Composition comprising a peptide having an isoelectric point of less than 6.5 and a co-polyamino acid bearing carboxylate charges and hydrophobic radicals

A co-polyamino acid and hydrophobic radical formulation at pH 5.0 to 6.0 stabilizes GLP-1 receptor agonists, addressing solubility and stability issues, enabling multi-use compositions that meet pharmacopeia standards and enhance efficacy.

WO2025172605A1PCT designated stage Publication Date: 2025-08-21ADOCIA
View PDF 19 Cites 0 Cited by

Patent Information

Application Number
PCT/EP2025/054175
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-10-07
Filing Date
2025-02-17
Publication Date
2025-08-21

AI Technical Summary

Technical Problem

Existing formulations of GLP-1 receptor agonists and other APIs with low isoelectric points struggle with stability and solubility at pH levels above 6, necessitating high cyclodextrin concentrations and failing to meet stability and solubility requirements for multi-use compositions.

Method used

A composition comprising a GLP-1 receptor agonist with an isoelectric point less than 6.5, co-formulated with a co-polyamino acid bearing carboxylate charges and hydrophobic radicals, at a pH of 5.0 to 6.0, which enhances stability and solubility, allowing for multi-use applications.

Benefits of technology

The composition achieves improved stability and solubility of GLP-1 receptor agonists, enabling multi-use formulations that meet pharmacopeia standards and reduce undesirable side-effects, while maintaining efficacy and duration of action.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure IMGF000005_0001
    Figure IMGF000005_0001
  • Figure IMGF000005_0002
    Figure IMGF000005_0002
  • Figure IMGF000005_0003
    Figure IMGF000005_0003
Patent Text Reader

Abstract

The invention relates to a composition comprising a peptide 1, which is an API (Active Pharmaceutical Ingredient, in particular a GLP-receptor agonist (GLP-1 RA), having an isoelectric point (pI1) of less than 6.5 and a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals, said composition being in the form of an aqueous injectable solution at pH between 5.0 to 6.0.
Need to check novelty before this filing date? Find Prior Art

Description

COMPOSITION COMPRISING A PEPTIDE HAVING AN ISOELECTRIC POINT OF LESS THAN 6.5 AND A CO-POLYAMINO ACID BEARING CARBOXYLATE CHARGES AND HYDROPHOBIC RADICALS

[0001] The invention relates to a composition comprising a peptide 1, which is an API (Active Pharmaceutical Ingredient, in particular a GLP-receptor agonist (GLP-1 RA), having an isoelectric point (pI1) of less than 6.5 and a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals, said composition being in the form of an aqueous injectable solution at pH between 5.0 to 6.0.

[0002] It also concerns a composition comprising a first peptide, peptide 1, which is an API, in particular a GLP-1 RA, having pI1of less than 6.5, another peptide, peptide 2, which is an API, and a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicalssaid composition being in the form of an aqueous injectable solution at pH between 5.0 to 6.0.

[0003] This peptide 2 may have an isoelectric point pI2 which is superior or equal to pI1 + 2 (pI2 ≥ pI1 + 2).

[0004] This peptide 2 may have an isoelectric point pI2 ranging from 6 to 12.

[0005] This composition may be used as a medicament, in particular for the treatment of overweight or obesity, diabetes, cardio-vascular disease(s), non-alcoholic steatohepatitis (NASH), and / or cognitive impairment, such as caused by Alzheimer Disease (AD). Diabetes, overweight and obesity could be with or without one or more associated comorbidities.

[0006] Formulating a peptide which is an API, in particular a GLP-1 RA, having a pI of less than 6.5 in solution at a pH of between 5.0 to 6.0 is very useful for associating it to other APIs, in particular peptides, which are not sufficiently soluble or stable at a pH outside of this range, in particular at a pH above 6.

[0007] For example, co-formulating semaglutide (pI1 = 4.37), and cagrilintide (pI2 = 8.56) was not considered possible, due to different physicochemical properties of these active pharmaceutical ingredients (APIs).

[0008] The WO2023 / 187067 and WO2023 / 110833 applications from Novo Nordisk proposes a solution to co-formulate said APIs by using a cyclodextrin comprising hydroxypropyl substitution.

[0009] The compositions of WO2023 / 187067 and WO2023 / 110833 prior arts need high concentration of cyclodextrins to solubilize semaglutide. Furthermore, compositions of the prior art are not sufficiently stable, in particular regarding the level of impurities.

[0010] A goal of the invention is to allow an improved stability of a peptide which is an API having a pI of less than 6.5, such as a GLP-1 RA, in particular a peptide chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550, and dapiglutide, and more particularly from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, and dapiglutide, even more particularly semaglutide, at pH between 5.0 and 6.0.

[0011] Therefore, there is a need to find a solution for obtaining stable compositions comprising a peptide which is an API having a pI of less than 6.5 in solution at a pH of between 5.0 and 6.0, in particular to enable associations with other APIs which are not, or at least not sufficiently, soluble or stable at pH outside of this range, especially at a pH above 6.

[0012] Specifically, one of the goals of the present invention is to enhance the chemical stability of an amylin RA, such as cagrilintide, while having a good stability of a GLP-1 RA having a pI of less than 6.5, such as semaglutide.

[0013] In the prior art, the way for obtaining a solution comprising a combination of semaglutide and cagrilintide needs the use of large quantities of excipients (namely cyclodextrins). Thus, a further problem to be solved is to improve the stability and / or solubility with a smaller amount of excipients allowing the combination to be done. This is particularly true when it comes to chronic treatments.

[0014] Among problems to be solved with peptides as APIs can be cited improving their efficacy, their duration of action (t half-life), in particular for those having a long half-life, and decreasing their undesirable side-effect(s).

[0015] Another problem to be solved is to be able to obtain a solution which comprises preservatives, in particular such as phenol or m-cresol, with a limited amount of excipients. This presence of preservatives, in particular such as phenol or m-cresol, in the composition allows to have a composition which can be used several times, ie a multi-use composition. Another way to define this problem is to have a composition which is able to pass the challenge test according to both European and American pharmacopeia, respectively EP 11thedition chapter 5.1.3 and USP 43 chapter <51>, in particular to allow the composition to be conform with criteria A of EP.

[0016] This property is very important as it allows such a composition to be used multiple, several, times. For example, this composition could be comprised in a device allowing multiple subcutaneous injections, as opposed to devices which are single use, ie devices which can be used only one time.

[0017] More precisely this allows the composition to be used in a multiple dose injection device or vial allowing protection against anti-microbial contamination.

[0018] Among the problems to be solved can also be cited the improvement of local tolerance and comfort upon injection.

[0019] Therefore, there is a need to find a solution for solving at least in part the problems cited above.

[0020] Surprisingly, the applicant has found that a composition, in the form of an aqueous injectable solution, comprising a co-polyamino acids bearing carboxylate charges and hydrophobic radicals and a peptide, which is a GLP-1 RA, in particular a peptide chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide, more particularly a peptide chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide and even more particularly semaglutide, having an isoelectic point of less than 6.5 at a pH of between 5.0 and 6.0 allows to solve at least in part the above cited problems.

[0021] The applicant has also found that a composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising a peptide 1, which is a GLP-1 RA, in particular a peptide chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide, more particularly a peptide chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide and even more particularly tirzepatide and semaglutide, having an isoelectic point, pI1, of less than 6.5, and a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals allows to solve at least in part the above cited problems.

[0022] The invention relates to a composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising:- a peptide 1, which is a GLP-1 receptor agonist, having an isoelectic point, pI1, of less than 6.5, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy, said co-polyamino acid consisting of glutamic or aspartic units, and said hydrophobic radicals Hy being according to formula X below:Formula X in which - GpR is chosen from the radicals according to formulas VII, VII’ or VII’:identicalordifferentGpGand GpHare chosen from the radicals according to formulas XI or XI’: Formula XI Formula XI’ - GpA is chosen from the radicals according to formula VIII:Formula VIII o in which A’ is chosen from the radicals according to formula VIII’, VIII’’ or VIII’’’:Formula VIII’ Formula VIII’’ Formula VIII’’’ - GpL is chosen from the radicals according to formula XII:Formula XII, - GpC is a radical according to formula IX:the * indicates the attachment sites of the different groups bonded by the amide functions; - a is an integer equal to 0 or to 1 and a’ = 1 if a = 0 and a’ = 1, 2 or 3 if a = 1; - a’ is an integer equal to 1, to 2, or to 3 - b is an integer equal to 0 or to 1; - c is an integer equal to 0 or to 1, and if c is equal to 0, then d is equal to 1 or to 2; - d is an integer equal to 0, to 1, or to 2; - e is an integer equal to 0 or to 1; - g is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6; - h is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6; - l is an integer equal to 0 or 1 and l’ = 1 if l = 0, and l’ = 2 if l = 1; - r is an integer equal to 0, to 1, or to 2, and - s’ is an integer equal to 0 or 1, and - if e is different from 0, then at least one of g, h or l is different from 0; - A, A1, A2 and A3, identical or different, are linear or branched alkyl radicals, and / or substituted by a radical derived from a saturated, unsaturated or aromatic ring, comprising 1 to 8 carbon atoms, - B is a linear or branched alkyl radical and / or comprising an aromatic nucleus, comprising 1 to 9 carbon atoms or an unsubstituted ether or polyether radical comprising from 4 to 14 carbon atoms and from 1 to 5 oxygen atoms; - Cx is a linear or branched monovalent alkyl radical, and / or comprising a cyclic part, in which x indicates the number of carbon atoms and: o when the hydrophobic radical -Hy carries 1 -GpC, then 9 ≤ x ≤ 25 o when the hydrophobic radical -Hy carries 2 -GpC, then 9 ≤ x ≤ 15, o when the hydrophobic radical -Hy carries 3 -GpC, then 7 ≤ x ≤ 13,o when the hydrophobic radical -Hy carries 4 -GpC, then 7 ≤ x ≤ 11, o when the hydrophobic radical -Hy carries at least 5 -GpC, then 6 ≤ x ≤ 11, - G is a branched alkyl radical of 1 to 8 carbon atoms, with said alkyl radical bearing one or more free carboxylic acid functions, - R is a radical chosen from the group consisting of a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms, a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms bearing one or more -CONH2 functions, or an unsubstituted ether or polyether radical comprising from 4 to 14 carbon atoms and 1 to 5 oxygen atoms: - the hydrophobic radical(s) -Hy according to formula X being bonded to the PLG: o via a covalent bond between a carbonyl of the hydrophobic radical -Hy and a nitrogen atom borne by the PLG, thus forming an amide function derived from the reaction of an amine function borne by the PLG and an acid function borne by the precursor -Hy’ of the hydrophobic radica -Hy, or o via a covalent bond between a nitrogen atom of the hydrophobic radical -Hy and a carbonyl borne by the PLG, thus forming an amide function derived from the reaction of an amine function of the precursor -Hy’ of the hydrophobic -Hy radical and an acid function borne by the PLG, - the ratio M between the number of hydrophobic radicals and the number of glutamic or aspartic units being from 0 < M ≤ 0.5; - when several hydrophobic radicals are borne by a co-polyamino acid, then they are identical or different, - the degree of polymerization DP in glutamic or aspartic units for PLG chains is comprised from 5 to 250; - free carboxylic acid functions being in the form of an alkali metal salt chosen from the group consisting of Na+and K+.

[0023] The invention also relates to a composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - a peptide chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, dapiglutide, AZD 9550, in particular from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide,mazdutide, retatrutide, dapiglutide, more particularly semaglutide, as peptide 1, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy.

[0024] The invention also relates to a composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - a peptide 1, which is a GLP-1 receptor agonist, having an isoelectic point, pI1, of less than 6.5, - a peptide 2, which is an API, in particular having an isoelectric point, pI2, which is superior or equal to pI1 + 2 (pI1 + 2 ≤ pI2) or ranging from 6 to 12, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy.

[0025] The invention also relates to a composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - a peptide chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, dapiglutide, AZD 9550 in particular from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, dapiglutide, more particularly semaglutide, as peptide 1, - a peptide 2, which is an API, in particular having an isoelectric point, pI2, which is superior or equal to pI1 + 2 (pI1 + 2 ≤ pI2) or ranging from 6 to 12, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy.

[0026] The invention also relates to a composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - a GLP-1 RA as peptide 1, - an amylin receptor agonist, also called amylin RA, as peptide 2, in particular having an isoelectric point, pI2, which is superior or equal to pI1 + 2 (pI1 + 2 ≤ pI2) or ranging from 6 to 12, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy.

[0027] The invention also relates to a composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - a peptide chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide, in particular from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, dapiglutide, more particularly semaglutide, as peptide 1, - an amylin receptor agonist, also called amylin RA, as peptide 2, in particular having an isoelectric point, pI2, which is superior or equal to pI1 + 2 (pI1 + 2 ≤ pI2) or ranging from 6 to 12, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy.

[0028] The amylin RA can be chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly), in particular cagrilintide.

[0029] The invention also relates to a composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - a GLP-1 RA as peptide 1, in particular chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, dapiglutide, AZD 9550, more particularly from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide, - a peptide 2 chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly), in particular cagrilintide, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy.

[0030] The invention also relates to a composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - semaglutide as peptide 1, - cagrilintide as peptide 2, and- a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy.

[0031] The invention also concerns compositions for use as a medicament.

[0032] The invention also concerns compositions for use in a method of treatment of overweight or obesity, diabetes, cardio-vascular disease(s), non-alcoholic steatohepatitis (NASH), and / or cognitive impairment, such as caused by Alzheimer Disease (AD). Diabetes, overweight and obesity could be with or without one or more associated comorbidities.

[0033] The invention also concerns a method of treatment of overweight or obesity, diabetes, cardio-vascular disease(s), non-alcoholic steatohepatitis (NASH), and / or cognitive impairment, such as caused by Alzheimer Disease (AD). Diabetes, overweight and obesity could be with or without one or more associated comorbidities comprising the step consisting of administering a composition according to the invention.The invention also concerns an injection device, in particular allowing multiple use, comprising a composition according to the invention.

