Test cells for dogbites
By modifying human cells to express canine CD3-chains and form hybrid TCR-complexes, the challenge of developing affordable immunotherapeutic drugs for dogs is addressed, enabling effective in vitro testing and potential immunotherapy solutions.
Patent Information
- Application Number
- PCT/EP2024/086332
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2023-12-15
- Filing Date
- 2024-12-13
- Publication Date
- 2025-06-19
AI Technical Summary
There is a significant unmet need for suitable immunotherapeutic targets in dogs, and existing cancer treatments for animals are limited, with cell therapies being expensive and unaffordable for most dog owners.
The development of human cells modified to express canine CD3-chains, forming a hybrid TCR-complex with human T-cell receptors, which can be used as a model for testing immunotherapeutic drugs intended for dogs without the need for living canine models.
This approach allows for the reliable and convenient testing of immunotherapeutic candidate compounds in vitro, reducing the need for costly and logistically complex in vivo testing in dogs, and providing a cost-effective immunotherapy option.
Smart Images

Figure IMGF000026_0001 
Figure IMGF000027_0001 
Figure 00000037_0000
Abstract
Description
[0001]TITLETest cells for dogBiTEsFIELDThe present disclosure concerns cells suitable for use in the development ofimmunotherapeutic drugs for dogs, and bispecific molecules suitable for binding toboth T-cells and target cells. BACKGROUND Until recently, the only drugs available to treat cancer in animals were thoseapproved for use in humans. However, a few drugs specifically intended for animalsare now approved.For example, the following drugs are approved or conditionally approved by FDAto treat cancer in dogs: ^Palladia (toceranib phosphate), to treat mast cell tumors, FDA andEMAapproved in 2009; ^Stelfonta (tigilanol tiglate injection), to treat mast cell tumors, FDA andEMA approved in 2020; ^Tanovea-CA1 (rabacfosadine for injection), to treat lymphoma, conditionallyFDA approved in 2016 and fully approved in 2021; and ^Laverdia-CA1 (verdinexor tablets), to treat lymphoma, conditionally FDAapproved in 2021In humans, many advanced cancer drugs have been approved. Both tumor vaccinesand cell therapies have been developed. However, cell therapies are quiteexpensive, and they may be unaffordable for most dog owners. In contrast, tumorvaccines could be logistically simple and provide a relative affordable immunotherapy for dogs.Checkpoint inhibitor therapy is a form of cancer immunotherapy based onmonoclonal antibodies. Some cancers can protect themselves from the immune system by stimulating immune checkpoint targets. Checkpoint therapy can blockinhibitory checkpoints and thus restore the immune system function. The first anti-cancer drug targeting an immune checkpoint was ipilimumab, a CTLA4 blockerapproved by FDA in 2011.Currently FDA-approved checkpoint inhibitor drugs target the molecules CTLA4,PD-1, or PD-L1. Examples of such drugs include Yervoy, Imjudo, Keytruda,Tecentriq, Bavencio, Imfinzi and Libtayo.Gilvetimab, a caninized monoclonal antibody against canine PD-, was recently (2024) conditionally approved by FDA to treat mast cell tumors and melanoma.However, there is still a large unmet need concerning suitable immunotherapeutictargets in dogs. SUMMARYThe present disclosure provides cells useful during development ofimmunotherapeutic drugs intended for dogs. If the candidate compounds rely onbinding to a T-cell receptor-complex (TCR-complex), the cells may be used as invitro tools to validate immunotherapeutic candidate compounds for dogs. Instead ofembarking on a cumbersome process for developing suitable canine model cells from scratch, the present disclosure provides a solution involving human cells. Said human cells are modified to represent a reliable and convenient canine model simply by expression of canine CD3-chains. It was found that canine CD3-chains could be successfully expressed in the cell membrane together with human T-cellreceptors, thus believed to form a canine-human hybrid TCR-complex in both T-cells and NK-cells. As demonstrated herein, this hybrid TCR-complex could then besuccessfully used as a target to test bispecific T-cell engagers (BiTEs) for dogswithout needing living dogs.In a first embodiment, the present disclosure provides a human cell expressing a T-cell receptor (TCR) and at least two different canine CD3-chains in its cell membrane. In a first aspect, the TCR comprises a human Vα and a human Vβ, or a human α- chain and a human β-chain. In a second aspect, the at least two different canine CD3-chains are selected from the group consisting of CD3ζ, CD3γ, CD3δ and CD3ε. In a third aspect, the cell expresses canine CD3ε and canine CD3γ, or wherein the cell expresses canine CD3ε and canine CD3δ, or wherein the cell expresses canine CD3ε and canine CD3ζ, or wherein the cell expresses canine CD3ε, canine CD3γ and canine CD3δ.In a fourth aspect, the cell expresses canine CD3ζ, canine CD3γ, canine CD3δ andcanine CD3ε, which together with the TCR forms a functional TCR-complex in the cell membrane. In a fifth aspect, the cell expresses canine CD3γ, canine CD3δ and canine CD3ε, which together with the TCR forms a functional TCR-complex in the cell membrane. In a sixth aspect, the cell is a T-cell or a Natural killer-cell. In a seventh aspect, the cell is a cytotoxic T-cell.In an eighth aspect, the cell is transduced with a nucleic acid encoding thepolyprotein represented by SEQ ID NO: 1.In a second embodiment, the present disclosure provides a human cell-linecomprising cells according to the first embodiment.In a first aspect, the cell-line is derived from Jurkat or NK92.In a third embodiment, the present disclosure provides a recombinant nucleic acidencoding canine CD3ε and at least one canine CD3-chain selected from the group consisting of CD3γ and CD3δ.In a first aspect, the recombinant nucleic acid encodes canine CD3ζ, canine CD3γ,canine CD3δ and canine CD3ε.In a second aspect, the recombinant nucleic acid encodes at least one ribosomalskipping sequence between two CD3-chains.In a third aspect, the recombinant nucleic acid encodes a ribosomal skippingsequences between each of the CD3-chains.In a fourth aspect, the recombinant nucleic acid is the form of a polycistronicconstruct encoding the polyprotein represented by SEQ ID NO: 1.In a fourth embodiment, the present disclosure provides a protein comprising a firstand a second Fv for binding to a first and a second target epitope, wherein each Fv comprises a VL and a VH, and the VL comprises three CDRs flanked by framework sequences, and the VH comprises three CDRs flanked by framework sequences, wherein the first Fv specifically binds, under physiological conditions, to an epitope located on the extracellular part of a canine CD3-chain, and wherein the second Fv specifically binds, under physiological conditions, to an epitope located on canineor human target cells.In a first aspect, the first Fv also specifically binds, under physiological conditions, to an epitope located on the extracellular part of a human CD3-chain.In a second aspect, the first and second Fv’s are scFv’s.In a third aspect, the first and second scFv’s are connected to each other by a linker, such as a peptide linker comprising 1 to 25 amino acid residues. Suitable examples include G4S, (G4S)2, (G4S)3, (G4S)4, (G4S)5 etc. and EAAAK, (EAAAK)2,(EAAAK)3, (EAAAK)4. Alternatively, the scFv’s may be connected by otherknown technologies like knob-in-hole Fc’s.In a fourth aspect, the linker is a glycine-serine linker comprising 5 to 50, 10 to 50,15 to 50 or 20 to 50 amino acid residues.In a fifth aspect, the first Fv specifically binds, under physiological conditions, tothe extracellular part of both human and canine CD3ε.In a sixth aspect, the second Fv specifically binds, under physiological conditions,to an epitope on a Tumor Associated Antigen located on a cancer cell.In a seventh aspect, the second Fv specifically binds, under physiologicalconditions, to an epitope on Tumor Associated Antigens located on both human and canine cancer cells.In an eighth aspect, the first Fv comprises,a VL with the following three CDRs; SEQ ID NO: 10 (CDR1), SEQ ID NO: 11 (CDR2) and SEQ ID NO: 12 (CDR3), and a VH with the following three CDRs; SEQ ID NO: 7 (CDR1), SEQ ID NO: 8 (CDR2) and SEQ ID NO: 9 (CDR3).In a nineth aspect, the second Fv is a scFv represented by SEQ ID NO: 14 or 15.In a tenth aspect, the second Fv specifically binds, under physiological conditions,to an epitope on ALPL-1 on an osteosarcoma cell, to an epitope of CD22 or to anepitope of HER2.In an eleventh aspect, the framework sequences in the first Fv are human, murine orcanine.In a twelfth aspect, the framework sequences in the second Fv are human, murine orcanine.In a fifth embodiment, the present disclosure provides a recombinant nucleic acidencoding the protein according the fourth embodiment. In a first aspect, the nucleic acid is in the form of linear or circular cDNA, mRNA or a circular DNA expression vector.In a sixth embodiment, the present disclosure provides the use of the cells accordingto the first embodiment for in vitro testing of