of the amino acid sequence of SEQ ID NO:

114.

20. The polypeptide according to any preceding claim, wherein the polypeptide comprises at least one copy, at least two copies, or at least three copies of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% sequence identity to any of SEQ ID NOs: 115 to 137 or 322 to 329.

21. A polypeptide comprising the amino acid sequence: (XMXXXXILXXYXXGXXXFXXIXLXX(I / A)XLXX(AX1X2X3X4)nAX(T / L / F)XXAX(L / F)XXA X(L / F)XXAXVXPVLWXXAXLXGAX(M / V)XXXXXXX(Y / F)XXAXX)m, wherein X is any amino acid, wherein X1is any amino acid, wherein X2is L or F, wherein X3is any amino acid, wherein X4is any amino acid, wherein m is at least 2, and wherein n is at least 10.

22. The polypeptide according to claim 21, wherein m is at least 3 or at least 4.

23. The polypeptide according to claim 21 or 22, wherein n is at least 15 or at least 20.

24. The polypeptide according to any of claims 21 to 23, wherein X1is D, N, I, S, E, K, L, R, V, A, C, M, or T, preferably wherein X1is D, N, I, S, E, K, L, R, or V, more preferably wherein X1is D or N.

25. The polypeptide according to any of claims 21 to 24, wherein X2is L.

26. The polypeptide according to any of claims 21 to 25, wherein X3is S, E, R, T, D, H, Q, K, N, C, A, F, G, I, V, W, or Y, preferably wherein X3is S, E, R, T, D, H, Q, K, N, or C.

27. The polypeptide according to any of claims 21 to 26, wherein X4is G, E, Q, K, R, A, D, H, N, Y, S, I, or C, preferably wherein X4is G, E, Q, K, R, A, D, H, N, or Y.

28. The polypeptide according to any preceding claim, wherein the polypeptide has a molecular weight of at least 30 kDa, at least 40 kDa, at least 50 kDa, at least 60 kDa, at least 70 kDa, or at least 80 kDa, optionally wherein the polypeptide has a molecular weight of from 30 kDa to 1000 kDa, from 40 kDa to 1000 kDa, from 50 kDa to 1000 kDa, from 60 kDa to 1000 kDa, from 70 kDa to 1000 kDa, or from 80 kDa to 1000 kDa.

29. The polypeptide according to any preceding claim, wherein the polypeptide is capable of forming a lyotropic liquid crystal mesophase.

30. The polypeptide according to any preceding claim, wherein the polypeptide is soluble at a concentration of at least 20 mg / ml, at least 30 mg / ml, at least 40 mg / ml, at least 50 mg / ml, at least 60 mg / ml, at least 70 mg / ml, at least 80 mg / ml, at least 90 mg / ml, or at least 100 mg / ml.

31. The polypeptide according to any preceding claim, wherein the polypeptide is capable of being expressed by a cell or a cell-free transcription and translation system.

32. A composition comprising the polypeptide according to any of claims 1 to 31.

33. The composition according to claim 32, wherein the composition comprises the polypeptide at a concentration of at least 20 mg / ml, at least 30 mg / ml, at least 40 mg / ml, at least 50 mg / ml, at least 60 mg / ml, at least 70 mg / ml, at least 80 mg / ml, at least 90 mg / ml, or at least 100 mg / ml.

34. The composition according to claim 32 or 33, wherein the polypeptide is not denatured.

35. The composition according to any of claims 32 to 34, wherein the composition comprises a solvent.

36. A polynucleotide encoding the polypeptide according to any of claims 1 to 31.

37. A vector comprising the polynucleotide according to claim 36.

38. A cell comprising the polynucleotide according to claim 36 or the vector according to claim 37.

39. A fibre comprising the polypeptide according to any of claims 1 to 31.

40. The fibre according to claim 39, wherein the fibre has been produced via a wetspinning method.

41. The fibre according to claim 39 or 40, wherein the fibre has an average diameter of from 100 nm to 100 µm, from 500 nm to 50µm, from 1 µm to 40 µm, from 2.5 µm to 35 µm, from 5 µm to 30 µm, from 7.5 µm to 25 µm, or from 10 µm to 20 µm.