[0034] The invention also concerns a container, such as a vial or a cartridge, in particular allowing multiple use, comprising a composition according to the invention.

[0035] The invention also concerns a method for the preparation of a stable, injectable aqueous solutions of peptide 1 comprising the step of mixing a co-polyamino acid with the peptide 1. DEFINITIONS

[0036] By “physically stable composition” is meant compositions that meet the visual inspection criteria described in European, American and international pharmacopoeia, that is, compositions that are clear and that do not contain visible particles and are also colorless.

[0037] The “chemical stability” can be evaluated by RP-HPLC or RP-UPLC for estimating peptide purity and SEC-HPLC for estimating high molecular weight products (HMWP).

[0038] By “injectable aqueous solution” is meant solutions for which the solvent is water and which meets the pharmacopoeia conditions of Europe and the US.

[0039] Compositions in the form of an injectable aqueous solution according to the invention are clear solutions. By “clear solution” is meant compositions that meet the criteria described in American and European pharmacopoeia (USP and EP) regardinginjectable solutions. In US pharmacopoeia, solutions are defined in part <1151>, referring to injection <1> (referring to <788> according to USP 35 and specified in <788> according to USP 35 and in <787>, <788> and <790> USP 38 (beginning on August 1st, 2014), according to USP 38). In European pharmacopoeia, injectable solutions must meet the criteria provided in sections 2.9.19 and 2.9.20.

[0040] By “co-polyamino acid being constituted of glutamic or aspartic units” is meant linear, non-cyclic units of glutamic or aspartic acids bonded to each other by peptidic bonds, said chains presenting a C-terminal part, corresponding to carboxylic acid at one end, and an N-terminal part, corresponding to amine at the other end of the chain. The N-terminal part and the C-terminal part may be substituted, in particular as defined in Formulae XXXa, XXXa’, XXXb, XXXb’, A-XXX and A-XXXI.

[0041] By “peptide” is meant short chains of amino acids linked by peptide bonds. In the instant specification peptides may have a molecular weight of less than 10000 Da.

[0042] Herein, specific values given in relation to numbers or intervals may be construed as being the specific value or as being the approximate value (such as plus or minus 10, 15 or 20 percent of the specific value, when amounts can be provided by weight; such as plus or minus 0.2, when pH is measured.

[0043] In the following, and without other indication, the limits of a value range are included within this range, particularly in the expressions "between" and "ranging from … to …". Co-polyamino acid

[0044] Said co-polyamino acid bearing carboxylate charges and hydrophobic -Hy radicals is soluble in an aqueous solution of pH between 5.0 and 6.0, at a temperature of 25 °C and at a concentration of 50 mg / ml.

[0045] Said co-polyamino acid bearing carboxylate charges and hydrophobic -Hy radicals is soluble in an aqueous solution of pH between 5.0 and 6.0, at a temperature of 25 °C and at a concentration of 20 mg / ml.

[0046] The co-polyamino acid is a random co-polyamino acid in the chain of glutamic and / or aspartic units.

[0047] In a preferred embodiment the co-polyamino acid is the chain of glutamic units.

[0048] By “alkyl radical” is meant a carbon-comprising chain, linear or branched, which does not include a heteroatom.

[0049] In the formulas, the *s indicate the attachment sites of the various elements represented.

[0050] The radicals Hy, GpR, GpG, GpH, GpA, GpL and GpC are each independently identical or different from one residue to another.

[0051] In one embodiment, the composition according to the invention is characterized in that the Hy comprises between 15 and 100 atoms of carbon.

[0052] In one embodiment, the composition according to the invention is characterized in that the Hy comprises between 30 and 70 atoms of carbon.

[0053] In one embodiment, the composition according to the invention is characterized in that the Hy comprises between 40 and 60 atoms of carbon.

[0054] In one embodiment, the composition according to the invention is characterized in that the Hy comprises between 20 and 30 atoms of carbon.

[0055] In one embodiment, the composition according to the invention is characterized in that the Hy comprises more than 30 atoms of carbon.

[0056] In the formulas, the *s indicate the attachment sites of hydrophobic radicals to the PLG or between the different GpR, GpG, GpH, GpA, GpL and GpC to form amide functions.

[0057] Hy radicals are attached to the PLG via amide functions.

[0058] In one embodiment, r=0 and the hydrophobic radical of formula X is bonded to the PLG via a covalent bond between a carbonyl of the hydrophobic radical and a nitrogen atom borne by the PLG, thus forming an amide function resulting from the reaction of an amine function borne by the PLG precursor and an acid function borne by the –Hy’ precursor of the hydrophobic radical.

[0059] In one embodiment, r=1 or 2 and the hydrophobic radical of formula X is bonded to the PLG: ^ via a covalent bond between a nitrogen atom of the hydrophobic radical and a carbonyl borne by the PLG, thus forming an amide function resulting from the reaction of an amine function of the –Hy’ precursor of the hydrophobic radical and an acid function borne by the PLG, or ^ via a covalent bond between a carbonyl of the hydrophobic radical and a nitrogen atom borne by the PLG, thus forming an amide function resulting from the reactionof an amine function of the Hy’ precursor of the hydrophobic -Hy radical and an acid function borne by the PLG.

[0060] In one embodiment, if GpA is a radical of formula VIIIc and r=1, then: - the GpCs are directly or indirectly bonded to N^1 and N^^ and the PLG is directly or indirectly bonded via GpR to N^^ , or - the GpCs are directly or indirectly bonded to N^^ and N^^ and the PLG is directly or indirectly bonded via GpR to N^^ , or - the GpCs are directly or indirectly bonded to N^^ and N^^ and the PLG is directly or indirectly bonded via GpR to N^^.

[0061] In one embodiment, if GpA is a radical of formula VIIIc and r=0, then: - the GpCs are directly or indirectly bonded to N^^ and N^^ and the PLG is directly or indirectly bonded to N^^; or - the GpCs are directly or indirectly bonded to N^^ and N^^ and the PLG is directly or indirectly bonded to N^^; or - the GpCs are directly or indirectly bonded to N^^ and N^^, and the PLG is directly or indirectly bonded to N^^.

[0062] In one embodiment, if GpA is a radical of formula VIIId and r=1, then - the GpCs are directly or indirectly bonded to N^^, N^^ and N^^ and the PLG is directly or indirectly bonded via GpR to N^^, or - the GpCs are directly or indirectly bonded to N^^, N^^ and N^^ and the PLG is directly or indirectly bonded via GpR to N^^, or - the GpCs are directly or indirectly bonded to N^^, N^^ and N^^ and the PLG is directly or indirectly bonded via GpR to N^^, or - the GpCs are directly or indirectly bonded to N^^, N^^ and N^^ and the PLG is directly or indirectly bonded via GpR to N^^.

[0063] In one embodiment, if GpA is a radical of formula VIIId and r=0, then - the GpCs are directly or indirectly bonded to N^^, N^^ and N^^ and the PLG is directly or indirectly bonded to N^^; or - the GpCs are directly or indirectly bonded to N^^, N^^ and N^^ and the PLG is directly or indirectly bonded to N^^; or - the GpCs are directly or indirectly bonded to N^^^ N^^ and N^^ and the PLG is directly or indirectly bonded to N^^; or - the GpCs are directly or indirectly bonded to N^^, N^^ and N^^ and the PLG is directly or indirectly bonded to N^^^^.

[0064] In one embodiment, when r=2, then the GpR group bonded to the PLG is chosen from among the GpRs of formula VII.

[0065] In one embodiment, when r=2, then the first GpR group bonded to the PLG is chosen from among the GpRs of formula VII and the second GpR is chosen from among the GpRs of formula VII”.

[0066] In one embodiment, an embodiment, when r=2 then the GpR bonded to the PLG is chosen from among the GpRs of formula VII”.

[0067] In one embodiment, an embodiment, when r=2, then the first GpR group bonded to the PLG is chosen from among the GpRs of formula VII” and the second GpR is chosen from among the GpRs of formula VII.

[0068] In one embodiment, a=0,

[0069] In one embodiment, h=1 and g=0,

[0070] In one embodiment, h=0 and g=1,

[0071] In one embodiment, r=0, g=1 and h=0.

[0072] In one embodiment, at least one of g, h or l is different from 0.

[0073] In one embodiment, at least one of g and h is equal to 1.

[0074] In one embodiment, a=1 and l=1.

[0075] In one embodiment, if l=0, at least one of g or h is equal to 0.

[0076] In one embodiment, if l=1, at least one of g or h is equal to 0.

[0077] In one embodiment, g+h≥2.

[0078] In one embodiment, g is greater than or equal to 2 (g≥2).

[0079] In one embodiment, h is greater than or equal to 2 (h≥2).

[0080] In one embodiment, g+h≥2 and a and l are equal to 0 (a=l=0).

[0081] In one embodiment, g+h≥2 and b is equal to 0 (b=0).

[0082] In one embodiment, g is greater than or equal to 2 (g≥2) and b is equal to 0.

[0083] In one embodiment, g+h≥2, b is equal to 0 (b=0) and e is equal to 1 (e=1).

[0084] In one embodiment, g or h is greater than or equal to 2 (g≥2) b is equal to 0 (b=0) and e is equal to 1 (e=1).

[0085] In a most preferred embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X wherein - GpR is according to Formula VII, with r = 0 or 1- g = 0 - GpA is according to Formula VIII with s’ = 1, A’ is according to Formula VIII’ with A1 being a linear alkyl radical comprising from 2 to 5 carbon atoms, in particular GpA corresponds to a Lysine residue trisubstituted, bonded to either GpR or the terminal -NH- of the PLG via its -CO-, thus forming an amide bond and bonded to GpH via its -NH-, thus forming an amide bond, - l = 0 - GpH is according to Formula XI, with h = 1, 2 or 3, in particular 1, - GpC with e = 1, c = 0, d = 1, b = 0 and x being comprised between 13 to 15, - l’ = 1 and a’ = 2.

[0086] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which r=2 of formula Xc’, as defined below:Formula Xc’ in which GpR1 is a radical from formula VIIFormula VII in which GpR, GpG, GpA, GpL, GpH, GpC, R, a, a’, g, h, l and l’ have the definitions given above.

[0087] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which r=2 of formula Xc’, as defined below:Formula Xc’ in which GpR1, is a radical from formula VII’’Formula VII” in which GpR, GpG, GpA, GpL, GpH, GpC, R, a, a’, g, h, l and l’ have the definitions given above.

[0088] In one embodiment, g=h=0, a=1, GpA is a radical from Formula VIII with s’=1 and A’ from Formula VIII’ or VIII”, and l=1.

[0089] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which - l=0, - from formula Xb’ as defined below.Formula Xb’ in which - GpR is chosen from the radicals of formulas VII, VII’ or VII’’:- GpG is chosen from among the radicals of formula XI or XI’:Formula XI Formula XI’ - GpA is chosen from among the radicals of formula VIII in which s’=1 represented by formula VIIIa or formula VIII in which and s’=0 represented by formula VIIIb,Formule VIIIb - GpC is a radical from formula IX:Formula IX; - The *s indicate the attachment sitesof the different groups bonded by the amide functions; - a is an integer equal to 0 or to 1 and a’ = 1 if a = 0’= if and a’=1 or a’=2 if a = 1; - a’ is an integer equal to 1 or 2 and o If a’ is equal to 1 then a is equal to 0 or to 1 and GpA is a radical from formula VIIIb and,o if a’ is equal to 2 then a is equal to 1 and GpA is a radical from formula VIIIa; - b is an integer equal to 0 or to 1; - c is an integer equal to 0 or to 1, and if c is equal to 0, then d is equal to 1 or to 2; - d is an integer equal to 0, to 1, or to 2; - e is an integer equal to 0 or to 1; - g is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6; - h is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6, and at least one of g or h is different from 0; - r is an integer equal to 0, to 1, or to 2, and - s’ is a whole number equal to 0 or 1; - A1 is a linear or branched alkyl radical, and possibly substituted by a radical from a saturated, unsaturated or aromatic ring, comprising 1 to 6 carbon atoms. - B is a linear or branched alkyl radical possibly comprising an aromatic core, comprising 1 to 9 carbon atoms or a non-substituted ether or polyether radical comprising 4 to 14 carbon atoms and 1 to 5 oxygen atoms; - Cx is a linear or branched monovalent alkyl radical, possibly comprising a ring part, in which x indicates the number of carbon atoms and: ^ When the hydrophobic radical -Hy carries 1 -GpC, then 9 ≤ x ≤ 25, ^ When the hydrophobic radical -Hy carries 2 -GpC, then 9 ≤ x ≤ 15, ^ When the hydrophobic radical -Hy carries 3 -GpC, then 7 ≤ x ≤ 13, ^ When the hydrophobic radical -Hy carries 4 -GpC, then 7 ≤ x ≤ 11, ^ When the hydrophobic radical -Hy carries at least 5 -GpC, then 6 ≤ x ≤ 11, - G is a branched alkyl radical of 1 to 8 carbon atoms, with said alkyl radical bearing one or more free carboxylic acid functions, - R is a radical chosen from the group constituted by a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms, a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms bearing one or more - CONH2 functions, or a non-substituted ether or polyether radical comprising from 4 to 14 carbon atoms and 1 to 5 oxygen atoms: - The hydrophobic Hy radical(s) of formula X being bonded to the PLG: o via a covalent bond between a carbonyl of the hydrophobic radical and a nitrogen atom borne by the PLG, thus forming an amide functionresulting from the reaction of an amine function borne by the PLG and and acid function borne by the precursor of the hydrophobic, or o via a covalent bond between a nitrogen atom of the hydrophobic radical and a carbonyl borne by the PLG. Thus forming an amide function resulting from the reaction of an amine function of the -Hy’ precursor of the hydrophobic radical and an acid function borne by the PLG, - the ratio M between the number of hydrophobic radicals and the number of glutamic or aspartic units being between 0 < M ≤ 0,5; - when several hydrophobic radicals are borne by a co-polyamino acid, then they are identical or different, - free carboxylic acid functions being in the form of an alkali metal salt chosen from the group constituted by Na+and K+.