immunotherapeutic candidatecompounds for dogs.In a seventh embodiment, the present disclosure provides an in vitro method fortesting immunotherapeutic candidate proteins for dogs, comprising the steps;a) providing a cell population comprising human cells according to the firstembodiment in a suitable medium,b) incubating the human cell population in step a) with an immunotherapeuticcandidate protein according to the fourth embodiment, as well as incubating the human cell population in step a) with canine cancer target cells, and thenc) measuring the canine cancer cell mortality, viability or proliferation.BRIEF DESCRIPTION OF THE FIGURES Figure 1 visualizes the generation of the cells expressing a TCR and canine CD3-chains. Human NK and T-cells can be converted by transferring the polycistronicnucleic acid encoding the canine CD3 complex includingCD3^^^CD3^^^CD3^^and^CD3^. The resulting T-cell will express both human andcanine CD3 proteins in complex with the endogenous (human)TCR. NK cells will be transduced with a second gene encoding for a human / canine TCR and the complex will be sent to the membrane. Both cells will become “caninized” for their CD3. This canine CD3 complex will be recognized by a dogBiTE and stimulate thecell through its TCR. Notably, this mechanism involves interaction between ahuman TCR and canine CD3-chains.Figure 2 visualizes, in a simplified manner, a conventional TCR-complexcomprising an α-chain with three CDRs and a β-chain with three CDRs together forming an αβTCR. The variable domain of the α-chain is called Vα. The variable domain of the β-chain is called Vβ. The TCR-complex comprises two CD3ζ-chains,two CD3ε-chains, one CD3γ-chain and one CD3δ-chain. The cell membrane is alsorepresented.Figure 3a visualizes, in a simplified manner, a conventional antibody comprisingtwo heavy chains and two light chains. Each light chain is connected to a heavy chain by a cysteine bridge, and the heavy chains are connected to each other by two cysteine bridges. The Variable domains forms two identical Fv’s. The N-terminal of the chains is represented by an N. The C-terminal of the chains is represented by a C. Each Fv comprises a VL and a VH with three CDRs (see Figure 3b). The VL and VH can be connected from C-terminal to the N-terminal by a peptide linker represented by a diagonal line, to form a scFv. The two orientations VL-linker-VH and VH-linker-VL are visualized in Figure 3c and 3d.Figure 4 visualizes, in a simplified manner, some suitable formats for BiTEs. Thesmallest BiTEs will contain a first scFv connected to a second scFv by a linker (see Figure 4a). However, the first Fv may be embedded in an antibody while the second Fv may be a scFv connected to the antibody by a linker (see Figure 4b and 4c). Accordingly, the bispecific proteins may comprise more than one Fv with the first specificity and more than one Fv with the second specificity.Figure 5 visualizes the design of a DogBiTE expression vector, here as a retroviralvector. The long terminal repeat (LTR) sequences will delimitate the region ofinterest for the transfer, and also serve as promoter sequence for the production. Theanti-cancer scFv is cloned at the beginning of the construct. The scFv is fused to aleader peptide (not shown) for ER-targeting and further exocytosis from theproducing cell on the N-terminal part. On the C-terminal partt, a peptide linkerconnects it to the scFv recognizing the canine extracellular domain of the CD3εprotein which contains on its C-terminal part an His-tag for purification anddetection. The sequence encoding the BiTE does not contain a STOP but a 2Aribosome skipping sequence followed by a green fluorescent protein (GFP) codingsequence. The resulting product is a BiTE comprising 2 scFv’s separated by a linkerand His tagged, and a separated cytosolic GFP . The latter will be used to detectexpressing cells. 2061 and 2063 are the code name for the CD19 targeting BiTEconstructs. 2062 and 2064 are the code name for the TP3 targeting BiTEsconstructs. These constructs differ in the orientation L-H or H-L of the anti-canineCD3 scFv.2061 pMP71-CD19BiTE-cCD3_scFv(H-L)-GFP2062 pMP71-TP3BiTE-cCD3_scFv(H-L)-GFP2063 pMP71-CD19BiTE-cCD3_scFv(L-H)-GFP2064 pMP71-TP3BiTE-cCD3_scFv(L-H)-GFPFigure 6 visualizes a Western blot of the different constructs used in the presentdisclosure. Note that anti-canine CD3 scFv was arranged either as VL-linker-VH orVH-linker-VL.Figure 7 visualizes Western blot of the production of BiTEs. Hek cells weretransfected with the indicated constructs and supernatants were harvested after 2 days. Ten microliter of a 3 mL supernatant was separated on an SDS-PAGE andtransferred to a nitrocellulase membrane. The produced BiTE were detected withanti-His tag antibody. A unique single product migrating at the expected size is observed.1 SW2061 (old)pMP71-CD19BiTE-cCD3_scFv(H-L)-GFP2 SW1529 pMP71-CD19BiTE-hCD3-GFP3 SW1850 human BiTE4 SW1851 human BiTE5 SW1971 pMP71-TP-3BiTE-hCD3-GFP6 SW2061 pMP71-CD19BiTE-cCD3_scFv(H-L)-GFP (DogBiTE)7 SW2062 pMP71-TP-3BiTE-cCD3_scFv(H-L)-GFP (DogBiTE)Figure 8a, 8b, 8c visualize the target binding capacity and selectivity of the BiTEproduced in Figure7. The lymphoblast cell line Jeko (CD19+, a) and theosteosarcoma cell line OSA (ALPL-1+, b) were incubated with 25 uL of thesupernatant containing the indicated BiTE constructs (SW2061 or SW2062) or noBiTE (negative control) for 15 minutes at room temperature and washed. The boundBiTEs were detected with an anti-His Tag antibody combined with AF-647fluorophore for 5 min at room temperature in the dark. After washing, the cells wereanalyzed on a flowcytometer and AF-647 positive cells were detected only when the BiTEs were harboring the TP3 scFv (osteosarcoma marker 2062in b and allconstructs in c), but not when anti-CD19FMC63 scFv was present (2061 in b and c)and not with mock supernatant. Thus, DogBiTE can generate potent scFv binding to their target.Figure 9a and 9b show a “caninized”-CD3 (cCD3) and human (hCD3) Jurkat T-cellline created from the E6 clone expressing GFP under the control of NFAT in twodifferent experiments with two different preparation of DogBiTEs. These cell lines and the non-modified Jurkat (Mock) were incubated with the indicated target cells (BL41, CD19+; OSA, ALPL-1+) or no target cells. Fifty µL of the indicated BiTEpreparation from Fig. 7 or a new one were added and the mix was left for 12 hoursat 37°C (hBiTE: CD19-BiTE and TP3-BiTE; dogBiTE-1 and 2: TP3 DogBiTE VH-linker-VL and VL-linker-VH, respectively). The presence of GFP (produced onlyupon TCR stimulation) was detected by flowcytometry. 9a % of positive Jurkat cellsand 9b % of positive GFP-cells. Note that the human constructs work in allconditions due to the presence of endogenous human CD3 in these cells. Importantly DogBiTEs only stimulate caninized Jurkat cell line.Figure 10a visualizes “Caninized” or human NK-TCR cells: NK-92 were transducedor not (NT) with caninized (c)CD3 chains (SW2069) or human (h)CD3 chains (SW652, from Mensali et al, 2019) and subsequently transduced with a human TCR (SW907). The presence of the TCR was detected by flowcytometryt with an anti- hTCRa / b-PE. As shown cCD3 is able to escorte human TCR molecules to the plasma membrane in NK cells. Figure 10b depicts a functional activity test whereNK-92, NK-92-hCD3-TCR, NK-92-cCD3-TCR were incubated with BL41expressing GFP in the presence or not of the indicated BiTE construct for 12 hours.The mix was run on flowcytometer and the presence of target cells was monitored by the % of remining GFP. As shown, NK-92 alone cannot kill BL41 cells (confirming Walseng et al.2017) and neither can NK-92-CD3-TCR without BiTEs. DogBiTEs can lead to target cell killing, only when cCD3 is expressed in theeffector cells (triangles). Note that the human BiTE also activated the cCD3-NK-TCR cells (squares), probably due to the presence of hCD3e in these cells which issent to the plasma membrane in complex with cCD3 proteins. Indeed, it was reported that some NK cells can express CD3 proteins (see Lanier et al J Immunol,1992 Sep 15;149(6):1876-80 “Expression of cytoplasmic CD3 epsilon proteins inactivated human adult natural killer (NK) cells and CD3 gamma, delta, epsilon complexes in fetal NK cells. Implications for the relationship of NK and T lymphocytes” PMID: 1387664). It is tempting to speculate that due to the conservation of protein sequences between human and dog CD3 proteins, complexes of heterogenous proteins are formed as it has been observed for humans and mice (PMID: 28368009; PMID: 16951205).Figure 11 visualizes the BLI killing assay. OSA cells expressing luciferase wereincubated with “caninized” or human NK-TCR and the indicated BiTE. % of lysis isdepicted as % of a saturating control. Only TP3-Bite can lead to OSA killing, and dogBiTE (cTP3BiTE) can only induce target cell killing in “caninized” NK-TCR cells.Figure 12 visualizes the BLI killing assay. BL-41 cells expressing luciferase wereincubated with “caninized” or human NK-TCR and the indicated BiTE. % of lysis is depicted as % of a saturating control. Only CD19-BiTe can lead to BL-41 killing,and dogBiTE (cCD19BiTE) can only induce target cell killing in “caninized” NK-TCR cells.Figure 13 visualizes the cytotoxic activities