42. The fibre according to any of claims 39-41, wherein the fibre has a Young’s modulus of at least 0.5 GPa, at least 1.0 GPa, at least 2 GPa, at least 5.0 GPa, at least 10.0 GPa, at least 15.0 GPa, at least 20.0 GPa, at least 25.0 GPa, at least 30.0GPa, at least 35.0 GPa, at least 40.0 GPa, at least 50.0 GPa, at least 60.0 GPa, at least 70.0 GPa, at least 75.0 GPa, at least 80.0 GPa, at least 90.0 GPa, at least 100.0 GPa, at least 125 GPa, at least 150 GPa, at least 175 GPa, or at least 200 GPa.

43. The fibre according to any of claims 39-42, wherein the fibre has an engineered strength of: at least 0.1 GPa, at least 0.2 GPa, at least 0.3 GPa, at least 0.4 GPa, at least 0.5 GPa, at least 0.6 GPa, at least 0.7 GPa, at least 0.8 GPa, at least 0.9 GPa, at least 1.0 GPa, at least 1.1 GPa, at least 1.2 GPa, at least 1.3 GPa, at least 1.4 GPa, at least 1.5 GPa, at least 1.6 GPa, at least 1.7 GPa, at least 1.8 GPa, at least 1.9 GPa, at least 2.0 GPa, at least 2.1 GPa, at least 2.2 GPa, at least 2.3 GPa, at least 2.4 GPa, at least 2.5 GPa, at least 2.6 GPa, at least 2.7 GPa, at least 2.8 GPa, at least 2.9 GPa, or at least 3.0 GPa.

44. The fibre according to any of claims 39-43, wherein the fibre has a strain to failure of at least 2%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 90%, at least 100%, at least 125%, at least 150%, at least 175%, at least 200%, at least 225%, at least 250%, at least 275%, or at least 300%.

45. The fibre according to any of claims 39-44, wherein the fibre has a toughness of at least 10 J / g, at least 20 J / g, at least 40 J / g, at least 60 J / g, at least 80 J / g, at least 100 J / g, at least 120 J / g, at least 140 J / g, at least 160 J / g, at least 180 J / g, at least 200 J / g, at least 250 J / g, at least 300 J / g, at least 350 J / g, at least 400 J / g, at least 450 J / g, at least 500 J / g, at least 550 J / g, at least 600 J / g, at least 650 J / g, at least 700 J / g, at least 750 J / g, at least 800 J / g, at least 850 J / g, at least 900 J / g, at least 950 J / g, or at least 1000 J / g.

46. A yarn comprising the polypeptide according to any of claims 1-31 or the fibre according to any of claims 39-45.

47. A textile comprising the polypeptide according to any of claims 1-31, the fibre according to any of claims 39-45, or the yarn according to claim 46.

48. Use of the polypeptide according to any of claims 1-31, the fibre according to any of claims 39-45, the yarn according to claim 46, or the textile according to claim 47, in the production of a textile product of, wherein the textile product is selected from sportswear; materials for blast containment; materials for blade containment; textiles for parachutes; ropes; textiles for clothing; textiles for shoes; general medical textiles; wound dressings; resorbable and non-resorbable surgical sutures; resorbable and non-resorbable stents; guide-wires for surgery; biocompatible coatings for implanted medical devices; surgical meshes; and scaffolds for 3D tissue engineering.

49. A textile product comprising the polypeptide according to any of claims 1-31, the fibre according to any of claims 39-45, the yarn according to claim 46, or the textile according to claim 47, wherein the textile product is selected from sportswear; materials for blast containment; materials for blade containment; textiles for parachutes; ropes; textiles for clothing; textiles for shoes; general medical textiles; wound dressings; resorbable and non- resorbable surgical sutures; resorbable and non-resorbable stents; guide-wires for surgery; biocompatible coatings for implanted medical devices; surgical meshes; and scaffolds for 3D tissue engineering.

Images