[0090] In one embodiment said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X as defined below in which l= 0, - GpA is chosen from among the radicals in formula VIII in which s’=1 and A’ is chosen from among the radicals of formula VIII” or VIII’’’, - from formula Xb’ as defined below:Formula Xb’ in which - GpR is chosen from the radicals of formulas VII, VII’ or VII’’: FormulaFormula VII’ or Formula VII’’; - GpG is chosen from among the radicals of formula XI or XI’: Formula XI Formula XI’ - GpA is chosen from among the radicals of formulas VIIIc or VIIId:Formula VIIId;- GpC is a radical from formula IX:Formula IX; - The *s indicate the attachment sites of the different groups bonded by the amide functions;- a is a whole equal to 0 or to 1 and a’ = 1 if a = 0, and a’ = 2 or 3 if a = 1; - a’ is an integer equal to 2 or 3 and o if a’ is equal to 1 then a is equal to 0 and, o if a’ is equal to 2 or 3 then a is equal to 1 and GpA is a radical from formula VIIIc or VIIId; - b is an integer equal to 0 or to 1; - c is an integer equal to 0 or to 1, and if c is equal to 0, then d is equal to 1 or to 2; - d is an integer equal to 0, to 1, or to 2; - e is an integer equal to 0 or to 1; - g is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6; - h is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6, and at least one of g or h is different from 0; - r is whole number equal to 0, to 1, or to 2, and - s’ is an integer equal to 1; - A1, A2, A3 identical or different, are linear or branched alkyl radicals, and possibly substituted by a radical from a saturated, unsaturated or aromatic ring, comprising 1 to 6 carbon atoms. - B is a linear or branched alkyl radical possibly comprising an aromatic core, comprising 1 to 9 carbon atoms or a non-substituted ether or polyether radical comprising 4 to 14 carbon atoms and 1 to 5 oxygen atoms;- Cx is a linear or branched monovalent alkyl radical, possibly comprising a ring part, in which x indicates the number of carbon atoms and: ^ When the hydrophobic radical -Hy carries 1 -GpC, then 9 ≤ x ≤ 25, ^ When the hydrophobic radical -Hy carries 2 -GpC, then 9 ≤ x ≤ 15, ^ When the hydrophobic radical -Hy carries 3 -GpC, then 7 ≤ x ≤ 13, ^ When the hydrophobic radical -Hy carries 4 -GpC, then 7 ≤ x ≤ 11, ^ When the hydrophobic radical -Hy carries 5 -GpC, then 6 ≤ x ≤ 11, - The hydrophobic Hy radical(s) of formula X being bonded to the PLG: o via a covalent bond between a carbonyl of the hydrophobic radical and a nitrogen atom borne by the PLG, thus forming an amide function resulting from the reaction of an amine function borne by the PLG and and acid function borne by the –Hy’ precursor of the hydrophobic radical, or o via a covalent bond between a nitrogen atom of the hydrophobic radical and a carbonyl borne by the PLG. Thus forming an amide function resulting from the reaction of an amine function of the –Hy’ precursor of the hydrophobic radical and an acid function borne by the PLG, - G is a branched alkyl radical of 1 to 8 carbon atoms, with said alkyl radical bearing one or more free carboxylic acid functions, - R is a radical chosen from the group constituted by a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms, a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms bearing one or more -CONH2 functions, or a non-substituted ether or polyether radical comprising from 4 to 14 carbon atoms and 1 to 5 oxygen atoms: - the ratio M between the number of hydrophobic radicals and the number of glutamic or aspartic units being between 0 < M ≤ 0.5; - when several hydrophobic radicals are borne by a co-polyamino acid, then they are identical or different, - free carboxylic acid functions being in the form of an alkali metal salt chosen from the group constituted by Na+and K+.

[0091] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which a=1 and a’=1 of formula Xa, as defined below:Formula Xain which GpA is a radical of formula VIII and A’ is chosen from among the radicals of formula VIII’ with s’=0 and is a radical of Formula VIIIbFormula VIIIb and GpR, GpG, GpL, GpH, GpC, A1, r, g, h, l and l’ have the definitions given above.

[0092] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which a=1 of formula Xb, as defined below:Formula Xb in which GpA is a radical of formula VIII and A’ is chosen from among the radicals of formula VIII’ with s’=1 and is a radical of Formula VIIIaFormula VIIIa and GpR, GpG, GpL, GpH, GpC, A1, a’, r, g, h, l and l’ have the definitions given above.

[0093] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which a=1, as defined below:Formula Xb in which GpA is a radical from formula VIII and A is chosen from among the radicals of Formula VIII’’ with s’=1 and GpA is a radical of Formula VIIIc Formula VIIIc and GpR, GpG, GpL, GpH, GpC, A1, A2, r, g, h, a’, l and l’ have the definitions given above.

[0094] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which a=1, as defined below:Formula Xbin which GpA is a radical of formula VIII and A is chosen from among the radicals of formula VIII’’’ with s’=1, and GpA is a radical of Formula VIIIdand GpR, GpG, GpL, GpH, GpC, A1, A2, A3, a’, r, g, h, l and l’ have the definitions given above.

[0095] In one embodiment, the composition according to the invention is characterized in that said hydrophobic radicals are chosen from among the hydrophobic radicals of formula X in which GpA is a radical from formula VIIIb, a’=1 and l=0, represented by the following formula Xe:Formula Xe GpR, GpG, GpA, GpH, GpC, r, g, h, and a have the definitions given above.

[0096] In one embodiment, r=0, and GpA is chosen from among the radicals of formulas VIIIa and VIIIb.

[0097] In one embodiment, r=0, g=0 and GpA is chosen from among the radicals of formula VIIIa and VIIIb.

[0098] In one embodiment, r=0, and GpA is chosen from among the radicals of formulas VIIIa and VIIIb and h=0.