of the DogBiTEs against cancer cellsexpressing the targeted antigens in a BLI killing assay. Jeko-1 (CD19+) cells expressing luciferase were incubated with canine primary T cells and the indicated BiTE. % of lysis is depicted as % of a saturating control. Only CD19-BiTE can lead to Jeko-1 killing, and dogBiTE (cCD19BiTE) can only induce target cell killing in canine primary T cells.Panel A. Canine T-cells (CTC) were incubated or not with different amounts of the2061 BiTE construct targeting the CD19 antigen on the target cells, and with the Jeko-1 B-cell lymphoma cell line. An irrelevant BiTE construct, 2062 targeting TP3, was used as a negative control to evaluate the basic killing of the BiTEconstruct. A strong and almost complete cancer cell killing with the BiTEspecifically targeting the CD19 antigen on the B-cell lymphoma target cell can beobserved. When no BiTES were present, only the expected non-self-killing could beobserved (CTC reacting on the human cancer cells).Panel B. CTC were incubated or not with different amounts of the 2062 BiTEconstruct targeting the ALPL-1 (TP-3 antigen) on the target cells (OSA-787). Anirrelevant BiTE construct, 2061 targeting CD19, was used as a negative control toevaluate the basic killing of the BiTE construct. We can observe a strong and almostcomplete cancer cell killing with the BiTE specifically targeting the TP3 antigen on the osteosarcoma target cell. When no BiTES were present, only the expected non-self-killing could be observed (CTC reacting on the human cancer cells).Panel C and D. CTC from two donor dogs were incubated with BiTE targeting theTP3 antigen on the osteosarcoma cell line OSA 787. Several effector to target (E:T)ratios of CTC versus target cancer cells were used with TP3 BiTE. The BiTEconstruct is already demonstrating cell-killing efficiency at a ratio of one Dog T-cell for one target cancer cell. The 2061 BiTE construct targeting CD19 is anirrelevant control to evaluate the non-self-killing of dog T-cells toward the humancancer cell line. Panel E. CTC from 5 different donor dogs were incubated with BiTE targeting the TP3 antigen on the osteosarcoma cell line OSA787, using 10:1 E:T ratio.Concentration dependent specific killing with the 2062 BiTE is clearlydemonstrated in all the different donor dogs.Figure 14 illustrates the killing ability of BiTEs, highlighting the impact of differentBiTE designs, in some the size of the linker between the scFvs was changed and one had a Fc-based design with knobs-in-hole (KIH) structure.NT = control (no BiTE). Here, the DogBiTE used is the TP-3DogBiTE targetedagainst ALPL-1. Fig. 14 A depicts the G4S linker position in the DogBiTEmolecule. Fig. 14 B depicts the design of the expression vector of the KIH DogBiTE construct and the expected molecular product. A: BiTE with G4S-linker between the scFvs B: BiTE with (G4S)2-linker between the scFvs C: BiTE with (G4S)3-linker between the scFvs D: BiTE with (EAAAK)3-linker between the scFvsE: BiTE with knob-in-hole Fc connecting the scFv’sFigure 14 C depicts an example of functional assay which was performed withNK92-cCD3-TCR cells as in Fig. 10b. Here the target cells, OSA, were co-culturedwith NK92-cCD3-TCR in the presence of the different BiTE constructs at saturating concentration for 8 hours. The killing was quantified using BLI Figure 14 D shows a Western blot with DogBiTE TP3 constructs designed with different linkers or a Knobs in Hole design. The indicated constructs were produced in Hek cells and supernatants were harvested and 10 µL / 2 mL were loaded on a SDS-PAGE and detected by Western blot using an anti-His tag antibody. Concentrations were determined by density using TP3BiTE (a human TP3 BiTE used as a standard). Figure 14 E These constructs were then used at equal amount to stain the ALPL-1 positive cell line OSA or the BL41 (ALPL-1 negative cell line and CD19 positive). As shown, all constructs efficiently bound the ALPL-1+ target but not the negative one (CD19 is used as a binding control for BL41). Notably, (G4S)2 linker seems to bind with a greater affinity than the other constructs.Figure 15 A shows the TCR complex comprising a TCR and a CD3 complex.Figure 15B shows the constructs tested in the CD3 experiment. Figure 15C illustrates the cells in the CD3 experiment.Figure 15 D shows a flow plot of NK-92 cells transduced with the indicated cCD3constructs + / - TCR. As shown, only the full CD3 and the cCD3εδγ have thecapacity to mix with the endogenous human CD3ε and be recognized by OKT-3 inthe presence of a TCR transgene. Thus, the cCD3ζ subunit is not necessary to createa functional complex. DETAILED DESCRIPTION It is to be noted that the term “a” or “an” entity refers to one or more of that entity;for example, “a cell”, is understood to represent one or more cells. As any skilledperson will understand, a cell expressing a TCR will normally express numerous such TCRs. As such, the terms “a” (or “an”), “one or more”, and “at least one” canbe used interchangeably herein. Accordingly, a cell expressing at least two differentcanine CD3-chains in its cell membrane will normally express numerous CD3-chains of each type in its cell membrane. The concept of specific binding to an epitope under physiological conditions is well known. Specific binding to a target may be distinguished from non-specific binding.Accordingly, the targeting units herein (e.g. Fv’s, in particular scFv’s) display anon-covalent and reversible binding to their particular epitopes under the relevantphysiological conditions. They bind with a higher affinity to the target epitope thanthey bind non-related molecules. The bispecific proteins herein can thus function asa coupling agent between cells expressing T-cell complexes and target cells. Thebinding of a targeting unit to a target epitope can be measured by conventionalmethods, e.g. surface plasmon resonance (SPR). The affinity between the targetingunit and its epitope can be represented by a KD-value (the equilibrium dissociation constant) for example in the range of 10-4M to 10-12M, such as 10-5M to 10-11M or 10-6M to 10-10M. As used herein, when referring to “sequence identity” of proteins, an amino acid sequence having at least x% identity to a second amino acid sequence means thatx% represents the fraction of amino acid residues in the first sequence which areidentical to their matched amino acid residues of the second sequence when both sequences are optimally aligned via a global alignment, relative to the total length of the second amino acid sequence. Both sequences are optimally aligned when thesequence identity value is at its maximum by using the comparison matrixBLOSUM62 with gap costs: existence 11, extension 1.The cells for testing immunotherapeutic compounds for dogs.The present disclosure concerns human cells as a starting material. Such cells maybe isolated from a healthy subject by leukapheresis or other suitable methods. Thehuman cells may endogenously express a TCR. Suitable examples include cytotoxicT-cells and T-helper cells. Cells isolated from a healthy subject will be primarycells. Alternatively, the human cells can be transduced or transfected with nucleicacids encoding a TCR and CD3-chains if needed.Culturing of primary cells can be challenging, but culturing of “immortalized” cells i.e. cell-lines, is generally easier for consistently obtaining larger cell populations. The human cells in the present disclosure can for example be cell-lines suitable forclinical use like NK-92 or Jurkat cell-lines. Jurkat cells are “immortalized” humanT-cells expressing an αβTCR. Numerous Jurkat cell-lines are commerciallyavailable from the American Type Culture Collection (ATCC). NK-92 can expressTCRs as disclosed by Mensali et al 2019 eBioMedicine, 40: 106–11.Such human cells, already expressing TCRs, can be modified to also express canineCD3-chains. For example, the cells can be transduced or transfected with nucleicacids encoding canine CD3-chains for transient expression. Alternatively, nucleicacids encoding canine CD3-chains can be incorporated in the cell genome for stable expression by known methods. TCRs are well-known receptors. Their variable domains, either Vα and Vβ or Vγand Vδ, form a single antigen binding unit based on six complementaritydetermining regions, CDRs. The CDRs are flanked by framework sequences. Thefirst framework sequence is N-terminal to the CDR1, the second frameworksequence is located between CDR1 and CDR2, while the third framework sequenceis located between CDR2 and CDR3. Accordingly, both a Vα and a Vβ can be roughly visualized as follows, with the CDRs boxed and the N-terminal indicated as N-: N-FRAMEWORK1CDR1FRAMEWORK2CDR2FRAMEWORK3CDR3FRAMEWORK4However, the detailed mechanism of action of TCRs is not completely understood.As visualized in Figure 2, they are believed to form a TCR-complex upon specific binding to its target. Such TCR-complex involves interaction between the TCR and several CD3-chains. It is found that human cells expressing a human TCR can form a hybrid TCR-complex with canine CD3-chains. Notably, co-expression of canine CD3ε alone incells expressing a human TCR, failed to present the canine CD3ε epitope on the cellsurface.However, it was found that by co-expressing all four