[0099] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which r=1 of formula Xc, as defined below:Formula Xc in which GpR is a radical from formula VII: Formula VII and GpG, GpA, GpL, GpH, GpC, R, a, a’, g, h, l, a’ and l’ have the definitions given above.[000100] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which r=1 of formula Xc, as defined below:Formula Xc in which GpR is a radical from formula VII’:Formula VII’ and GpG, GpA, GpL, GpH, GpC, R, a, a’, g, h, l, a’ and l’ have the definitions given above. [000101] In one embodiment, said at least one hydrophobic radical -Hy is chosen from the radicals of formula X in which r=1 of formula as defined below:Formula Xc in which GpR is a radical from formula VII’’Formula VII” [000102] In one embodiment, r=1, and GpR is chosen from among the radicals of formulas VII’ and VII” and h=0. [000103] In one embodiment, r = 1, g = 0 and GpR is a radical of formula VII’ and h=0. [000104] In one embodiment, r =1, g = 0 and GpR is a radical of formula VII’ and h=1. [000105] In one embodiment, r=1, g = 0 and GpR is a radical of formula VII’, GpA is chosen from among the radicals of Formula VIIIa or VIIIb and h=0. [000106] In one embodiment, r=1, g = 0, GpR is a radical of formulas =VII’, GpA is chosen from among the radicals of formula VIIIa or VIIIb and h = 1. [000107] In one embodiment, r = 1, g = 0 GpR is a radical of formula VII’, GpA is a radical from formula VIIIa and h=0. [000108] In one embodiment, r =1, g = 0 GpR is a radical from formula VII’, GpA is a radical of formula VIIIa and h=1.[000109] In one embodiment, r = 1, g = 0, GpR is a radical from formula VII’, GpA is a radical of formula VIIIb and h=0. [000110] In one embodiment, r=1, g = 0, GpR is a radical of formulas =VII’, GpA is a radical of formula VIIIb and h = 1. [000111] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X, as defined below:Formula X in which GpC is a radical from formula IX in which e = 0 and GpC is a radical from formula IXa.Formula IXa [000112] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X, as defined below:Formula X in which GpC is a radical from formula IX in which e = 1, b = 0 and GpC is a radical from formula IXd.Formula IXd [000113] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula as defined below:Formula Xin which GpC is a radical from formula IX in which e = 1 and GpC is a radical from formula IXb .Formula IXb [000114] In one embodiment, said at least one hydrophobic radical -Hy is chosen from among the radicals of formula X in which r, g, a, l, h are equal to 0 of formula Xd, as defined below: Formula Xd, in which GpC is a radical from formula IX in which e = 0, b = 0 and GpC is a radical from formula IXc.[000115] In one embodiment, the composition according to the invention is characterized in that said hydrophobic radicals are chosen from among the hydrophobic radicals of formula X in which a’=2 and a = 1 and l=0, represented by the following formula Xf:Formula Xf GpR, GpG, GpA, GpH, GpC, r, g and h have the definitions given above. [000116] In one embodiment, the composition according to the invention is characterized in that said hydrophobic radicals are chosen from among the hydrophobic radicals of formula X in which h=0, l=0 and l’=1, represented by the following formula Xg:GpR, GpG, GpA, GpC, r, g, a, and a’ have the definitions given above. [000117] In one embodiment, the composition according to the invention is characterized in that said hydrophobic radicals are chosen from among the hydrophobic radicals of formula X in which h=0, a’ = 1 represented by the following formula Xh:Formula Xh GpR, GpG, GpA, GpC, r, a and g have the definitions given above. [000118] In one embodiment, the composition according to the invention is characterized in that said hydrophobic radicals are chosen from among the hydrophobic radicals of formula X in which h = 0, a’ = 2 and a = 1, represented by the following formula Xi:Formula Xi GpR, GpG, GpA, GpC, r and g have the definitions given above. [000119] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent, linear alkyl radical comprising 2 to 12 atoms of carbon. [000120] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent, linear alkyl radical comprising 2 to 6 atoms of carbon. [000121] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent, linear alkyl radical comprising 2 to 6 atoms of carbon. [000122] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent, linear alkyl radical comprising 2 to 4 atoms of carbon. [000123] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent, linear alkyl radical comprising 2 to 4 atoms of carbon.[000124] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent alkyl radical comprising 2 atoms of carbon. [000125] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent, linear alkyl radical comprising 1 to 11 atoms of carbon. [000126] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent, linear alkyl radical comprising 1 to 6 atoms of carbon. [000127] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent alkyl radical comprising 2 to 5 atoms of carbon and bearing one or more amide functions (-CONH2). [000128] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent, linear alkyl radical comprising 2 to 5 atoms of carbon and bearing one or more amide functions (-CONH2). [000129] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is chosen from the group constituted by the radicals represented by the formulas below: * Formula X1 * ONH2* *Formula X2 ONH2[000130] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a radical from Formula X1. [000131] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a radical from Formula X2.[000132] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is bonded to the co-polyamino acid via an amide function borne by the carbon in delta or epsilon position (or in position 4 or 5) in relation to the amide function (-CONH2). [000133] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is an unsubstituted linear ether or polyether radical comprising 4 to 14 carbon atoms and from 1 to 5 oxygen atoms. [000134] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is an ether radical. [000135] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is an ether radical comprising 4 to 6 carbon atoms. [000136] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a divalent alkyl radical comprising 6 atoms of carbon. [000137] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xh and Xi is a radical in which R is an ether radical represented by formula[000138] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a polyether radical. [000139] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a linear polyether or polyether radical comprising 6 to 10 carbon atoms and from 2 to 3 oxygen atoms. [000140] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a polyether radical chosen from the group constituted by the radicals represented by the formulas below: * O Formula X3 O * *O O *Formula X4* O OFormula X5 O** O * Formula X6 O O [000141] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a radical from Formula X3. [000142] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a radical from Formula X4. [000143] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a polyether radical chosen from the group constituted by the radicals represented by the formulas X5 and X6 below: [000144] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a polyether radical from Formula X5. [000145] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which R is a polyether radical from Formula X6. *O OFormula X5 O** O * Formula X6 O O [000146] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpG and / or GpH is from Formula XI’ in which G is an alkyl radical comprising 6 carbon atoms represented by formula Z below: Formula Z [000147] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which theradical GpG and / or GpH is from Formula XI which G is an alkyl radical comprising 4 carbon atoms represented by formula Z below:Formula Z’ [000148] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpG and / or GpH is from Formula XI which G is an alkyl radical comprising 4 carbon atoms represented by –(CH2)2-CH(COOH)-. [000149] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpG and / or GpH is from Formula XI which G is an alkyl radical comprising 4 carbon atoms represented by -CH((CH2)2COOH)-. [000150] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpG and / or GpH is from Formula XI which G is an alkyl radical comprising 3 carbon atoms represented by –CH2-CH-(COOH). [000151] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpG and / or GpH is from Formula XI which G is an alkyl radical comprising 3 carbon atoms represented-CH(CH2)COOH)-. [000152] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xe, Xf, Xg, Xh and Xi is a radical in which GpA is from formula VIII and in which A1, A2 or A3 is chosen from the group constituted by the radicals represented by the formulas below: ** * ** *H3C Formula Y1CH3CH3Formula Y2 Formula Y3* * * ** *CHCH 33Formula Y4H 3 CCH3Formula Y5 Formula Y6 ** * *H3C H3C CH3Formula Y7 Formula Y8 Formula Y9 Formula Y10 [000153] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpC from formula IX is chosen from the group constituted by the radicals from formulas IXe, IXf or IXg represented below: O * Formula IXe O NH N B Cx b O *OFormula IXf O NH N B Cx b O O O Formula IXg NH * N B Cx b O[000154] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xd,Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpC from formula IX is chosen from the group constituted by the radicals from formulas IXe, IXf or IXg in which b is equal to 0, respectively responding to formulas IXh, IXi, and IXj below: O O Formula IXh * Cx N O O Formula IXi *CxN O O Formula IXj * NCx[000155] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpC corresponds to the formula IX or IXe in which b = 0, and corresponds to the formula IXh. [000156] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is chosen from the group constituted by the linear alkyl radicals. [000157] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is a radical chosen from the group constituted by branched alkyl radicals. [000158] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is chosen from the group constituted by alkyl radicals comprising between 19 and 14 carbon atoms. [000159] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in whichCx is a radical chosen from the group constituted by the radicals represented by the formulas below: * CH3x = 9 * CH3x = 11 * CH3x = 13 [000160] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is chosen from the group constituted by alkyl radicals comprising between 15 and 16 carbon atoms. [000161] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is a radical chosen from the group constituted by the radicals represented by the formulas below: x = 15 *C H 3[000162] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is a radical is chosen from the group constituted by the radicals represented by the formulas below: CH3x = 16 * CH3[000163] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is chosen from the group constituted by alkyl radicals comprising between 17 and 25 carbon atoms. [000164] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is chosen from the group constituted by alkyl radicals comprising between 17 and 18 carbon atoms. [000165] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is a radical is chosen from the group constituted by the alkyl radicals represented by the formulas below:* CH3x = 17 [000166] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is chosen from the group constituted by alkyl radicals comprising between 18 and 25 carbon atoms. [000167] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which Cx is a radical chosen from the group constituted by the alkyl radicals represented by the formulas below: * CH3x = 19 x = 21 [000168] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpC from formula IX is chosen from among the group constituted of radicals in which Cx is chosen from the group constituted by alkyl radicals comprising between 14 and 15 carbon atoms. [000169] In one embodiment, the composition is characterized in that the hydrophobic radical from formulas X, Xa, Xb, Xb’, Xc, Xd, Xe, Xf, Xg, Xh and Xi is a radical in which the radical GpC from formula IX is chosen from the group constituted of radicals in which Cx is chosen from the group constituted by the radicals represented by the formulas below: * CH3x = 15 [000170] In one embodiment, when a’ = 1, x is between 11 and 25 (11 ≤ x ≤ 25). In particular, when x is between 15 and 16 (x = 15 or 16) then r = 1 and R is an ether or polyether radical and when x is greater than 17 (x ≥ 17) then r = 1 and R is an ether or polyether radical. [000171] In one embodiment, when a’ = 2, x is between 9 and 15 (9 ≤ x ≤ 15). [000172] In one embodiment, the co-polyamino acid is chosen from among the co- polyamino acids of formula XXXb in which the hydrophobic radical -Hy is chosen from the group of hydrophobic radicals from X, Xc’, Xa, Xb’, Xc, Xe, Xg and Xh in which a’ = 1 and l’ = 1 and GpC is a radical from formula IXe.[000173] In one embodiment, the co-polyamino acid is chosen from among the co- polyamino acids of formula XXXb in which the hydrophobic radical -Hy is chosen from the group of hydrophobic radicals from formulas X, Xc’, Xa, Xb’, Xc, Xe, Xg and Xh in which a’ = 1 and l’ = 1 and GpC is a radical from formula IX in which e=0. [000174] In one embodiment, the co-polyamino acid is chosen from among the co- polyamino acids of formula XXXb in which the hydrophobic radical -Hy is chosen from the group of hydrophobic radicals from formulas X, Xc’, Xa, Xb, Xc, Xf, Xg and Xi in which a’ = 2 and l’ = 2 and GpC is a radical from formula IXe. [000175] In one embodiment, the co-polyamino acid is chosen from among the co- polyamino acids of formula XXXb in which the hydrophobic radical -Hy is chosen from the group of hydrophobic radicals from formulas X, Xc’, Xa, Xb, Xc, Xf, Xg and Xi in which a’ = 2 and l’ = 2 and GpC is a radical from formula IX in which e = 0. [000176] In one embodiment, the co-polyamino acid is chosen from among the co- polyamino acids of formula XXXa in which the hydrophobic radical -Hy is chosen from the group of hydrophobic radicals from formulas X, Xc’, Xa, Xb’, Xc, Xe, Xg and Xh in which a’ = 1 and l’ = 1 and GpC is a radical from formula IXe. [000177] In one embodiment, the co-polyamino acid is chosen from among the co- polyamino acids of formula XXXa in which the hydrophobic radical -Hy is chosen from the group of hydrophobic radicals from formulas X, Xc’, Xa, Xb, Xc, Xf, Xg and Xi in which a’ = 2 and l’ = 2 and GpC is a radical from formula IXe. [000178] In one embodiment, the hydrophobic radical Hy is chosen from the group of hydrophobic radicals from formula X, in which h is greater than or equal to 2 h ≥ 2) and GpC is from formula IXe. [000179] In one embodiment, the hydrophobic radical Hy is chosen from the group of hydrophobics from formula X in which g is greater than or equal to 2 (g ≥ 2) and a, l and h are equal to 0 and GpC is from formula IXe. [000180] In one embodiment, the composition is characterized in that the hydrophobic radical from the hydrophobic radicals from formulas X, Xc’, Xa, Xb, Xb’, Xc, Xe, Xg and Xh in which a’ = 1 and l’ = 1 and in which Cx is chosen from the group constituted by the linear alkyl radicals. [000181] In one embodiment, the composition is characterized in that the hydrophobic radical is chosen from the hydrophobic radicals from formulas X, Xc’, Xa, Xb, Xb’, Xc, Xf, Xg and Xi in which a’ = 2 or l’ = 2 and in which Cx is chosen from the group constituted by the linear alkyl radicals.[000182] In one embodiment, the hydrophobic radical -Hy is chosen from the group of hydrophobic radicals from formula X in which GpR is a radical from formula VII, GpH is a radical from XI and GpC is a radical from formula IX in which e = 1, b = 0 and x = 13. [000183] In a preferred embodiment, the hydrophobic radical -Hy is chosen from the group of hydrophobic radicals from formula XFormula X in which: - r is an integer equal to 0 or to 1, in particular r = 1, and GpR is a radical according to Formula VIIFormula VII - g = 0, - a = 0 - a’ = 1 - l = 1 and GpL is a radical according to formula XII:Formula XII, - A is a linear or branched alkyl radical and / or substituted by a radical derived from a saturated, unsaturated or aromatic ring, comprising 1 to 8 carbon atoms, in particular A is a linear or branched alkyl radical comprising 1 to 8 carbon atoms, more particularly A is a linear alkyl radical comprising 5 carbon atoms, - l’ = 2 - h = 1, 2 or 3, in particular h = 1, and GpH is a radical according to Formula XI:Formula XI - G is a branched alkyl radical of 1 to 8 carbon atoms, with said alkyl radical bearing one or more free carboxylic acid functions, in particular one free carboxylic acid function, - GpC is a radical according to formula IX:in which b = 0; e = 1; c = 0 or 1; d = 0, 1, or 2; and if c is equal to 0, then d is equal to 1 or to 2; in particular c = 0 and d = 1, - Cx is a linear or branched monovalent alkyl radical, and / or comprising a cyclic part, in which x indicates the number of carbon atoms and when the hydrophobic radical -Hy carries 2 -GpC, then 9 ≤ x ≤ 15, in particular x = 13. [000184] In an embodiment, the hydrophobic radical(s) -Hy according to formula X being bonded to the PLG: o via a covalent bond between a carbonyl of the hydrophobic radical -Hy and a nitrogen atom borne by the PLG, thus forming an amide function derived from the reaction of an amine function borne by the PLG and an acid function borne by the precursor -Hy’ of the hydrophobic radica -Hy, or o via a covalent bond between a nitrogen atom of the hydrophobic radical -Hy and a carbonyl borne by the PLG, thus forming an amide function derived from the reaction of an amine function of the precursor -Hy’ of the hydrophobic -Hy radical and an acid function borne by the PLG, - the ratio M between the number of hydrophobic radicals and the number of glutamic or aspartic units being from 0 < M ≤ 0.5; - when several hydrophobic radicals are borne by a co-polyamino acid, then they are identical or different, - the degree of polymerization DP in glutamic or aspartic units for PLG chains is comprised from 5 to 250; - free carboxylic acid functions being in the form of an alkali metal salt chosen from the group consisting of Na+and K+. [000185] In one embodiment, the composition according to the invention is characterized in that the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.007 and 0.3.