canine CD3-chains (canineCD3ζ, canine CD3γ, canine CD3δ and canine CD3ε) in cells expressing a humanTCR, successful presentation of the canine CD3ε epitope was achieved.Accordingly, such cells are believed to express a hybrid TCR-complex in the cellmembrane comprising a human αβTCR and at least two canine CD3-chains eitherupon binding of the TCR target or upon clustering of CD3-chains due to binding of the bispecific proteins disclosed herein. This TCR-complex is referred to as hybridbecause it contains both human and canine proteins. As demonstrated herein, thesehybrid TCR-complexes can activate the cells. Accordingly, they are believed toform a functional TCR-complex in the cell membrane. These cells can be used during drug development of immunotherapeutic drugs intended for dogs. If the candidate compounds rely on binding to TCR-complexes,the cells may be used as in vitro tools to validate immunotherapeutic candidatecompounds for dogs. These human cells are modified to represent a reliable and convenient canine model simply by expression of canine CD3-chains.This approach can thus reduce the need for in vivo testing in living dogs or the needto create fully canine in vitro system such as an equivalent Jurkat or NK-92 cellline.For example, the present disclosure provides an in vitro method for testingimmunotherapeutic candidate proteins for dogs, comprising the steps;a) providing a cell population comprising human cells expressing a TCR andcanine CD3-chains, together forming a TCR-complex, in a suitable medium,b) incubating the human cell population in step a) with an immunotherapeuticbispecific candidate protein comprising a first Fv for specific binding to an epitopelocated on the extracellular part of a canine CD3-chain and a second Fv for bindingto an epitope located on target cells, as well as incubating the human cell population in step a) with target cells, and thenc) measuring the target cell mortality, viability, or proliferation.Culturing of the cells disclosed herein can be done by well-known methods, and adetailed example is provided in the experimental part.Nucleic acids encoding proteins are well known for example DNA and RNA. Theproteins mentioned herein can be encoded by recombinant nucleic acids. Recombinant nucleic acids are non-naturally occurring nucleic acids. In particular,the recombinant nucleic acid may encode canine CD3ε and at least one canine CD3-chain selected from the group consisting of CD3γ and CD3δ. The recombinantnucleic acid may encode canine CD3ε and canine CD3γ, or canine CD3ε and canineCD3δ, or canine CD3ε and canine CD3ζ, or canine CD3ε, canine CD3γ and canineCD3δ. A recombinant nucleic acid may encode canine CD3ζ, canine CD3γ, canineCD3δ and canine CD3ε. Such recombinant nucleic acids may encode canine CD3-chains in any order. The recombinant nucleic acids may comprise promoters, enhancers and other well- known elements for providing expression of the CD3-chains in the intended cell.Accordingly, the recombinant nucleic acid may encode and express canine CD3εand at least one canine CD3-chain selected from the group consisting of canineCD3γ and canine CD3δ in human cells. The recombinant nucleic acid may encodeand express, in human cells, canine CD3ε and canine CD3γ, or canine CD3ε andcanine CD3δ, or canine CD3ε and canine CD3ζ, or canine CD3ε, canine CD3γ andcanine CD3δ. A recombinant nucleic acid may encode and express, in human cells,canine CD3ζ, canine CD3γ, canine CD3δ and canine CD3ε. For expression in equimolar ratio, the CD3-chain can be produced as a polyprotein wherein ribosomal skipping sequences separate the CD3-chains. Ribosomal skipping sequences are well-known. NIH defines them as: a 2A is an oligopeptide sequence mediating a ribosome 'skipping' effect, producing an apparent 'cleavage' of polyproteins. First identified and characterized in picornaviruses, '2A-like' sequences are found in other mammalian viruses and a wide range of insect viruses. They are commonly used in biotechnology to produce two or more proteins in equimolar ratio, in a polycistronic design. The recombinant nucleic acid mayencode at least one ribosomal skipping sequence between two CD3-chains. Therecombinant nucleic acid may encode a ribosomal skipping sequence between eachof the CD3-chains.SEQ ID NO: 1 shows one example of a polyprotein comprising four canine CD3-chains (cCD3ζ-F2A-cCD3ε-T2A-cCD3δ-E2A-cCD3γ) with leader peptidesunderlined and three different ribosomal skipping sequences in italic.The Ribosomal skipping sequence F2A: VKQTLNFDLLKLAGDVESNPGP (SEQ IDNO: 2)The Ribosomal skipping sequence T2A: EGRGSLLTCGDVEENPGP (SEQ ID NO: 3)The Ribosomal skipping sequence E2A: QCTNYALLKLAGDVESNPGP(SEQ ID NO: 4) Accordingly, the recombinant nucleic acids herein can be SEQ ID NO: 1 or nucleic acids with more than 75% sequence identity thereto, such as more than 80%, 90% or95% sequence identity thereto.The leader peptide is believed to be trimmed off and will likely not be present in theprotein in the cell membrane.In one embodiment, the present disclosure provides a human cell immune cell, such as a T-cell or NK-cell, expressing a hybrid TCR-complex in the cell membrane comprising a human αβTCR and at least two, such as three or four different canine CD3-chains including canine CD3ε. The bispecific proteins In contrast to TCRs, most naturally occurring antibodies comprise two identicalFv’s (see Figure 2). Because both Fv’s are able to bind the same target epitope, suchantibodies are monospecific and their binding to the target epitope is bivalent.An Fv is a protein moiety able to bind a target epitope under physiologicalconditions. The Fv comprises an antibody light chain variable domain (VL) and anantibody heavy chain variable domain (VH). Such variable domains are well-known for skilled persons.Provided herein are proteins comprising a first targeting unit for binding to a firsttarget epitope and a second targeting unit for binding to a second target epitope.Such proteins are bispecific. The first and second targeting unit may have any format as long as they providespecific binding, under physiological conditions, to their target epitopes. Suchbinding units may be obtained by phage display libraries by conventional screening.They can also be obtained from TCRs. However, more conventionally, such targeting units may be obtained from antibodies of any type including single- domain antibodies.In one embodiment, the targeting units can provide specific binding to aconformational epitope (i.e. a 3Dimensional epitope) rather than conventionalepitopes which often are 2Dimensional or linear. This may allow targeting ofproteins that are also expressed on normal tissue, but with a different conformationin diseased tissue. Accordingly, such target epitopes can be used to distinguishhealthy cells from cancer cells.In particular, provided herein are proteins comprising a first and a second targetingunit for binding to a first and a second target epitope,wherein the first targeting unit specifically binds, under physiological conditions, toan epitope located on the extracellular part of a canine CD3-chain, and wherein thesecond targeting unit specifically binds, under physiological conditions, to anepitope located on canine or human target cells.In one embodiment, the bispecific proteins comprise a first Fv for binding to a firsttarget epitope and a second Fv for binding to a second target epitope.In particular, provided herein are proteins comprising a first and a second Fv forbinding to a first and a second target epitope, wherein each Fv comprises a VL and a VH, and the VL comprises three CDRs flanked by framework sequences, and the VH comprises three CDRs flanked by framework sequences, wherein the first Fv specifically binds, under physiological conditions, to an epitope located on the extracellular part of a canine CD3-chain, and wherein the second Fv specifically binds, under physiological conditions, to an epitope located on canineor human target cells.Physiological conditions, as used herein, means the environment encountered orsimulated, in a living human or canine patient, where the disclosed bispecificproteins are intended to bind an epitope located on canine or human target cells.In general, the physiological conditions in most human extracellular fluids arenormally ca. 37°C, pH in the range of 6.0 to 7.5. The physiological conditions incanine extracellular fluids are normally 38-39°C, pH in the range of 6.0 to 7.5. If the target cells are cancer cells in a solid tumor, the physiological conditions are theones found in the solid tumor, i.e. the tumor microenvironment (TME). The TME isoften hypoxic and acidic. Each VL and VH herein comprises three complementarity determining regions (CDRs) flanked by framework sequences. Framework sequences are structurally conserved regions that normally tend to form a β-sheet structure positioning theCDRs for specific binding to the target epitope under physiological conditions.The CDR sequences herein have been determined using the well-known Kabatsystem. The first framework sequence is N-terminal to the CDR1, the second frameworksequence is located between CDR1 and CDR2, while the third framework sequenceis located between CDR2 and CDR3. Accordingly, both a VL and VH can be roughly visualized as follows, with the CDRs boxed and the N-terminal indicated as N-: N-FRAMEWORK1CDR1FRAMEWORK2CDR2FRAMEWORK3CDR3FRAMEWORK4Antibodies obtained from dogs will have canine framework sequences. Antibodiesobtained from mice will have murine framework sequences. Antibodies obtainedfrom humans will have human framework sequences. However, it is well knownthat murine framework sequences can be completely or partially replaced by humanframework sequences. This process is called humanization, and the resulting Fv isthus humanized. Accordingly, if murine or human framework sequences in the Fvare completely or partially replaced by canine framework sequences, the resultingFv is caninized.In one embodiment of the bispecific proteins herein, each of the frameworksequences in the first Fv may independently be human, murine or canine.In one embodiment of the bispecific proteins herein, each the framework sequencesin the second Fv may independently be human, murine or canine.In one embodiment of the bispecific proteins herein, all the framework sequences inthe first Fv may be human, murine or canine.In one embodiment of the bispecific proteins herein, all the framework sequences inthe second Fv may be human, murine or canine.A framework sequence is human if it is present in a human antibody, and it is flanking a CDR in a human VL or human VH, or it is encoded by a human genomic sequence flanking a CDR in a human VL-sequence or human VH-sequence. A framework sequence is canine if it is present in a canine antibody and it is flanking a CDR in a canine VL or canine VH, or it is encoded by a canine genomic sequence flanking a CDR in a canine VL-sequence or canine VH-sequence. A framework sequence is murine if it is present in a murine antibody and it is flanking a CDR in a murine VL or murine VH, or it is encoded by a murine genomic sequence flanking a CDR in a murine VL-sequence or murine VH- sequence.The framework sequences may also comprise amino acid substitutions. Each of thecanine framework sequences may optionally comprise 1 to 5 amino acidsubstitutions if needed based on discovered or predicted immunogenicity by knownmethods. An amino acid substitution is a sequence wherein an amino acid residue in a specific position is substituted for a different amino acid residue at thecorresponding position, apparent when the sequences are aligned. The substitutionsmay be conservative substitutions. Even if such framework sequences are notnecessarily previously known from canine antibodies, they may provide lowerimmunogenic risk in dogs compared to a murine framework sequence.In one embodiment, the canine framework sequences are mature canine frameworksequences available from known canine antibodies. Without being bound by theory,such framework sequences may convey very low risk of triggering unwantedimmunogenic responses against the Fv in dogs, and at the same time increase thelikelihood of obtaining stable binding units which are expressed well in cellular systems.In one embodiment, the human framework sequences are mature human frameworksequences available from known human antibodies. Without being bound by theory,such framework sequences may convey very low risk of triggering unwanted immunogenic responses against the Fv in humans, and at the same time increase the likelihood of obtaining stable binding units which are expressed well in cellular systems.In one embodiment, the Fv comprises or consists of VL-linker-VH. In anotherembodiment, the Fv comprises or consists of VH-linker-VL.Such antigen binding domains are often referred to as single chain Fv (scFv’s). The linker between VL and VH in a scFv generally needs a certain length in order to allow the VH and VL to form a functional antigen binding domain. In oneembodiment, the linker comprises 10 to 50 amino acid residues, or 15 to 30 aminoacid residues. In one embodiment, the linker comprises 10 to 50 glycine and / orserine residues. One such example is provided by SEQ ID NO: 13.The VH and VL may be connected by at least one disulphide bridge or alternativelinkers. The VL and VH may be embedded in a Fab-fragment of an antibody or an antibody as such. Bispecific proteins for binding and recruiting T-cells to target cells can have avariety of formats. Examples of such T-cell-engagers are BiTEs. For example,Blinatumomab is a bispecific CD19-directed CD3 T-cell engager that binds toCD19 expressed on the surface of cells of B-lineage origin and CD3 expressed onthe surface of T-cells. It activates endogenous T-cells by connecting CD3 in the T-cell receptor (TCR) complex with CD19 on benign and malignant B cells.Blinatumomab mediates the formation of a synapse between the T-cell and thetumor cell, upregulation of cell adhesion molecules, production of cytolyticproteins, release of inflammatory cytokines, and proliferation of T-cells, whichresult in redirected lysis of CD19+ cells. Many types of bispecific T-cell engagers are known. Some examples are described by Goebeler and Bargou (Nat. Rev. Clin. Oncol.17(7):418-434 (2020); doi:10.1038 / s41571-020- 0347-5), or by Zhou et al. (Biomarker Research 9(38) (2021)).The BiTEs disclosed in the examples comprise a well-known C-terminaloligopeptide comprising multiple histidine residues, also known as a “His-tag”, forpurification and detection during research and early development. Such “His-tag”will not necessarily be present in a protein drug. The first targeting unitThe first targeting unit for specific binding to a first target epitope located on theextracellular part of canine CD3-chain will provide binding to cells expressing a TCR-complex comprising the canine CD3-chain. The TCR does not signal and associates at the ER with CD3 proteins which will serve of signaling units.The first targeting unit may be a Fv for specific binding to a first target epitopelocated on the extracellular part of canine CD3-chain. It will provide binding tocells expressing a TCR-complex comprising the canine CD3-chain. Accordingly, afirst Fv for specific binding to a first target epitope located on the extracellular partof canine CD3ε-chain will provide binding to cells expressing a TCR-complex comprising a canine CD3ε-chain. However, as demonstrated herein, the first Fv may also provide specific binding to cells expressing a TCR-complex comprising ahuman CD3ε-chain. Such cross-reactivity is beneficial because the same protein canthus bind both canine and human T-cells. One such example of first Fv with cross-reactivity for both canine and humanCD3ε-chains is represented by the scFv with the SEQ ID NO: 5. Accordingly, thepresent disclosure provides an Fv comprising a VL with the following three CDRs;CDR1: QSIFKNCDR2: YASCDR3: LQAYSTPWTand a VH with the following three CDRs;CDR1: GYTFSDYNMCDR2: IYPYNGGTCDR3: ARLVYFDY.Another example is the scFv with the SEQ ID NO: 6. It comprises the same CDRs as the scFv with SEQ ID NO: 5. The present disclosure also provides scFv’s wherein the sequences have more than 70%, such as 75% to 99% sequence identity to SEQ ID NO: 5. The present disclosure also provides scFv’s wherein the sequences have more than 70%, such as 75% to 99% sequence identity to SEQ ID NO: 6. The present disclosure also provides scFv’s wherein the sequences have more than 70%, such as 75% to 99%, such as 85% to 99% sequence identity to SEQ ID NO: 5, provided the CDRs are identical to the ones in SEQ ID NO: 5. Such scFv’s may for example be humanized versions of the scFv. The present disclosure also provides scFv’s wherein the sequences have more than 70%, such as 75% to 99%, such as 85% to 99% sequence identity to SEQ ID NO: 6, provided the CDRs are identical to the ones in SEQ ID NO: 6. Such scFv’s may for example be humanized versions of the scFv. However, it was found that in the BiTEs comprising the scFv represented by SEQ ID NO: 5 performed better than BiTEs comprising the scFv represented by SEQ ID NO: 6. Accordingly, for this Fv, VH-linker-VL may be the preferred orientation in scFv’s.It was found that this Fv activated the canine T-cells upon binding. Because theaffinity and the position of the epitope may affect the efficacy of a synapseformation on the T-cell, any anti-CD3 Fv should be tested in a scFv-format for theability to stimulate T-cells through TCR clustering. Indeed, the binding of an scFvto CD3 is not sufficient to make a potent BiTE. scFv must be tested experimentallyand the epitope location must be extracellular (see Zhou et al, Biomarker Researchvolume 9, Article number: 38 (2021) “The landscape of bispecific T cell engager incancer treatment” and Tian et al. Journal of Hematology & Oncology volume 14,Article number: 75 (2021) “Bispecific T cell engagers: an emerging therapy for the management of hematologic malignancies” https: / / biomarkerres.biomedcentral.com / articles / 10.1186 / s40364-021-00294-9#Sec18; https: / / doi.org / 10.1186 / s13045-021-01084-4). The testing can be runusing primary T cells, which are cocultured with target cells (expressing the epitoperecognized by the second scFv). Activation of T cells is routinely performed and can be the detection of activation marker (CD69), degranulation markers (CD107a) or killing (bioluminescence-based assays, BLI or Chromium release).The BiTEs herein are believed to involve a mechanism for T-cell activation:1) The tumor cell plays an indispensable role in the T cell activation induced by the BiTE. In other words, the BiTE cannot activate the T cells alone, but needs to be clustered by another mean (tumour antigen) to trigger T-cell activation. This T-cell activation is TCR dependent, meaning that it is the result of TCR clustering that will trigger the necessary signalling components to enable the cellular changes related to activation. 