[000186] In one embodiment, the composition according to the invention is characterized in that the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.01 and 0.3. [000187] In one embodiment, the composition according to the invention is characterized in that the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.02 and 0.2. [000188] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.007 and 0.15. [000189] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.01 and 0.1. [000190] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.02 and 0.08. [000191] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radical Cx comprises between 9 and 10 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.03 and 0.15. [000192] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radical Cx comprises between 11 and 12 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.015 and 0.1. [000193] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radical Cx comprises between 11 and 12 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.02 and 0.08. [000194] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radicalCx comprises between 13 and 15 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.01 and 0.1. [000195] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radical Cx comprises between 13 and 15 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.01 and 0.06. [000196] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.007 and 0.3. [000197] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.01 and 0.3. [000198] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.015 and 0.2. [000199] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radical Cx comprises between 11 and 14 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.1 and 0.2. [000200] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radical Cx comprises between 15 and 16 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.04 and 0.15. [000201] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radical Cx comprises between 17 and 18 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.02 and 0.06.[000202] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radical Cx comprises between 19 and 25 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.01 and 0.06. [000203] In one embodiment, the composition according to the invention is characterized in that the hydrophobic radical corresponds to formula X in which radical Cx comprises between 19 and 25 atoms and the M ratio between the number of hydrophobic radicals and the number of glutamate or aspartic unites is between 0.01 and 0.05. [000204] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa’ below:formula XXXa’ In which - D represents, independently, either a -CH2- group (aspartic unit) or a -CH2- CH2- group (glutamic unit), - Hy is a hydrophobic radical chosen from among the hydrophobic radicals from formula X, in which r=1 and GpR is a radical from formula VII, - R1is a hydrophobic radical chosen from among the hydrophobic radicals of formula X in which r=0 or r=1 and GpR is a radical from Formula VII’, or a radical chosen from the group constituted by an H, a linear acyl group in C2 to C10, a branched acyl group in C4 to C10, a benzoyl, a terminal “amino acid” and a pyroglutamate, - R2is a hydrophobic radical chosen from among the hydrophobic radicals of formula X in which r=1 and GpR is a radical from Formula VII, or a -NR’R’’ radical, withR’ and R”, either identical or different, being chosen from the group comprised by H, linear or branched or cyclic alkyls in C2 to C10, or benzyl and said R’ and R” alkyls being able to form together one or more carbonated cycles, saturated, unsaturated and / or aromatic, able to comprise hetero-atoms, chosen from the group comprised of O, N and S; - X represents a cationic entity chosen from the group comprising alkaline cations; - the sum n + m represents the degree of polymerization DP of the co-polyamino acid, namely, the average number of monomeric units per co-polyamino acid chain and 5 ≤ n + m ≤ 250. [000205] In some embodiments, a composition according to the present disclosure comprising co-polyamino aicds (PLGs) bearing carboxylate charges and hydrophobic radicals comprise a non-functionalized N-terminal being H or pyroglutamte. [000206] In some embodiment, at least 90% of the co-polyamino acids bearing carboxylate charges and hydrophobic radicals have a non-functionalized N-terminal (R1) that is pyroglutamate, in particular at least 95% pyroglutamate, more particularly at least 98% pyroglutamate, and even more particularly at least 99% pyroglutamate. [000207] In an embodiment, R1 in Formula XXX (when R1 is not a hydrophobic radical from Formula X), XXXa’, XXXb (when R1 is not a hydrophobic radical from Formula X), R1’ in Formulas XXXa, XXXb’ is at least 90% pyroglutamate, in particular at least 95% pyroglutamate, more particularly at least 98% pyroglutamate, and even more particularly at least 99% pyroglutamate. [000208] The maximum % of pyroglutamate being 100%. [000209] The percentage of pyroglutamate is estimated by the analysis method disclosed in the Examples. [000210] In an embodiment, the dispersity, Ð, of the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is less or equal to 1.2. [000211] In an embodiment, the dispersity, Ð, of the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is less or equal to 1.15. [000212] In an embodiment, the dispersity, Ð, of the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is less or equal to 1.10. [000213] In an embodiment, the dispersity, Ð, of the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is less or equal to 1.08. [000214] The minimum dispersity being 1.[000215] The determination of Mn, Mw, and Ð (dispersity) is disclosed in the Examples. [000216] When the co-polyamino acid comprises one or more aspartic units, the latter may be subject to structural re-arrangements. [000217] In one embodiment, the composition according to the invention is characterized in that when the co-polyamino acid comprises aspartic units, then the co-polyamino acid may also comprise monomeric units from formula XXXI and / or XXXI’.Formula XXXI Formula XXXI’ [000218] We call “a statistically grafted co-polyamino acid” a co-polyamino acid bearing carboxylate charges and at least one hydrophobic radical, a co-polyamino acid of formula XXXa. [000219] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa’, in which R1 = R’1 and R2 = R’2, from formula XXXa below:formula XXXa in which - m, n, X, D and Hy have the definitions given above,- R’1 is a radical chosen from among the group constituted by an H, a linear acyl group in C2 to C10, a branched acyl group in C4 to C10, a benzoyl, a terminal “amino acid” and a pyroglutamate, - R’2 is a -NR’R’’ radical with R’ and R” , either identical or different, being chosen from the group comprised by H, linear or branched or cyclic alkyls in C2 to C10, or benzyl and said R’ and R” alkyls being able to form together one or more carbonated cycles, saturated, unsaturated and / or aromatic, able to comprise hetero-atoms, chosen from the group comprised of O, N and S. [000220] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa in which Hy is a radical from formula X. [000221] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa in which Hy is a radical from formula X, in which r=1. [000222] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa, in which Hy is a radical from formula X, in which r=1, and for GpC, b=0. [000223] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa in which Hy is a radical from formula X and in which GpC is a radical from formula IX. [000224] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa in which Hy is a radical from formula X and in which GpC is a radical from formula IX and r=1. [000225] We call “a semi-telechelic grafted co-polyamino acid” a co-polyamino acid bearing carboxylate charges and at least one hydrophobic radical, a co-polyamino acid of formula XXXb. [000226] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges andhydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa’, in which n=0 from the following formula XXXb:In which m, X, D, R1 and R2 have the definitions given above and at least R1 or R2 is a hydrophobic radical from formula X. [000227] In one embodiment the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa’ in which n=0 of formula XXXb and R1 or R2 is a hydrophobic radical from formula X. [000228] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXb in which R1= R’1 from formula XXXb’:formula XXXb’ in which m, X, D, R’ 1 and R2 have the definitions given above and R2 is a hydrophobic radical from formula X. [000229] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXb in which R2 = R’2 from formula XXXb”:Formula XXXb’’ in which m, X, D, R1 and R’ 2 have the definitions given above and R1 is a hydrophobic radical from formula X. [000230] In a most preferred embodiment, the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is according to Formula XXXb’. [000231] In another most preferred embodiment, the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is according to Formula XXXb’’. [000232] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXb or XXXb” in which R1 is a radical from formula X and in which GpR is from formula VII’. [000233] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXb or XXXb” in which R1 is a radical from formula X and in which GpR is a from formula VII’’. [000234] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXb or XXXb’’ in which R1 is a hydrophobic radical from formula X and in which GpR is from formula VII’ and GpC is from formula IX. [000235] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXb or XXXb’’ in which R1 is a hydrophobic radical from formula X and in which GpR is from formula VII’ and GpC is from formula IX.[000236] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXb or XXXb’ in which R2 is a hydrophobic radical from formula X and in which r = 1 and GpR is from formula VII. [000237] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from the co-polyamino acids of formula XXXa’ in which at least one of R1 or R2 is a hydrophobic radical as defined above from the following formula XXX:formula XXX In which - D represents, independently, either a -CH2- group (aspartic unit) or a -CH2-CH2- group (glutamic unit), - Hy is a hydrophobic radical chosen from among the hydrophobic radicals from formula X, in which r=1 and GpR is a radical from formula VII, - R1 is a hydrophobic radical chosen from among the hydrophobic radicals of formula X in which r=0 or r=1 and GpR is a radical from Formula VII’, or a radical chosen from the group constituted by an H, a linear acyl group in C2 to C10, a branched acyl group in C4 to C10, a benzoyl, a terminal “amino acid” unit and a pyroglutamate, - R2 is a hydrophobic radical chosen from among the hydrophobic radicals of formula X in which r=1 and GpR is a radical from Formula VII, or a -NR’R’’ radical, with R’ and R”, either identical or different, being chosen from the group comprised by H, linear or branched or cyclic alkyls in C2 to C10, or benzyl and said R’ and R” alkylsbeing able to form together one or more carbonated cycles, saturated, unsaturated and / or aromatic, able to comprise hetro-atoms, chosen from the group comprised of O, N and S, - X represents an H or a cationic entity chosen from the group comprising the metallic cations; - the sum n + m represents the degree of polymerization DP of the co-polyamino acid, namely, the average number of monomeric units per co-polyamino acid chain and 5 ≤ n + m ≤ 250. [000238] According to an embodiment, the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is as disclosed in WO2019 / 110797 and its US equivalent US2019275115, which are incorporated by reference. [000239] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from the co-polyamino acids of formula A-1 [Q(PLG)k] [Hy]j[Hy]j’ Formula A-I Wherein: - j ≥ 1; 0 ≤ j’ ≤ n’1 and j + j’ ≥ 1 and k ≥ 2 - said co-polyamino acid according to formula A-I bearing at least one hydrophobic radical -Hy,carboxylate charges and consisting of at least two chains of glutamic or aspartic units PLG bound together by at least a divalent linear or branched radical or spacer Q[―*]k consisting of an alkyl chain comprising one or a plurality of heteroatoms chosen in the group consisting of nitrogen and oxygen atoms and / or bearing one or a plurality of heteroatoms consisting of nitrogen and oxygen radicals and / or radicals bearing one or a plurality of heteroatoms consisting of nitrogen and oxygen atoms and / or carboxyl functions, - said radical or spacer Q[―*]k being bound to at least two glutamic or aspartic unit chains PLG by an amide function and, - said amide functions binding said radical or spacer Q[―*]k bound to said at least two chains of glutamic or aspartic units result from the reaction between an amine function and an acid function respectively borne either by the precursor Q’ of the radical or spacer Q[―*]k or by a glutamic or aspartic unit, - said hydrophobic radical -Hy being bound either to a terminal "amino acid" unit and then j ≥ 1, or to a carboxyl function borne by one of the chains of theglutamic or aspartic units PLG and then j’ = n’1 and n’1 is the mean number of monomeric units bearing a hydrophobic radical -Hy. [000240] In one embodiment, k is 2, 3, 4, 5 or 6. [000241] In one embodiment, k = 2. [000242] In one embodiment, k = 3. [000243] In one embodiment, k = 4. [000244] In one embodiment, k = 5. [000245] In one embodiment, k = 6. [000246] In one embodiment, j is 1, 2, 3, 4, 5 or 6. [000247] In one embodiment, j = 1. [000248] In one embodiment, j = 2. [000249] In one embodiment, j = 3. [000250] In one embodiment, j = 4. [000251] In one embodiment, j = 5. [000252] In one embodiment, j = 6. [000253] In one embodiment, the radical or spacer Q[―*]k is represented by a radical according to formula A-II: Q[―*]k = ([Q’]q)[―*]k Formula A-II Wherein 1≤ q ≤ 5 - The radicals Q’ being identical or different and chosen in the group consisting of radicals of the following formulas III to VI’, to form Q[―*]k: by a radical according to formula A-IIIFormula A-III wherein 1 ≤ t ≤ 8 by a radical according to formula A-IV:Formula A-IV wherein:At least one of u1’’ or u2’’ is different to 0. If u1’’ ≠ 0 then u1’ ≠ 0 and if u2’’ ≠ 0 then u2’ ≠ 0, u1’ and u2’ are identical or different and, 2 ≤ u ≤ 4, 0 ≤ u1’’ ≤ 8, in particular 0 ≤ u1’’ ≤ 4, 0 ≤ u2’ ≤ 4 0 ≤ u2’’ ≤ 8, in particular 0 ≤ u2’’ ≤ 4, by a radical to formula A-V:Formula A-V Wherein: v, v’ and v’’ identical or different, are integers ≥ 0, and v + v’ +v’’ ≤ 15, by a radical according to formula A-VI:Formula A-VI Wherein: w1’ is different to 0, 0 ≤ w2’’ ≤ 1, w1 ≤ 6 and w1’≤ 6 and / or w2 ≤ 6 and w2’≤ 6 where Fd, and Fd’ identical or different representing functions -NH- or -CO- and Fy representing a trivalent nitrogen atom -N=, where in each of the radicals represented above Fx = Fa, Fb, Fc, Fd, Fa’, Fb’, Fc’, Fc’’ and Fd’ identical or different representing functions -NH- or -CO- and Fy representing a trivalent nitrogen atom -N=, two radicals Q’ being bound together by a covalent bond between a carbonyl function, Fx = -CO-, and an amine function Fx = -NH- or Fy = -N= , thus forming anamide bond and where a function Fx = Fa, Fb, Fc, Fd, Fa’, Fb’, Fc’, Fc’’ and Fd’ is not used in a bond between two Q’, this function is then free and salified. [000254] In one embodiment, said radical Q’ is chosen among the radicals according to formula A-VI’, wherein w2 = 0 according to formula VI’ as defined hereinafter:Formula A-VI’ wherein: w’1 is different to 0, 0 ≤ w’’2 ≤ 1, w1 ≤ 6 and w’1≤ 6 and / or w’2≤ 6 where Fd, and Fd’ identical or different representing functions -NH- or -CO- and Fy representing a trivalent nitrogen atom -N=, two radicals Q’ being bound together by a covalent bond between a carbonyl function, Fx = -CO-, and an amine function Fx = -NH- or Fy = -N= , thus forming an amide bond, where in each of the radicals represented above, Fx = Fa, Fb, Fc, Fd, Fa’, Fb’, Fc’, Fc’’ and Fd’ identical or different representing functions -NH- or -CO- and Fy representing a trivalent nitrogen atom -N=, two radicals Q’ being bound together by a covalent bond between a carbonyl function, Fx = -CO-, and an amine function Fx = -NH- or Fy = -N= , thus forming an amide bond. [000255] In one embodiment, if Fa and Fa’ are -NH-, then t≥2. [000256] In one embodiment, if Fa and Fa’ are -CO-, then t≥1. [000257] In one embodiment, if Fa and Fa’ are -CO- and -NH-, then t≥1. [000258] In one embodiment, if Fb and Fb’ are -NH-, then u and u1’≥2 and / or u2’≥2. [000259] In one embodiment, if Fc, Fc’ and Fc’’ are -NH- then at least two of v, v’ and v’’ are different to 0. [000260] In one embodiment, if Fc, Fc’ and Fc’’ are 2 -NH- and 1 -CO- then at least one of the indices of the –(CH2)- bearing a nitrogen is different to 0. [000261] In one embodiment, if Fc, Fc’ and Fc’’ are 1 -NH- and 2 -CO- then no conditions.[000262] In one embodiment, if Fc, Fc’ and Fc’’ are -CO- then at least one of v, v’ and v’’ is different to 0. [000263] In one embodiment, if Fd and Fd’ are -NH-, w1 and w1’ ≥2 and / or w2 and w’2 ≥2. [000264] In one embodiment, if Fd and Fd’ are -CO-, w1 and w1’ ≥1 and / or w2 and w2’ ≥1. [000265] In one embodiment, if Fd and Fd’ are -CO- and -NH-, w1 and w1’ ≥1 and / or w2 and w2’ ≥1. [000266] The at least two chains of glutamic or aspartic units PLG being bound to Q[―*]k by a function Fx or Fy by a covalent bond to form an amide bond with a function -NH- or -CO- of the PLG. [000267] In one embodiment, 1≤ q ≤ 5. [000268] In one embodiment, v + v’ +v’’ ≤ 15. [000269] In one embodiment, at least one of the Q’ is a radical according to formula A-III,Formula A-III wherein the precursor is a diamine. [000270] In one embodiment, the precursor of the radical according to formula A- III is a diamine chosen in the group consisting of ethylene diamine, butylenediamine, hexylenediamine, 1,3-diaminopropane and 1,5-diaminopentane, propylene diamine, pentylene diamine. [000271] In one embodiment, t = 2 and the precursor of the radical according to formula A-III is ethylenediamine. [000272] In one embodiment, t = 4 and the precursor of the radical according to formula A-III is butylenediamine. [000273] In one embodiment, t = 6 and the precursor of the radical according to formula A-III is hexylenediamine. [000274] In one embodiment, t = 3 and the precursor of the radical according to formula A-III is 1,3-diaminopropane. [000275] In one embodiment, t = 5 and the precursor of the radical according to formula A-III is 1,5-diaminopentane.[000276] In one embodiment, the precursor of the radical according to formula A- III is an amino acid. [000277] In one embodiment, the precursor of the radical according to formula A- III is an amino acid chosen in the group consisting of aminobutanoic acid, aminohexanoic acid and beta-alanine. [000278] In one embodiment, t = 2 and the precursor of the radical according to formula A-III is beta-alanine. [000279] In one embodiment, t = 6 and the precursor of the radical according to formula A-III is aminohexanoic acid. [000280] In one embodiment, t = 4 and the precursor of the radical according to formula A-III is aminobutanoic acid [000281] In one embodiment, the precursor of the radical according to formula A- III is a diacid. [000282] In one embodiment, the precursor of the radical according to formula A- III is a diacid chosen in the group consisting of succinic acid, glutaric acid and adipic acid. [000283] In one embodiment, t = 2 and the precursor of the radical according to formula A-III is succinic acid. [000284] In one embodiment, t = 3 and the precursor of the radical according to formula A-III is glutaric acid. [000285] In one embodiment, t = 4 and the precursor of the radical according to formula A-III is adipic acid. [000286] In one embodiment, at least one of the Q’ is a radical according to formula A-IV,Formula A-IV wherein the precursor is a diamine. [000287] In one embodiment, the precursor of the radical according to formula A- IV is a diamine chosen in the group consisting of diethyleneglycoldiamine, triethyleneglycol diamine, 1-amino-4,9-dioxa-12-dodecanamine and 1-amino-4,7,10- trioxa-13-tridecanamine. [000288] In one embodiment, u = u’1 = 2, u’’1=1, u’’2 = 0 and the precursor of the radical according to formula A-IV is diethyleneglycol diamine.[000289] In one embodiment, u = u’1 = u’2 = 2, u’’1= u’’2 = 1 and the precursor of the radical according to formula A-IV is triethyleneglycol diamine. [000290] In one embodiment, u = u’2 = 3, u’1 = 4, u’’1= u’’2 = 1 and the precursor of the radical according to formula A-IV is 4,9-dioxa-1,12-dodecanediamine. [000291] In one embodiment, u = u’2 = 3, u’1 = u’’1= 2, u’’2 = 1 and the precursor of the radical according to formula A-IV is 4,7,10-trioxa-1,13-tridecanediamine. [000292] In one embodiment, at least one of the Q’ is a radical according to formula A-V,Formula A-V wherein the precursor is chosen in the group consisting of amino acids. [000293] In one embodiment, the precursor of the radical according to formula A- V is an amino acid chosen in the group consisting of lysine, ornithine, 1,3- diaminopropionic acid. [000294] In one embodiment, v = 4, v’ = v’’ = 0 and the precursor of the radical according to formula A-V is lysine. [000295] In one embodiment, v = 3, v’ = v’’ = 0 and the precursor of the radical according to formula A-V is ornithine. [000296] In one embodiment, v = 2, v’ = v’’ = 0 and the precursor of the radical according to formula A-V is 2,3-diaminopropionic acid. [000297] In one embodiment, at least one of the Q’ is a radical according to formula A-V,Formula A-V wherein the precursor is chosen in the group consisting of triacids.[000298] In one embodiment, the precursor of the radical according to formula A- V is a triacid chosen in the group consisting of tricarballylic acid. [000299] In one embodiment, v = 0, v’ = v’’ = 1 and the precursor of the radical according to formula A-V is tricarballylic acid. [000300] In one embodiment, at least one of the Q’ is a radical according to formula A-V,Formula A-V wherein the precursor is chosen in the group consisting of triamines. [000301] In one embodiment, the precursor of the radical according to formula A- V is a triamine chosen in the group consisting of (2-(aminomethyl)propane-1,3- diamine). [000302] In one embodiment, v = v’ = v’’ = 1 and the precursor of the radical according to formula A-V is (2-(aminomethyl)propane-1,3-diamine). [000303] In one embodiment, at least one of the Q’ is a radical according to formulaFormula A-VI wherein the precursor is a triamine. [000304] In one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI is a triamine chosen in the group consisting of spermidine, norspermidine, and diethylenetriamine and bis(hexamethylene)triamine. [000305] In one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI is spermidine. [000306] In one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI is norspermidine. [000307] In one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI is diethylenetriamine.[000308] one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI is bis(hexamethylene)triamine. [000309] In one embodiment, at least one of the Q’ is a radical according to formula A-VI,Formula A-VI wherein the precursor is a tetramine. [000310] In one embodiment, w’’2 = 1 and the precursor of the radical according to formula A-VI is a tetramine. [000311] In one embodiment, w’’2 = 1 and the precursor of the radical according to formula A-VI is a tetramine chosen in the group consisting of spermine and triethylenetetramine. [000312] In one embodiment, w’’2 = 1 and the precursor of the radical according to formula A-VI is spermine. [000313] In one embodiment, w’’2 = 1 and the precursor of the radical according to formula A-VI is triethylenetetramine. [000314] In one embodiment, the precursor of the radical or spacer Q[―*]k has 4 reactive functions, chosen among the amine and carboxylic acid functions. Such a precursor may be 1,2,3,4-butanetetraoic acid. [000315] In one embodiment, at least one of the Q’ is a radical according to formula A-VI’,Formula A-VI’ wherein the precursor is a triamine. [000316] In one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI’ is a triamine chosen in the group consisting of spermidine, norspermidine, and diethylenetriamine and bis(hexamethylene)triamine. [000317] In one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI’ is spermidine. [000318] In one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI’ is norspermidine.[000319] In one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI’ is diethylenetriamine. [000320] one embodiment, w’’2 = 0 and the precursor of the radical according to formula A-VI is bis(hexamethylene)triamine. [000321] In one embodiment, at least one of the Q’ is a radical according to formulaFormula A-VI’ wherein the precursor is a tetramine. [000322] In one embodiment, w’’2 = 1 and the precursor of the radical according to formula A-VI’ is a tetramine. [000323] In one embodiment, w’’2 = 1 and the precursor of the radical according to formula A-VI’ is a tetramine chosen in the group consisting of spermine and triethylenetetramine. [000324] In one embodiment, w’’2 = 1 and the precursor of the radical according to formula A-VI’ is spermine. [000325] In one embodiment, w’’2 = 1 and the precursor of the radical according to formula A-VI’ is triethylenetetramine. [000326] In one embodiment, the precursor of the radical or spacer Q[―*]k has 4 reactive functions, chosen among the amine and carboxylic acid functions. [000327] In one embodiment, the precursor of the radical or spacer Q[―*]k has 4 reactive functions and the precursor of the radical or spacer Q[―*]k is 1,2,3,4- butanetetraoic acid. [000328] In one embodiment, all the Fx are bound to the PLG or to other Fx or Fy. [000329] In one embodiment, one or plurality of Fx are free, i.e. are not bound to the PLG, or to another Fx, or to an Fy. [000330] In one embodiment, one Fx is free, i.e. is not bound to the PLG, or to another Fx, or to an Fy. [000331] In one embodiment, the -CO- type Fx(s) is free, it is in carboxylic acid salt form. [000332] In one embodiment, the free -CO- type Fx is borne by a radical Q’ according to Formula A-V. [000333] In one embodiment, the -NH- type Fx(s) is free, it is in amine or ammonium form.[000334] In one embodiment, the PLG are bound to Fx where Fx = -NH- or to Fy by at least one carbonyl function of the PLG. [000335] In one embodiment, the PLG are bound to Fx where Fx = -NH- or to Fy by at least one carbonyl function which is not in the C-terminal position of the PLG. [000336] In one embodiment, the PLG are bound to Fx where Fx = -NH- or to Fy by the carbonyl function in the C-terminal function of the PLG. [000337] In one embodiment, the PLG are bound to Fx where Fx = -NH- by the carbonyl function in the C-terminal function of the PLG. [000338] In one embodiment, the PLG are bound to Fx where Fx = Fy by the carbonyl function in the C-terminal function of the PLG. [000339] In one embodiment, the PLG are bound to Fx, where Fx = -CO- by the nitrogen atom in the N-terminal function of the PLG. [000340] In a preferred is either a radical of formula A-III or A-IVFormula A-III wherein 1 ≤ t ≤ 8, in particular with Fa and Fa’ being -NH- andFormula A-IV wherein: at least one of u1’’ or u2’’ is different to 0. If u1’’ ≠ 0 then u1’ ≠ 0 and if u2’’ ≠ 0 then u2’ ≠ 0, u1’ and u2’ are identical or different and, 2 ≤ u ≤ 4, 0 ≤ u1’ ≤ 4, 0 ≤ u1’’ ≤ 8, in particular 0 ≤ u1’’ ≤ 4, 0 ≤ u2’ ≤ 4 0 ≤ u2’’ ≤ 8, in particular 0 ≤ u2’’ ≤ 4, and Fa, Fb, Fa’, Fb’ identical or different are representing functions -NH- or -CO-. They would form an amide bond with the aspartate or glutamate unit of the PLG they are linked with. [000341] In a most preferred embodiment, Q’ is a radical of formula A-IIIFormula A-III Wherein - t is 2, 3 or 4, in particular 2 and - Fa, and Fa’ identical or different are representing functions -NH- or -CO-, in particular Fa = Fa’ and represents -NH- They would form an amide bond with the aspartate or glutamate unit of the PLG they are liked with. [000342] In a most preferred embodiment, Q’ is a radical of formula A-IV wherein u is 2, u’1 and u’2 are equal to 2, u’’1 is an integer comprised between 0 and 8 and u’’2 is an integer comprised between 0 and 8 and thus corresponds to Formula A-IVa *-Fb-(CH2)2-(O(CH2)2)aa -Fb’ Formula A-IVa wherein - aa is an integer comprised between 1 and 16, in particular between 2 and 8, - Fb and Fb’, identical or different, are representing functions -NH- or -CO-, in particular Fb and Fb’ represents -NH-. They would form an amide bond with the aspartate or glutamate unit of the PLG they are linked with. [000343] In a preferred embodiment Q comprises only one Q’. [000344] In a most preferred embodiment Q comprises only one Q’ chosen from formula A-III, A-IV and A-IVa. [000345] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from the co-polyamino acids of formula A-XXX:Formula A-XXX Wherein - D represents, independently, either a group -CH2- (aspartic acid) or a group - CH2-CH2- (glutamic acid),- Z represents a cationic entity chosen in the group comprising alkali cations, - Ra and R’a, identical or different, are either a hydrophobic radical -Hy, or a radical chosen in the group consisting of an H, a C2 to C10 linear acyl group, a C3 to C10 branched acyl group, a benzyl, a terminal "amino acid" unit and a pyroglutamate, - at least one of Ra and R’a being a hydrophobic radical -Hy, in particular both Ra and Ra’ are hydrophobic radicals -Hy, - Q is corresponding to only one Q’, in particular chosen from the group consisting of Formula A-III, A-IV or A-IVa - -Hy is as previously defined, - n’ + m’ represents the degree of polymerization DP of the co-polyamino acid, namely the mean number of monomeric units per co-polyamino acid chain and 8 ≤ n’ + m’ ≤ 250, in particular 10 ≤ n’ + m’ ≤ 250, more particularly 20 ≤ n’ + m’ ≤ 150, and even more particularly 20 ≤ n’ + m’ ≤ 100. More particularly, 8 ≤ n’ + m’ ≤ 50. [000346] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from the co-polyamino acids of formula A-XXXI:Formula A-XXXI Wherein - D represents, independently, either a group -CH2- (aspartic acid) or a group - CH2-CH2- (glutamic acid), - X represents a cationic entity chosen in the group comprising alkali cations, - Ra and R’a, identical or different, are either a hydrophobic radical -Hy, or a radical chosen in the group consisting of an H, a C2 to C10 linear acyl group, aC3 to C10 branched acyl group, a benzyl, a terminal "amino acid" unit and a pyroglutamate, - at least one of Ra and R’a being a hydrophobic radical -Hy, in particular both Ra and Ra’ are hydrophobic radicals -Hy, - Q is corresponding to only one Q’, in particular chosen from the group consisting of Formula A-III, A-IV or A-IVa - -Hy is as previously defined, - n’ + m’ represents the degree of polymerization DP of the co-polyamino acid, namely the mean number of monomeric units per co-polyamino acid chain and 8 ≤ n’ + m’ ≤ 250, in particular 10 ≤ n’ + m’ ≤ 250, more particularly 20 ≤ n’ + m’ ≤ 150, and even more particularly 20 ≤ n’ + m’ ≤ 100. More particularly, 8 ≤ n’ + m’ ≤ 50. [000347] According to an embodiment, the backbone “PLG” of the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is as disclosed in WO2019 / 110625 and its US equivalent US2022 / 040099 which are incorporated by reference. [000348] To be clear, in an embodiment, the co-polyamino acid bearing carboxylate charges and hydrophobic radicals bear the hydrohobic radical as disclosed in the instant specification with the PLG backbone as disclosed in WO2019 / 110625 and its US equivalent US2022 / 040099. [000349] According to an embodiment, the backbone “PLG” of the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is as disclosed in WO2019 / 243628 which os incorporated by reference. [000350] To be clear, in an embodiment, the co-polyamino acid bearing carboxylate charges and hydrophobic radicals bear the hydrohobic radical as disclosed in the instant specification with the PLG backbone as disclosed in WO2019 / 243628. [000351] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen among the co-polyamino acids of formula XXX, XXXa, XXXa’, XXXb, XXXb’, XXXb”, A-XXXI or A-XXX in which group D is a –CH2- group (aspartic unit).[000352] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen among the co-polyamino acids of formula XXX, XXXa, XXXa’, XXXb, XXXb’ XXXb”, A-XXXI or A-XXX in which group D is a –CH2-CH2- group (glutamic unit). [000353] In one embodiment, the composition according to the invention is characterized in that R1 is a radical chosen from the group comprised by a linear acyl group in C2 to C10, a branched acyl group in C4 to C10, a benzoyl, a terminal “amino acid” unit and a pyroglutamate. [000354] In one embodiment, the composition according to the invention is characterized in that R1 is a radical chosen from the group comprised by a linear acyl group in C2 to C10, or a branched acyl group in C4 to C10. [000355] In one embodiment, the composition according to the invention is characterized in that n+m or n’+m’ is between 10 and 200. [000356] In one embodiment, the composition according to the invention is characterized in that n+m is between 9 and 49. [000357] In one embodiment, the composition according to the invention is characterized in that n+m is between 9 and 29. [000358] In one embodiment, the composition according to the invention is characterized in that n+m is between 14 and 24. [000359] [000360] In one embodiment, the composition according to the invention is characterized in that n+m is between 15 and 150.In one embodiment, the composition according to the invention is characterized in that n+m is between 10 and 100. [000361] In one embodiment, the composition according to the invention is characterized in that n+m is between 15 and 100. [000362] In one embodiment, the composition according to the invention is characterized in that n+m is between 10 and 80. [000363] In one embodiment, the composition according to the invention is characterized in that n+m is between 15 and 80. [000364] In one embodiment, the composition according to the invention is characterized in that n+m is between 10 and 65. [000365] In one embodiment, the composition according to the invention is characterized in that n+m is between 15 and 65.