2) T-cells can be activated without costimulatory signals such as CD28 and interleukin (IL)-2 where this feature can be attributed to memory T-cells which playan important role in the reaction to BiTEs (Godbersen C, Coupet TA, Huehls AM,Zhang T, Battles MB, Fisher JL, et al. NKG2D ligand-targeted bispecific T-Cell engagers lead to robust antitumor activity against diverse human tumors. Mol Cancer Ther.2017;16(7):1335–46.) 3) The immunological synapses between T-cells and tumor cells can assemble TCRs and amplify the first signals of activation because the Immunological synapsesbetween T-cells and tumor cells are also crucial to the BiTE-mediated tumor lysisby perforin (Huehls AM, Coupet TA, Sentman CL. Bispecific T-cell engagers for cancer immunotherapy. Immunol Cell Biol.2015;93(3):290–6.).Accordingly, provided herein are proteins comprising a first Fv for binding to a firsttarget epitope and a second Fv for binding to a second target epitope, wherein thefirst Fv is cross-reactive with both human and canine homologs of the targetprotein. Especially suitable as such target proteins are CD3-chains such as CD3γ,CD3δ and CD3ε.Based on the present disclosure, skilled persons can obtain such Fv’s by employingconventional methods. For example, the desired human epitope can be used as an antigen in mice or rabbits for obtaining antibodies with specific binding to it, andthen screen for cross-reactivity to the canine variant. For example, the desiredcanine epitope can be used as an antigen in mice or rabbits for obtaining antibodies with specific binding to it, and then screen for cross-reactivity to the human variant. There are several techniques to generate a single-chain variable fragment (scFv) for antigen recognition: 1) By amplification and cloning of VL and VH antibody sequences: scFv sequences have traditionally been cloned by amplifying the variable light (VL) and variable heavy (VH) antibody sequences of hybridomas. 2) By a Phage Display approach: For phage display, a pooled library of scFv’s is displayed on the coats of bacteriophages and screening for antigen binding. 3) Recombinant scFv format (mouse, Rabbit): This involves generating a recombinant scFv format for a specific monoclonal antibody (mAb). However, the first targeting unit does not necessarily have to comprise an Fv. One example of a targeting unit in the form of a peptide ligand for human CD3ε isdisclosed by Ahmadi et al J Mater Chem B, 2021 Feb 14;9(6):1661-1675. doi:10.1039 / d0tb02235g. Epub 2021 Jan 22. Such peptide ligands which specificallybinds, under physiological conditions, to an epitope located on the extracellular partof a canine CD3-chain can also be obtained by conventional methods.Non-scFv based targeting units can be implemented in BiTEs. For example: 1) Aptamer based BitEs TLS11a Aptamer / CD3 Antibody Anti-Tumor System for Liver Cancer. DOI: https: / / doi.org / 10.1166 / jbn.2018.2619 2) Single domain antibody-based BiTes ang, Xm., Lin, Xd., Shi, W. et al. Nanobody-based bispecific T-cell engager (Nb-BiTE): a new platform for enhanced T-cell immunotherapy. Sig Transduct Target Ther 8, 328 (2023). https: / / doi.org / 10.1038 / s41392-023-01523-3 3) HLE Bite (to increase half-life of Bites by adding an Fc domain) 4) dAbs VH domain antibody (dAb) Development of single domain agents including: VHH domains, v-NARs, FN3-based binders, human dAbs. 5) CD3 is linked to a receptor, like NKG2D. 6) CD3 is linked to a 14FN3 Based Single Domain Proteins (doi.org / 10.3390 / biomedicines10123184) The second targeting unitThe second targeting unit for specific binding to a second target epitope located onthe target cells will provide binding to said target cells. The second targeting unitmay be a Fv for specific binding to a second target epitope located on the targetcells providing binding to said target cells. The target cells may be any kind of cellwhere close localization of T-cells are desired, e.g. for cytotoxic activity. The target cells may be cancer cells, but the target does not have to be cancer specific. For example, CD19 is used in cancer treatment even though CD19 is also expressedon healthy cells which are expendable. However, choosing a cancer associatedantigen can provide better therapeutic specificity. A true cancer-restricted antigen would of course provide the best therapeutic specificity. Many target epitopes located on the cancer cells are being explored. For example,human epidermal growth factor receptor 2 (HER2), PCMA, CD22, CD19.CD19 and CD20 are targets for treatment of NHL. CD19 is the target for the treatment of acute lymphocytic leukemia. CD123, CD33, CLEC12A, WT1, and FLT3 are targets for treatment of acute myeloid leukemia. BCMA, CD38, and GPRC5D are targets for the treatment of multiple myeloma. EpCAM for solidmalignancies of epithelial origin, CEA for gastrointestinal tract, sweat gland andprostate epithelium, PSMA for prostate cancer.For example, the second Fv may specifically bind, under physiological conditions,to an epitope on ALPL-1 on an osteosarcoma cell, both in human and dogs.Double targeting has been exploited (combi or dual), which can also be exploited in BiTE format.The target epitope can be a secondary modification of a protein such as sugar orphosphorylation. One specific example of a suitable second Fv is represented by the scFv with the SEQ ID NO: 14 derived from the known antibody TP3. Said antibody specifically binds to osteosarcoma cells.Another example is the scFv with the SEQ ID NO: 15 derived from the knownantibody FMC63. The second Fv may have a TCR-like specificity, i.e. it may specifically bind an MHC presenting a specific peptide, in particular an HLA presenting a specific peptide. Methods for obtaining such Fv’s are well known and one example is provided in Yarmarkovich, M., Marshall, Q.F., Warrington, J.M. et al. Targeting of intracellular oncoproteins with peptide-centric CARs. Nature 623, 820–827 (2023). https: / / doi.org / 10.1038 / s41586-023-06706-0. Based on the present disclosure, skilled persons can obtain such Fv’s by employingconventional methods. For example, the desired cancer epitope can be used as anantigen in mice or rabbits for obtaining antibodies with specific binding to it. Thepurified protein or an epitope in this protein (peptide) can be used to pan a phage library and isolate binding sequences. These sequences can be peptidic or scFv, theywill then be used as targeting unit of the BiTE. The bispecific proteins herein can also contain Fv’s for specific binding to othernon-cancerous targets like CD19.Accordingly, provided herein are proteins comprising a first Fv for binding to a firsttarget epitope and a second Fv for binding to a second target epitope, wherein thesecond Fv is cross-reactive with both human and canine homologs of the target protein. Pharmaceutical compositions may comprise the bispecific proteins or nucleic acids disclosed herein. The pharmaceutical compositions can be a composition suitablefor administration of therapeutic proteins or nucleic acids to a patient. The mostcommon administration route for therapeutic proteins is parenteral administration.Accordingly, said pharmaceutical compositions may for example be sterile aqueous solutions with a neutral pH. Accordingly, said pharmaceutical compositions may forexample be sterile and isotonic aqueous solutions with a physiological pH.SEQUENCESSEQ ID NO: 1 represents a polyprotein comprising canine CD3-chains (cCD3ζ-F2A-cCD3ε-T2A-cCD3δ-E2A-cCD3γ) with leader peptides underlined and theribosomal skipping sequences in italic: MWKMLVITALLQAQLPVTGAQSLGLLDPKLCYLLDGVLFIYGVIITALFLRAKFGRSAA APEHQQGPNQLYNELNLRGREEYEVLDKRRGLDPEMGGKQRKRNPQEVVYNALQKDKMA EAYSEIGIKSENQRRRGKGHDGLYQGLSTATKDTYDALHMQALPPRVKQTLNFDLLKLA GDVESNPGPMQSRNLWRILGLCLLSVGAWGQDEDFKASDDLTSISPEKRFKVSISGTEV VVTCPDVFGYDNIKWEKNDNLVEGASNRELSQKEFSEVDDSGYYACYADSIKEKSYLYL RARVCANCIEVNLMAVVTIIVADICLTLGLLLMVYYWSKTRKANAKPVMRGTGAGSRPR GQNKEKPPPVPNPDYEPIRKGQQDLYSGLNQRGIEGRGSLLTCGDVEENPGPMEHCRFL AGLILAVLLSRVSPFKVSVEELEDRVFLSCNTSVLRIEGTMGIQLPHSRTLDLGKRILD PRGIYRCNATEEQSDKAPYMQVYYRMCQNCVELNSATLAGIVIADIIATLLLALGVYCF AGHETGRSSKSADTQILLENDQLYQPLRDRNDAQYSHLGENWPRKKQCTNYALLKLAGD VESNPGPMELGKHLAGLILAVTLLQGATAQKEQGFPMIKVDGNREDGSVLLICDSQSKD IKWFEDGKERTLPKKDKKTLDLGSSMKDPQGIYQCQVAKNISKPLQVYYRMCQNCIELN AGTIIGFVFAEIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLSNDQLYQPLRDRENDQ YGHLQGKRLRKN SEQ ID NO: 2 (The Ribosomal skipping sequence F2A): VKQTLNFDLLKLAGDVESNPGP SEQ ID NO: 3 (The Ribosomal skipping sequence T2A): EGRGSLLTCGDVEENPGP SEQ ID NO: 4 (The Ribosomal skipping sequence E2A): QCTNYALLKLAGDVESNPGPSEQ ID NO: 5 (cCD3_scFv (VH-Linker-VL)) wherein the CDRs are boxed and thelinker is underlined: EVQLQQSGPELVKPGASVKISCKASGYTFSDYNMHWVKQSHGESLEWIGYIYPYNGGTY