[000366] In one embodiment, the composition according to the invention is characterized in that n+m is between 20 and 60. [000367] In one embodiment, the composition according to the invention is characterized in that n+m is between 20 and 50. [000368] In one embodiment, the composition according to the invention is characterized in that n+m is between 20 and 40. [000369] In one embodiment, the composition according to the invention is characterized in that n+m is between 16 and 26. [000370] In one embodiment, the composition according to the invention is characterized in that n+m is between 17 and 25. [000371] In one embodiment, the composition according to the invention is characterized in that n+m is between 18 and 24. [000372] In one embodiment, the composition according to the invention is characterized in that n+m is between 19 and 23. [000373] In one embodiment, the composition according to the invention is characterized in that n+m is between 20 and 22. [000374] In one embodiment, the composition according to the invention is characterized in that n’+m’ is between 10 and 150. [000375] In one embodiment, the composition according to the invention is characterized in that n’+m’ is between 15 and 100. [000376] In one embodiment, the composition according to the invention is characterized in that n’+m’ is between 15 and 50. [000377] In one embodiment, the composition according to the invention is characterized in that n’+m’ is between 15 and 40. [000378] In one embodiment, the composition according to the invention is characterized in that n’+m’ is between 15 and 30. [000379] The average sum of glutamate and pyroglutamate in co-polyamino acid bearing carboxylate charges and hydrophobic radicals Hy is abbreviated SumG+P. [000380] The SumG+P is the mole ratio of the glutamate monomer precursor used per hydrophobic graft (Hy) in the synthesis.[000381] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 10 and 150. [000382] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 15 and 150 [000383] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 10 and 100. [000384] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 15 and 100. [000385] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 10 and 80. [000386] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 15 and 80. [000387] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 10 and 65. [000388] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 15 and 65. [000389] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 30 and 60. [000390] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 10 and 50. [000391] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 10 and 30. [000392] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 15 and 25. [000393] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 20 and 50. [000394] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 20 and 40. [000395] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 17 and 27. [000396] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 18 and 26.[000397] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 19 and 25. [000398] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 20 and 24. [000399] In one embodiment, the composition according to the invention is characterized in that SumG+P is between 21 and 23. [000400] In one embodiment, the composition according to the invention is characterized in that SumG+P is 22. [000401] In a preferred embodiment, the composition comprises a co-polyamino acid according to formula XXXb’ or XXXb”, in particular XXXb’:formula XXXb’ in which m, X, D, R’ 1 and R2 have the definitions given above and R2 is a hydrophobic radical -Hy, orFormula XXXb’’ in which m, X, D, R1and R’2have the definitions given above and R1is a hydrophobic radical -Hy, said radical -Hy is chosen from the group of hydrophobic radicals from formula XFormula X in which: - r is an integer equal to 0 or to 1, in particular r = 1, and GpR is a radical according to Formula VIIFormula VII - g = 0, - a = 0 - a’ = 1 - l = 1 and GpL is a radical according to formula XII:Formula XII, - A is a linear or branched alkyl radical and / or substituted by a radical derived from a saturated, unsaturated or aromatic ring, comprising 1 to 8 carbon atoms, in particular A is a linear or branched alkyl radical comprising 1 to 8 carbon atoms, more particularly A is a linear alkyl radical comprising 5 carbon atoms, - l’ = 2 - h = 1, 2 or 3, in particular h = 1, and GpH is a radical according to Formula XI:Formula XI - G is a branched alkyl radical of 1 to 8 carbon atoms, with said alkyl radical bearing one or more free carboxylic acid functions, in particular one free carboxylic acid function, - GpC is a radical according to formula IX:in which b = 0; e = 1; c = 0 or 1; d = 0, 1, or 2; and if c is equal to 0, then d is equal to 1 or to 2; in particular c = 0 and d = 1, - Cx is a linear or branched monovalent alkyl radical, and / or comprising a cyclic part, in which x indicates the number of carbon atoms and when the hydrophobic radical -Hy carries 2 -GpC, then 9 ≤ x ≤ 15, in particular x = 13, - the hydrophobic radical(s) -Hy according to formula X being bonded to the PLG: o via a covalent bond between a carbonyl of the hydrophobic radical -Hy and a nitrogen atom borne by the PLG, thus forming an amide function derived from the reaction of an amine function borne by the PLG and an acid function borne by the precursor -Hy’ of the hydrophobic radica -Hy, or o via a covalent bond between a nitrogen atom of the hydrophobic radical -Hy and a carbonyl borne by the PLG, thus forming an amide function derived from the reaction of an amine function of the precursor -Hy’ of the hydrophobic -Hy radical and an acid function borne by the PLG, - the ratio M between the number of hydrophobic radicals and the number of glutamic or aspartic units being from 0.01 < M ≤ 0.4, in particular from 0.02 to 0.1, - when several hydrophobic radicals are borne by a co-polyamino acid, then they are identical or different, - the degree of polymerization DP in glutamic or aspartic units for PLG chains is comprised from 5 to 250, in particular from 10 to 50, - free carboxylic acid functions being in the form of an alkali metal salt chosen from the group consisting of Na+and K+. [000402] In a preferred embodiment, the composition comprises a co-polyamino acid as represented below:wherein- M = 0.02 to 0.1, DP or n = 10 to 50, R1 = H or pyroglutamate, in particular with n = 21, R1 = H or pyroglutamate, with at least 95% pyroglutamate. [000403] In a preferred embodiment the composition comprises a co-polyamino acid as defined in the 2 paragraphs above. [000404] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 17 and 27, R1 = H or pyroglutamate with at least 90% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000405] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 19 and 25, R1 = H or pyroglutamate with at least 90% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000406] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 20 and 24 R1 = H or pyroglutamate with at least 90% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000407] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 21 and 23, R1 = H or pyroglutamate with at least 90% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000408] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 17 and 27, R1 = H or pyroglutamate with at least 95% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08.[000409] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 19 and 25, R1 = H or pyroglutamate with at least 95% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000410] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 20 and 24 R1 = H or pyroglutamate with at least 95% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000411] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 21 and 23, R1 = H or pyroglutamate with at least 95% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000412] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 17 and 27, R1 = H or pyroglutamate with at least 98% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000413] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 19 and 25, R1 = H or pyroglutamate with at least 98% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000414] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 20 and 24 R1 = H or pyroglutamate with at least 98% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000415] In a most preferred embodiment, the composition comprises a co-polyamino acid according to Formula A, where SumG+P is between 21 and 23, R1 = H or pyroglutamate with at least 98% pyroglutamate, in particular with a Ð being less than 1.2, more particularly being less than 1.1, and more particularly being less than 1.08. [000416] According to an embodiment, the co-polyamino acid is as defined in WO2019 / 110774.[000417] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by polymerization. [000418] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by ring-opening polymerization of a N-carboxy anhydride derivative of glutamic acid or of a N-carboxy anhydride derivative of aspartic acid. [000419] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by ring-opening polymerization of a N-carboxyanhydride derivative of glutamic acid or of a N-carboxy anhydride derivative of aspartic acid as described in the article from the journal Adv. Polym. Sci.2006, 202, 1-18 (Deming, T.J.). [000420] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by ring opening polymerization of a N-carboxy anhydride derivative of glutamic acid. [000421] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid comes from a polyamino acid obtained by ring-opening polymerization of a N-carboxy anhydride derivative of glutamic acid chosen from the group constituted by N-carboxyanhydride methyl glutamate (GluOMe- NCA), N-carboxy anhydride benzyl glutamate (GluOBzl-NCA) and N-carboxy anhydride t-butyl glutamate (GluOtBu-NCA). [000422] In one embodiment, the N-carboxy anhydride glutamic acid derivative is methyl L-glutamate N-carboxy anydride (L-GluOMe-NCA). [000423] In one embodiment, the N-carboxy anhydride glutamic acid derivative is benzyl L-glutamate N-carboxy anydride (L-GluOBzl-NCA). [000424] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid comes from a polyamino acid obtained by ring opening polymerization of a N-carboxyanhydride derivative of glutamic acid or a N-carboxyanhydride derivative of aspartic acid using an organo-metallic compound of a transition metal as an initiator as described in the publication Nature 1997, 390, 386-389 (Deming, T. J.). [000425] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by ring opening polymerization of a N-carboxyanhydride derivative of glutamic acid or a N-carboxyanhydride derivative of aspartic acid using ammonia or a primary amineas described in French patent FR 2,801,226 (Touraud, F., et al.) and the references cited by this patent. [000426] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by ring opening polymerization of a N-carboxyanhydride derivative of glutamic acid or a N-carboxyanhydride derivative of aspartic acid using hexamethyldisilazide as described in the publication J. Am. Chem. Soc. 2007, 129, 14114-14115 (Lu H. ; et al.) or a silylated amine as described in the publication J. Am. Chem. Soc.2008, 130, 12562-12563 (Lu H. ; et al.). [000427] In one embodiment, the composition according to the invention is characterized in that the process for synthesizing the polyamino acid obtained by ring opening polymerization of a N-carboxyanhydride derivative of glutamic acid or a N- carboxyanhydride derivative of aspartic acid from which the co polyamino acid results comprises a stage of ester functions hydrolysis. [000428] In one embodiment, this step of ester functions hydrolysis may consist of hydrolysis in an acidic medium or hydrolysis in a basic medium or be carried out by hydrogenolysis. [000429] In one embodiment, this ester groups hydrolysis step is carried out by hydrolysis in an acidic medium. [000430] In one embodiment, this ester groups hydrolysis step is carried out by hydrolysis in a basic medium. [000431] In one embodiment, this ester groups hydrolysis step is carried out by hydrogenolysis. [000432] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by depolymerization of a polyamino acid of a higher molecular weight. [000433] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by enzymatic depolymerization of a polyamino acid of a higher molecular weight. [000434] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by chemical depolymerization of a polyamino acid of a higher molecular weight. [000435] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtainedby enzymatic and chemical depolymerization of a polyamino acid of a higher molecular weight. [000436] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by depolymerization of a polyamino acid of a higher molecular weight chosen from the group constituted by sodium polyglutamate and sodium polyaspartate. [000437] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by depolymerization of a sodium polyglutamate of a higher molecular weight. [000438] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is the result of a polyamino acid obtained by depolymerization of a sodium polyaspartate of a higher molecular weight. [000439] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is obtained by grafting a hydrophobic group onto a poly-L-glutamate acid or a poly-L-aspartate acid by using the amide bond formation process well-known to the person versed in the art. [000440] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is obtained by grafting a hydrophobic group onto a poly-L-glutamate acid or a poly-L-aspartate acid by using the amide bond formation process used for peptide synthesis. [000441] In one embodiment, the composition according to the invention is characterized in that the co-polyamino acid is obtained by grafting a hydrophobic group onto a poly-L-glutamate acid or a poly-L-aspartate acid as described in French patent FR 2,840,614 (Chan, Y.P.; et al.). [000442] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is at most 60 mg / ml. [000443] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is at most 40 mg / ml. [000444] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is at most 20 mg / ml. [000445] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is at most 10 mg / ml. [000446] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is at most 5 mg / ml.[000447] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is at most 2.5 mg / ml. [000448] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is ranging from 2.5 to 60 mg / ml. [000449] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is ranging from 5 to 50 mg / ml. [000450] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is ranging from 7.5 to 40 mg / ml. [000451] In one embodiment, the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is ranging from 10 to 30 mg / ml. [000452] According to an embodiment, the composition does not comprise a basal insulin for which the isoelectric point, pI, is comprised from 5.8 to 8.5. [000453] According to an embodiment, the composition does not comprise insulin glargine. [000454] According to an embodiment, the composition does not comprise human amylin. [000455] According to an embodiment, the composition does not comprise pramlintide. [000456] According to an embodiment, the composition does not comprise glucagon. [000457] According to an embodiment, the composition does not comprise human glucagon. [000458] According to the invention, the peptide 1 is a GLP-1 receptor agonist having an isolectric point pI1 of less than 6.5. [000459] In an embodiment, the peptide 1 is a long-acting peptide. By “long-acting peptide is meant a peptide having a half-life in humans of more than 48 hours. [000460] By “half-life” is meant the terminal half-life following the subcutaneous administration of the peptide. [000461] In an embodiment the peptide 1 is acylated or lipidated by a graft comprising an alkyl comprising from 12 to 30 carbon atoms and bearing at its extremity a methyl, a carboxylate, a sulphate, a sulfonate, a phosphate, or a phosphonate. [000462] In an embodiment the peptide 1 is acylated by a graft comprising a divalent alkyl comprising from 12 to 30 carbon atoms and bearing at its extremity carboxylate.