YNQKFKSKATLTVDNSSSTAYMEFRSLTSEDSAVYYCARLVYFDYWGQGTALTVSSVEG GSGGSGGSGGSGGVDDILLTQSPATLSVTPGETVSLSCRASQSIFKNLHWYQQKSHRSP RLLIKYASDSISGIPSRFTGSGSGTDYTLSINSVKPEDEGVYYCLQAYSTPWTFGGGTK LEIKSEQ ID NO: 6 (cCD3_scFv(VL-linker-VH)) wherein the CDRs are boxed and thelinker is underlined: SEQ ID NO: 7 (VH CDR1):GYTFSDYNMSEQ ID NO: 8 (VH CDR2):IYPYNGGTSEQ ID NO: 9 (VH CDR3):ARLVYFDYSEQ ID NO 10 (VL CDR1):QSIFKNSEQ ID NO 11 (VL CDR2):YASSEQ ID NO 12 (VL CDR3):LQAYSTPWTSEQ ID NO: 13 Linker:VEGGSGGSGGSGGSGGVDSEQ ID NO: 14 TP3 scFv (VL-linker-VH) wherein the CDRs are boxed and theleader peptide is underlined, and the linker is in italic:METDTLLLWVLLLWVPGSTGDIVLTQSPASLAVSLGQRATISCRASKSVSTGYSYLH WYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHS RELPLTFGAGTKLELKRGGGGSGGGGSGGGGSGGGGSEVQLQQSGAELVKPGASVKI SCKASGYTFTDYNMDWVKQSHGKSLEWIGDINPNYDSTRYNQKFKGKATLTVDKSSS TAYMELRSLTSEDTAVYYCARGDYYVSSYGHDYAMDYWGQGTSVTVSSDSEQ ID NO: 15 CD19-fmc63 scFv wherein the CDRs are boxed and the leaderpeptide is underlined, and the linker is in italic:METDTLLLWVLLLWVPGSTGDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQ QKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTL PYTFGGGTKLEITKAGGGGSGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTC SEQ ID NO: 16 BiTE 2061 with N-terminal leader peptide and C-terminal His-tagMETDTLLLWVLLLWVPGSTGDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQ QKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTL PYTFGGGTKLEITKAGGGGSGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTC TVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVF LKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSSDPGGGGSEVQLQQSGP ELVKPGASVKISCKASGYTFSDYNMHWVKQSHGESLEWIGYIYPYNGGTYYNQKFKS KATLTVDNSSSTAYMEFRSLTSEDSAVYYCARLVYFDYWGQGTALTVSSVEGGSGGS GGSGGSGGVDDILLTQSPATLSVTPGETVSLSCRASQSIFKNLHWYQQKSHRSPRLL IKYASDSISGIPSRFTGSGSGTDYTLSINSVKPEDEGVYYCLQAYSTPWTFGGGTKL EIKHHHHHHSEQ ID NO: 17 BiTE 2062 with N-terminal leader peptide and C-terminal His-tag METDTLLLWVLLLWVPGSTGDIVLTQSPASLAVSLGQRATISCRASKSVSTGYSYLH WYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHS RELPLTFGAGTKLELKRGGGGSGGGGSGGGGSGGGGSEVQLQQSGAELVKPGASVKI SCKASGYTFTDYNMDWVKQSHGKSLEWIGDINPNYDSTRYNQKFKGKATLTVDKSSS TAYMELRSLTSEDTAVYYCARGDYYVSSYGHDYAMDYWGQGTSVTVSSDPGGGGSEV QLQQSGPELVKPGASVKISCKASGYTFSDYNMHWVKQSHGESLEWIGYIYPYNGGTY YNQKFKSKATLTVDNSSSTAYMEFRSLTSEDSAVYYCARLVYFDYWGQGTALTVSSV EGGSGGSGGSGGSGGVDDILLTQSPATLSVTPGETVSLSCRASQSIFKNLHWYQQKS HRSPRLLIKYASDSISGIPSRFTGSGSGTDYTLSINSVKPEDEGVYYCLQAYSTPWT FGGGTKLEIKHHHHHHSEQ ID NO: 18 BiTE 2063 with N-terminal leader peptide and C-terminal His-tagMETDTLLLWVLLLWVPGSTGDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQ QKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTL PYTFGGGTKLEITKAGGGGSGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTC TVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVF LKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSSDPGGGGSDILLTQSPA TLSVTPGETVSLSCRASQSIFKNLHWYQQKSHRSPRLLIKYASDSISGIPSRFTGSG SGTDYTLSINSVKPEDEGVYYCLQAYSTPWTFGGGTKLEIKVEGGSGGSGGSGGSGG VDEVQLQQSGPELVKPGASVKISCKASGYTFSDYNMHWVKQSHGESLEWIGYIYPYN GGTYYNQKFKSKATLTVDNSSSTAYMEFRSLTSEDSAVYYCARLVYFDYWGQGTALT VSSHHHHHHSEQ ID NO: 19 BiTE 2064 with N-terminal leader peptide and C-terminal His-tagMETDTLLLWVLLLWVPGSTGDIVLTQSPASLAVSLGQRATISCRASKSVSTGYSYLH WYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHS RELPLTFGAGTKLELKRGGGGSGGGGSGGGGSGGGGSEVQLQQSGAELVKPGASVKI SCKASGYTFTDYNMDWVKQSHGKSLEWIGDINPNYDSTRYNQKFKGKATLTVDKSSS TAYMELRSLTSEDTAVYYCARGDYYVSSYGHDYAMDYWGQGTSVTVSSDPGGGGSDI LLTQSPATLSVTPGETVSLSCRASQSIFKNLHWYQQKSHRSPRLLIKYASDSISGIP SRFTGSGSGTDYTLSINSVKPEDEGVYYCLQAYSTPWTFGGGTKLEIKVEGGSGGSG GSGGSGGVDEVQLQQSGPELVKPGASVKISCKASGYTFSDYNMHWVKQSHGESLEWI GYIYPYNGGTYYNQKFKSKATLTVDNSSSTAYMEFRSLTSEDSAVYYCARLVYFDYW GQGTALTVSSHHHHHH EXAMPLES Material and methodsProduction of bispecificT-cell engager (BiTEs).HEK293T cells (ATCC) were seeded at 1.2x106cells per 60 mm plate in 3 mLDMEM (D5671, Sigma-Aldrich) supplemented with 10% FBS (Sigma-Aldrich) and1% L-Glut (Sigma-Aldrich). After 24 hrs., cells were added a transfection mix. Thetransfection mix was prepared by mixing 300 ^L OptiMEM (Gibco, ThermoFisher Scientific), 9 ^L X-tremeGENE9 DNA Transfection Reagent (Roche, Merck) and 3.0 ^g expression vector (SW2061 or SW2062) and incubating it for 15 min. The HEK293T cells were incubated O / N at 37^C and 5% CO2 before the medium was changed to fresh IMDM (Cytiva) supplemented with 1% L-glut and 1% HI HyClone FBS (Cytiva). The cells were further incubated for 48 hrs at 32 ^C 5% CO2 beforethe supernatant containing BiTEs was harvested by centrifuging at 500 X g for 5minto remove packaging cells. Supernatant form untransformed HEK293T cells treatedthe same way as the transformed HEK293T cells was collected as a control, termed“noBiTE”. The supernatants were stored at 4 ^C until use (within 2 weeks).Verification of BiTE production by flow cytometry.BiTE production was verified by flow cytometry. Target cells were washed inPhosphate buffer saline (PBS) and centrifuged at 300 X g for 5min. 1x 106 targetcells were resuspended with 60 ^L BiTE supernatant, noBiTE supernatant or flowbuffer (PBS supplemented with 0.5% BSA and 0.1% sodium azide) (unstainedcontrol), transferred to FACS tubes and then incubated for 30 min at RT. Five mLflow buffer was added to all samples, and the cells were spun down at 300 X g for 5 min. The cells were then resuspended in 90 ^L flow buffer, added 10 ^L hFc Block (Miltenyi Biotec) and incubated for 10 min at RT. 0.5 ^L anti-His-Tag Ab-Alexa 647 (R&D systems, clone#AD1.1.10R) or flow buffer (unstained control) were directly added to the cells. After 30 min incubation at RT, protected from light, the cells were washed twice with flow buffer and centrifuged at 300 X g for 5 min. The cells were resuspended in 300 ^L PBS and acquired on Accuri C6 (BD Biosciences).CanineT-cell (cTc) isolation and activation.The canine blood collection received ethical approval by the Norwegian Food Safety Authority (FOTS 20944), according to the national regulation for use ofanimals in research. Peripheral blood mononuclear cell (PBMC) was collected fromhealthy dogs in 6ml Heparin tubes and processed as soon as possible. The blood was kept at room temperature and under constant agitation in the meantime. CaninePBMC´s were isolated by gradient centrifugation using Lymphoprep ™ (AlereTechnologies AS). The PBMC´s were washed twice in PBS and resuspended in T- cell medium (TCM), consisting of HyClone IMDM supplemented with 25 mMHEPES (Cytiva), 10% HI HyClone FBS (Cytiva), 1% Glutamax (ThermoFisher),1% MEM non-essential amino acid solution (Sigma), 1% Sodium Pyruvate (Sigma Aldrich) and 1% Pen / Strep. The PBMC´s were counted, then centrifuged at 500 X g for 10 min, and the amount of TCM, antibodies and FcR blocking reagent neededfor the negativeT-cell selection were calculated (listed in table 1, below).Table 1: Antibodies and reagent volumes for canine T-cell isolation by MACS negative selection Primary antibodies (mAb) AmountMouse anti-dog CD11b, clone CA16.3E10 (Invitrogen) 1 µg / 1x 107 cellsMouse anti-dog CD11c, clone CA11.6A1 (Invitrogen) 1 µg / 1x 107 cellsMouse anti-dog CD21, clone CA2.1D6 (Invitrogen) 1 µg / 1x 107 cellsMouse anti-human CD14, clone TuK4 (Invitrogen) 1 µg / 1x 107 cellsDog gamma globulins (Jackson Immunology) 10 µL / 1x 107 cellsTCM (90 µL / 1x 107 cells) – mAb volumeTotal volume 100 µL / 1x 107 cellsFrom this step, the work was done on ice and the solutions kept cold. The PBMC´s were resuspended in TCM and the required amount of dog gamma-globulins were added. The cells were mixed gently and incubated for 10-15 min at RT. Then the primary antibodies were added, the cells gently mixed and incubated for 30 min at 4 ^C. The cells were then washed and centrifuged at 500 X g for 10 min, twice. The cell pellet was resuspended in 80 ^L TCM per 107total cells and 20 ^L of anti- Mouse IgG MicroBeads (Miltenyi Biotec) was added per 107cells. The cells weremixed well and incubated for 15 min at 4 ^C before washing them twice in TCM using up to 50 mL. The cell pellet was resuspended in TCM at 1x108cells / 500 mL and then applied to a LS Column (Miltenyi Biotec) according to the manufacturers protocol. A pre-selection sample and the antibody-bound fraction were alsocollected to assess theT-cell purity by flow cytometry.Verification ofT-cell purity by flow cytometry.Cells were counted and centrifuged at 300 X g for 5 minutes. The samples were resuspended in staining buffer (FACS), before adding 10uL canine FC block (Invitrogen), and incubating for 10 mins at RT. The antibody master-mix was added as specified in table 2 below, and samples were incubated for 30min at 4°C. Cells were washed twicewith the staining buffer and centrifuged at 300 X g for 5 minutes, then re-suspended inPBS and acquired on the BD LSR Fortessa cytometer.Table 2: Antibodies used for flow cytometry evaluation of T-cell purity.mAb (clone) Channel Concentration Volume uLBFortessa Pr.Total sample CD3e-FITC (CA17.2A12) 488 laser, filter 530 / 30 1:10 10 120CD5-PE (YKIX322.3) * 561 laser, filter 582 / 15 1:50 2 24CD4-SB645 (tandem, 407) 407 laser, filter 660 / 20 1:10 10 120CD8-APC * 640 laser, filter 670 / 14 1:25 4 48CD25-SB600 (tandem, 407) 407 laser, filter 610 / 20 1:50 2 24Total 40uL pr sample x / 12 480uL / 144 PBSActivation of T cells.The T-cells were activated by adding Dynabeads (M-450, Invitrogen) coated withcanine anti-CD3, clone CA17.2A12 and canine anti-CD28, clone 1C6 (manufactured as described in Rotolo et al, doi.org / 10.1016 / j.xpro.2021.100905), at a ratio of 1:2. In addition, 10uL of canine specific IL-2 (100mg / uL, Cys147Ser, BioTechne) was added. The T-cells were seeded at a density of 1–2 x 106cell / mL in 6-well plates (ThermoScientific), and expanded twice, before being frozen as described below.T-cells were counted, centrifuged at 300 X g, 5min and then resuspended in freeze medium (FBS (Sigma-Aldrich) with 10% DMSO (Sigma- Aldrich) or Cryostor-CS10 (Sigma-Aldrich), to a final concentration of 5x106cells per 1 mL. Cryovials were placed in a freezing device (Naglene, Sigma-Aldrich) O / Nat -80 ^C. For short-term storage, the canineT-cells (cTcs) were kept at -80 ^C. Bioluminescence killing assay. The osteosarcoma cell line OSA 787luc+was seeded in triplicate at 8000 cells / wellin a black walled 96 well plate (Corning Incorporated). The mantle cell lymphomacell line JeKo-1luc+was also seeded in triplicate at 30,000 cells / well in a round bottom 96 well plate (Greiner).100 ^L RPMI 1640 (Sigma-Aldrich) supplementedwith 10% FBS (Sigma-Aldrich) and 1% L-Glut (Sigma-Aldrich) was added to eachwell. OSA 787luc+ was seeded 24 hrs before adding cTcs, whilst JeKo-1luc+ wasseeded 2 hrs prior to adding of cTc. The cTcs were thawed by gently warming the cryotube for 1 min in a 37 ^C water bath, then the content was resuspended in 10mL tissue culture medium (TCM) and centrifuged at 300 X g for 5 min to removeDMSO. The cTcs were counted and allowed to recover at a concentration of 0.5x106cells / mL in TCM for 2 hrs at 37 ^C prior to adding them to target cells. The cTcs were added in 90 ^L TCM per well. In wells with no cTc, 90 ^L TCM was added. For the wells containing only cTcs, 100 ^L supplemented RPMI was added.Treatment was added, in triplicate, with BiTE supernatant, noBiTE supernatant, 1%Triton X-100 (CAS-No: 9036-19-5, Sigma-Aldrich) or supplemented RPMI,directly after the adding of cTcs. All wells, where needed, were supplemented withRPMI to reach a final volume of 200 ^L. The target cells mixed with cTcs andtreatment, was then incubated for 24 hrs. After incubation, luciferin was added at aconcentration of 2.5 mg / mL per well, incubated for 10 min protected from light, andthen imaged using the IVIS Spectrum Series Imager (PerkinElmer Inc, Waltham,MA, USA). Quantification using photons per second (p / s) was performed with theLive Image® Software (PerkinElmer Inc), and the percentage specific killing wascalculated using the following equation: ^^^^^^^^^^^ ^^^^ ^^^^ℎ − ^^^^^^% ^^^^^^^^ ^^^^^^^ = 100 ×^^^^^^^^^^^ ^^^^ ^^^^ℎ − ^^^^^^^ ^^^^^^^Spontaneous cell death is p / s from target cells only, sample is p / s from the sample where the specific killing is unknown, maximal killing is the p / s from the 1% Triton X-100 treated sample. CD3 experiment We cloned different units of the canine CD3 (cCD3) isoforms to test the minimalcCD3 requirement to accommodate TCRs. We monitored human CD3ε expressionat the surface of NK-92 cells.We compared three constructs: cCD3 full which comprises of all the CD3 units(ε,γ,δ, ζ,), cCD3 ε,γ,δ (with 3 CD3 subunits) and CD3ε with the ε subunit only. Theresults are presented in Figure 15D.
Claims
CLAIMS1. A human cell expressing a T-cell receptor (TCR) and at least two differentcanine CD3-chains in its cell membrane.
2. A human cell according to claim 1, wherein the TCR comprises a human Vαand a human Vβ, or a human α-chain and a human β-chain.
3. A human cell according to claims 1 or 2, wherein the at least two differentcanine CD3-chains are selected from the group consisting of CD3ζ, CD3γ, CD3δ and CD3ε.
4. A human cell according to any one of claims 1 to 3, wherein the cellexpresses canine CD3ε and canine CD3γ, or wherein the cell expresses canine CD3ε and canine CD3δ, or wherein the cell expresses canine CD3ε and canine CD3ζ, or wherein the cell expresses canine CD3ε, canine CD3γ and canine CD3δ.
5. A human cell according to any one of claims 1 to 4, wherein the cellexpresses canine CD3ζ, canine CD3γ, canine CD3δ and canine CD3ε, which together with the TCR forms a functional TCR-complex in the cell membrane.
6. A human cell according to any one of claims 1 to 5, wherein the cell is a T-cell or a Natural killer-cell.
7. A human cell according to any one of claims 1 to 6, wherein the cell is acytotoxic T-cell.
8. A human cell according to any one of claims 1 to 7, transduced with anucleic acid encoding the polyprotein represented by SEQ ID NO: 1.
9. A human cell-line comprising cells according to any one of claims 1 to 8.
10. A human cell-line according to claim 9, wherein the cell-line is derived fromJurkat or NK92.
11. A recombinant nucleic acid encoding canine CD3ε and at least one canineCD3-chain selected from the group consisting of CD3γ and CD3δ.
12. A recombinant nucleic acid according to claim 11, encoding canine CD3ζ,canine CD3γ, canine CD3δ and canine CD3ε, or encoding canine CD3γ, canine CD3δ and canine CD3ε13. A recombinant nucleic acid according to claims 11 or 12, encoding at leastone ribosomal skipping sequence between two CD3-chains.
14. A recombinant nucleic acid according to any one of claims 11 to 13,encoding a ribosomal skipping sequences between each of the CD3-chains.
15. A recombinant nucleic acid according to any one of claims 11 to 14,encoding a polyprotein represented by SEQ ID NO: 1, or nucleic acids encodingpolyproteins with more than 75% sequence identity thereto.
16. A protein comprising a first and a second Fv for binding to a first and asecond target epitope, wherein each Fv comprises a VL and a VH, and the VL comprises three CDRs flanked by framework sequences, and the VH comprises three CDRs flanked by framework sequences, wherein the first Fv specifically binds, under physiological conditions, to an epitope located on the extracellular part of a canine CD3-chain, and wherein the second Fv specifically binds, under physiological conditions, to an epitope located on canineor human target cells.
17. A protein according to claim 16, wherein the first Fv also specifically binds,under physiological conditions, to an epitope located on the extracellular part of a human CD3-chain.
18. A protein according to claims 16 or 17, wherein the first and second Fv’s arescFv’s.
19. A protein according to claim 18, wherein the first and second scFv’s areconnected to each other by a linker.
20. A protein according to claim 18, wherein the linker is a glycine-serine linkercomprising 5 to 50 amino acid residues.
21. A protein according to any one of claims 16 to 20, wherein the first Fvspecifically binds, under physiological conditions, to the extracellular part of both human and canine CD3ε.
22. A protein according to any one of claims 16 to 21, wherein the second Fvspecifically binds, under physiological conditions, to an epitope on a Tumor Associated Antigen located on a cancer cell.
23. A protein according to any one of claims 16 to 22, wherein the second Fvspecifically binds, under physiological conditions, to an epitope on Tumor Associated Antigens located on both human and canine cancer cells.
24. A protein according to any one of claims 16 to 23, wherein the first Fvcomprises,a VL with the following three CDRs; SEQ ID NO: 10 (CDR1), SEQ ID NO: 11(CDR2) and SEQ ID NO: 12 (CDR3), anda VH with the following three CDRs; SEQ ID NO: 7 (CDR1), SEQ ID NO: 8(CDR2) and SEQ ID NO: 9 (CDR3).
25. A protein according to any one of claims 16 to 24, wherein the second Fv isa scFv represented by SEQ ID NO: 14 or 15.
26. A protein according to any one of claims 16 to 25, wherein the second Fvspecifically binds, under physiological conditions, to an epitope on ALPL-1 on anosteosarcoma cell.
27. A protein according to any one of claims 16 to 26, wherein the frameworksequences in the first Fv are human, murine or canine.
28. A protein according to any one of claims 16 to 27, wherein the frameworksequences in the second Fv are human, murine or canine.
29. A recombinant nucleic acid encoding the protein according to any one ofclaims 16 to 28.
30. A recombinant nucleic acid according to claim 27, wherein the nucleic acidis in the form of linear or circular cDNA, mRNA or a circular DNA expression vector.
31. Use of the cells according to any one of claims 1 to 10 for in vitro testing ofimmunotherapeutic candidate compounds for dogs.
32. An in vitro method for testing immunotherapeutic candidate proteins fordogs, comprising the steps;a) providing a cell population comprising human cells according to any one ofclaims 1 to 10 in a suitable medium,b) incubating the human cell population in step a) with an immunotherapeuticcandidate protein according to any one of claims 16 to 28, as well as incubating the human cell population in step a) with canine cancer target cells, and thenc) measuring the canine cancer cell mortality, viability or proliferation.
Citation Information
Patent Citations
Deposition Apparatus
KR1020250020045A
Anti-canine CD16 polypeptides, Anti-canine CD64 polypeptides, compositions including same, and methods of using
US20230227561A1