[000463] In an embodiment, the peptide 1 is acylated with an acyl graft comprising at least one C-18 to C-30 fatty diacid, linked with or without a linker to a residue of the peptide. [000464] The term “GLP-1” or “native GLP-1” herein refers to human Glucagon-Like Peptide-1 (GLP-1 (7-37)). [000465] A “GLP-1 receptor agonist” may be defined as a ligand which is capable of binding to the GLP-1 receptor and producing a biological response similar to that of the endogenous ligand, glucagon-like peptide 1 (GLP-1 (7-37)). A "full" GLP-1 receptor agonist may be defined as a GLP-1 receptor agonist which is capable of eliciting a biological response of the same magnitude as GLP-1 (7-37). [000466] The GLP-1 receptor agonist is capable of binding to and activating, or “agonising” the GLP-1 receptor; in other words, it is “potent” on the GLP-1 receptor. The in vitro potency of the GLP-1 receptor agonist on the GLP-1 receptor may be measured as described in WO2022 / 129526, Assay 1. The potency of the compound may be described by means of its EC50 values, wherein EC50 represents the concentration of compound upon which 50% of its maximal effect is observed. The lower the EC50 value, the more potent the compound. [000467] When tested as described in WO2022 / 129526, Assay 1 , the GLP-1 receptor agonist disclosed herein may have an EC50 value of less than 300 pM, such as less than 200 pM, such as less than 150 pM, preferably less than 100 pM, such as less than 75 pM, even more preferably less than 50 pM, such as less than 40 pM, such as less than 30 pM, such as less than 20 pM, such as less than 10 pM. [000468] In an embodiment, the peptide 1 is a GLP-1 RA which is chosen in the group consisting of dual or triple GLP-1 RA agonist. [000469] In an embodiment, the peptide 1 is a GLP-1 RA which is chosen in the group consisting of GLP-1 single agonist, GLP-1 / Glucagon, GLP-1 / GIP, GLP-1 / GLP-2 dual agonist and GLP-1 / GIP / Glucagon triple agonist. [000470] In an embodiment, the peptide 1 is a GLP-1 single agonist [000471] In an embodiment, the peptide 1 is a GLP-1 / Glucagon dual agonist. [000472] In an embodiment, the peptide 1 is a GLP-1 / GIP dual agonist. [000473] In an embodiment, the peptide 1 is a GLP-1 / GLP-2 dual agonist. [000474] In an embodiment, the peptide 1 is a GLP-1 / GIP / Glucagon triple agonist.[000475] According to an embodiment peptide 1 is chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide. [000476] According to an embodiment peptide 1 is chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide. [000477] Ecnoglutide is a compound having the following sequence (SEQ ID NO:1) as shown below: [000478] HVEGTFTSDVSSYLEEQAAREFIKWLVRGRG wherein the lysine at position 24 is chemically modified through conjugation to the epsilon-amine group of the lysine side chain withwherein the dashed line indicates attachment to the epsilon-amine group of the lysine side chain of the lysine at position 24. [000479] Tirzepatide, has the following sequence (SEQ ID NO: 2) as shown below: YAibEGTFTSDYSIAibLDKIAQKAFVQWLIAGGPSSGAPPPS wherein the lysine at position 20 is chemically modified through conjugation to the epsilon-amine group of the lysine side-chain with ([2-(2-amino-ethoxy)-ethoxy]-acety)2-(gammaGlu)1-CO-(CH2)18- CO2H; and the C-terminal serine, i e. the serine at position 39, is amidated as a C-terminal primary amide. [000480] The moiety ([2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(gammaGlu)1-CO- (CH2)18-COOH has the following structurewherein the dashed line indicates attachment to the epsilon-amine group of the lysine 20. [000481] CT388 has the following sequence (SEQ ID NO: 3) disclosed by either Formula A1 or Formula B1:Formula B1 [SEQ ID NO: 3] [000482] Survodutide has the following sequence (SEQ ID NO: 4) as shown below: HX1QGT FTSDY SKYLD ERAAK DFIKW LESA wherein - X1 is 1-amino-cyclobutanecarboxylic acid (Ac4c); - the lysine at position 24 is chemically modified through conjugation to the epsilon- amine group of the lysine side-chain with [17-carboxy-heptadecanoyl]-isoGlu- GSGSGG; and - the C-terminal alanine, i.e. the alanine at position 29, is amidated as a C-terminal primary amide [000483] The moiety [17-carboxy-heptadecanoyl]-isoglu GSGSGG has the following structure:wherein the dash line indicates attachment to the epsilon-amine group of the lysine 24side-chain. [000484] Pemvidutide has the following sequence (SEQ ID NO: 5) as show below: HAibQGT FTSDY SKYLD E*K#AAK* EFIQW LLQT-NH21His-2Aib-3Gln-4Gly-5Thr-6Phe-7Thr-8Ser-9Asp-10Tyr-11Ser-12Lys-13Tyr-14Leu-15Asp-16Glu*-17Lys#-18Ala-19Ala-20Lys*-21Glu-22Phe-23Ile-24Gln-25Trp-26Leu-27Leu-28Gln-29Thr- NH2, where * indicates a lactam bridge is formed between Glu16 and Lys 20, and 17Lys# indicates the attachment site for glucuronic acid C-18 *(EuPort G, Z17CO2H). [000485] Illustrated differently, pemvidutide is a peptide amide consisting of 29 amino acid residues and a glucuronic acid / C18 diacid moiety attached to17Lys, in which the side-chains of16Glu and20Lys forming an intramolecular cycle as shown below:[000486] Mazdutide, has the following sequence (SEQ ID NO:6) as shown below: H2N-H-Aib-Q-G-T-F-T-S-D-Y-S-K-Y-L-D-E-K-K-A-K-E-F-V-E-W-L-L-E-G-G-P-S-S-G- NH2 wherein lysine (K) at position 20 is chemically modified by conjugation of the epsilon-amino group of the lysine side chain with ([2-(2-aminoethoxy)-ethoxy]- acetyl)2-(γ-Glu)-CO-(CH2)18CO2H.[000487] Illustrated differently Mazdutide has the following structure[000488] Retatrutide has the following sequence (SEQ ID NO:7) according to the following structure:[000490] Dapiglutide has the following sequence (SEQ ID NO:8) as shown below: HXiEGSFTSELATILDKQAARDFIAWLIQHKITD (SEQ ID NO:50), wherein - Xi is Aib; and - the lysine in position 16 is chemically modified by conjugation of the epsilon-amino- group of the lysine side chain with [17-carboxy-heptadecanoyl]-isoGlu. [000491] The moiety [17-carboxy-heptadecanoyl]-isoGlu has the following structure:wherein the dashed line indicates attachment to the epsilon-amino- group of the lysine 16 side chain. [000492] According to an embodiment peptide 1 is ecnoglutide. [000493] According to an embodiment peptide 1 is tirzepatide.[000494] According to an embodiment peptide 1 is CT388 (from Roche). [000495] According to an embodiment peptide 1 is survodutide. [000496] According to an embodiment peptide 1 is pemvidutide. [000497] According to an embodiment peptide 1 is mazdutide. [000498] According to an embodiment peptide 1 is retatrutide. [000499] According to an embodiment peptide 1 is dapiglutide. [000500] According to an embodiment, peptide 1 is different from liraglutide. [000501] Liraglutide is not a long-acting peptide, as its half-life in humans is far less than 48h. According to its Summary of Product Characteristics (from EMA), liraglutide has a half-life after subcutaneaous administration of approximately 13h. [000502] In an embodiment, the peptide 1 is comprised in a concentration ranging from 0.25 to 30 mg / ml. [000503] In an embodiment, the peptide 1 is comprised in a concentration ranging from 1 to 28 mg / ml. [000504] In an embodiment, the peptide 1 is comprised in a concentration ranging from 2 to 25 mg / ml. [000505] In an embodiment, the peptide 1 is comprised in a concentration ranging from 5 to 25 mg / ml. [000506] In an embodiment, the peptide 1 is comprised in a concentration ranging from 10 to 25 mg / ml. [000507] In an embodiment, the peptide 1 is comprised in a concentration ranging from 15 to 25 mg / ml. [000508] In an embodiment, the peptide 1 is comprised in a concentration ranging from 2 to 20 mg / ml. [000509] In an embodiment, the peptide 1 is comprised in a concentration ranging from 2 to 15 mg / ml. [000510] In an embodiment, the peptide 1 is comprised in a concentration ranging from 3 to 12 mg / ml. [000511] In an embodiment, the peptide 1 is comprised in a concentration ranging from 5 to 10 mg / ml. [000512] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide,mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 0.25 to 30 mg / ml. [000513] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 0.25 to 30 mg / ml. [000514] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 1 to 28 mg / ml. [000515] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 1 to 28 mg / ml. [000516] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 2 to 25 mg / ml. [000517] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 2 to 25 mg / ml. [000518] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 5 to 25 mg / ml. [000519] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 5 to 25 mg / ml. [000520] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 10 to 25 mg / ml.[000521] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 10 to 25 mg / ml. [000522] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 15 to 25 mg / ml. [000523] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 15 to 25 mg / ml. [000524] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 2 to 20 mg / ml. [000525] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 2 to 20 mg / ml. [000526] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 2 to 15 mg / ml. [000527] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 2 to 15 mg / ml. [000528] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 3 to 12 mg / ml. [000529] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide,mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 3 to 12 mg / ml. [000530] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide is comprised in a concentration ranging from 5 to 10 mg / ml. [000531] In an embodiment, the peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide and dapiglutide is comprised in a concentration ranging from 5 to 10 mg / ml. [000532] In a most preferred embodiment, the peptide 1 is semaglutide. [000533] Semaglutide is a GLP-1 receptor agonist also known as N<626>-{18-[N- (17-carboxyheptadecanoyl)-L-y-glutamyl]-10-oxo-3,6,12,15-tetraoxa-9,18- diazaoctadecanoyl}-[8-(2-amino-2-propanoic acid),34-L-arginine]human glucagon- like peptide 1 (7-37). Semaglutide was described in WO2006 / 097537 and in J. Med. Chem.2015, 58, 18, 7370-7380 and may be manufactured using methods well known to the person skilled in the art, such as that briefly described in WO2006 / 097537, Example 4. [000534] Semaglutide may be present in the composition in its fully or partly ionized form; for example one or more carboxylic acid groups (-COOH) may be deprotonated into the carboxylate group -COO- and / or one or more amino groups (-NH2) may be protonated into the -NH3+group. [000535] Semaglutide may be in the form of a salt, preferably a pharmaceutically acceptable salt. [000536] When the potency of semaglutide was tested according to the procedure described in WO2022 / 129526, Assay 1, semaglutide had an EC50 value of about 5.5 pM (see WO2022 / 129526, Tables 4b and 4c). The concentration of semaglutide in the pharmaceutical formulation disclosed herein may be from about 0.25 mg / ml to about 22 mg / ml. [000537] The concentration of semaglutide in the compositions disclosed herein may be from about 0.25 mg / ml to about 22 mg / ml. [000538] In an embodiment, the semaglutide is comprised in a concentration ranging from 0.3 to 20 mg / ml.[000539] In an embodiment, the semaglutide is comprised in a concentration ranging from 0.25 to 0.5 mg / ml, in particular is about 0.37 mg / ml. [000540] In an embodiment, the semaglutide is comprised in a concentration ranging from 0.5 to 1.0 mg / ml, in particular is about 0.75 mg / ml. [000541] In an embodiment, the semaglutide is comprised in a concentration ranging from 1.0 to 1.5 mg / ml, in particular is about 1.25 mg / ml. [000542] In an embodiment, the semaglutide is comprised in a concentration ranging from 1.5 to 2.0 mg / ml. [000543] In an embodiment, the semaglutide is comprised in a concentration ranging from 2.0 to 2.5 mg / ml. [000544] In an embodiment, the semaglutide is comprised in a concentration ranging from 2.5 to 3.0 mg / ml. [000545] In an embodiment, the semaglutide is comprised in a concentration ranging from 3.0 to 3.5 mg / ml, in particular is about 3.2 mg / ml. [000546] In an embodiment, the semaglutide is comprised in a concentration ranging from 3.5 to 4.0 mg / ml. [000547] In an embodiment, the semaglutide is comprised in a concentration ranging from 4.0 to 5.0 mg / ml. [000548] In an embodiment, the semaglutide is comprised in a concentration ranging from 5.0 to 7.5 mg / ml. [000549] In an embodiment, the semaglutide is comprised in a concentration ranging from 7.5 to 10 mg / ml. [000550] In an embodiment, the semaglutide is comprised in a concentration ranging from 10 to 15 mg / ml. [000551] In an embodiment, the semaglutide is comprised in a concentration ranging from 15 to 20 mg / ml. [000552] In an embodiment, the semaglutide is comprised in a concentration ranging from 20 to 25 mg / ml. [000553] The isoelectric point (pl) of a molecule is the pH at which the molecule carries no net charge. The pl of a peptide may be theoretically calculated from the pK values of its amino acids and of the terminal amine and carboxyl groups and can be used to predict the solubility of the peptide at a given pH.[000554] The overall net charge of a protein or peptide is related to the solution pH and can be approximated using the Henderson-Hasselbach equation (Po HN, Senozan NM. The Henderson-Hasselbalch Equation: Its History and Limitations. J Chem Educ. 2001 ;78(11): 1499). To derive the isoelectric point or find the charge of a peptide at a specific pH, the pKa values of its amino acids are considered. At pH 7.0, the carboxyl group is negative (-1) and the amino group is positive (+1). The net charge of a peptide at a given pH is the sum of the charges of the ionizable groups in the peptide at the given pH. By summing the charges of all ionizable groups, the overall charge of the peptide can be determined. [000555] Several software tools exist that can predict the charge states and aid in understanding a peptide’s behavior under different pH conditions [I PC - Isoelectric Point Calculator, Kozlowski, Lukasz P., Biology Direct (2016), 11 , 55 / 1-55 / 16], Because algorithms that consider the amino acid pKa values are utilized, predictions are not considered to diverge significantly [Principles of Biochemistry, A.L. Lehninger and M. M. Cox, 1982]. [000556] When chemical modifications are made to the peptide, these may affect the pl; however, by evaluating the pKa for the ionizable groups for the modifications, these can be accounted for in the pl prediction also by using the Henderson-Hasselback equation. An example of such “chemical modification” is a protraction moiety, such as a side chain comprising a fatty acid, that is covalently bound to the peptide. [000557] The charge of a peptide influences its solubility. Peptides with a net charge, whether positive or negative, have enhanced solubility in water because the charged groups can interact with water molecules [Pace CN, Grimsley GR, Scholtz JM. Protein ionizable groups: pK values and their contribution to protein stability and solubility. J Biol. Chem.2009;284(20): 13285-13289], [The effect of net charge on the solubility, activity, and stability of ribonuclease Sa, Shaw, Kevin L.; Grimsley, Gerald R.; Yakovlev, Gennady I.; Makarov, Alexander A.; Pace, C. Nick, Protein Science (2001), 10 (6), 1206-1215], Thus, good solubility is typically obtained at a formulation pH away from the isoelectric point where the peptide carries sufficient charge, positive or negative, to accommodate solubility. [000558] In an embodiment, the theoretically calculated isoelectric point (pI1) of the peptide 1, which is a GLP-1 receptor agonist, is in the range of 3.5 to 6.5. [000559] In an embodiment, GLP-1 receptor agonist has an isoelectric point (pI1) of less than, or equal to, 6.0 (6.0 being included).[000560] In an embodiment, GLP-1 receptor agonist has an isoelectric point (pI1) in the range of 3.5 to 6.0. [000561] In an embodiment, GLP-1 receptor agonist has an isoelectric point (pI1) in the range of 4.0 to 6.0. [000562] In an embodiment, GLP-1 receptor agonist has an isoelectric point (pI1) in the range of 4.5 to 5.5. [000563] In an embodiment, GLP-1 receptor agonist has an isoelectric point (pI1) in the range of 3.8 to 4.9. [000564] In an embodiment, GLP-1 receptor agonist has an isoelectric point (pI1) in the range of 4.0 to 4.5. [000565] In an embodiment, GLP-1 receptor agonist has an isoelectric point (pI1) in the range of 3.8 to 5.8. [000566] In an embodiment, GLP-1 receptor agonist has an isoelectric point (pI1) in the range of 3.9 to 5.7. [000567] In an embodiment, GLP-1 receptor agonist has an isoelectric point (pI1) in the range of 4.0 to 5.6. [000568] Semaglutide has a theoretically calculated isoelectric point of about 4.37. [000569] In an embodiment, the peptide 2 is chosen from the list consisting of amylin receptor agonist, also called amylin RA. [000570] In an embodiment, the theoretically calculated isoelectric point (pI2) of the peptide 2, in particular amylin receptor agonist, is superior or equal to pI1 + 2 (pI2 ≥ pI1 +2). [000571] In an embodiment, the theoretically calculated isoelectric point (pI2) of the peptide 2, in particular amylin receptor agonist, is in the range of 6 to 12. [000572] In an embodiment, the pI2 of peptide 2 is in the range of 8 to 12 [000573] In an embodiment, the pI2 of peptide 2 is in the range of 8 to 9. [000574] In an embodiment, the peptide 2 is a long-acting peptide. [000575] By “long-acting peptide is meant a peptide having a half-life in humans of more than 48 hours. [000576] By “half-life” is meant the terminal half-life following the subcutaneous administration of the peptide.[000577] In an embodiment, the peptide 2 is acylated with an acyl graft comprising at least one C-18 to C-30 fatty diacid, linked, with or without a linker, to a residue of the peptide. [000578] In an embodiment, the peptide 2 is an amylin RA. [000579] An amylin receptor agonist may bind to and activate the calcitonin receptor (CTR) and / or the amylin receptors (AMYRs). The latter consist of heterodimers of two components: the calcitonin receptor (CTR) and one of three receptor activity-modifying proteins (RAMP1-3) resulting in three possible complexes, AMYR1-3. [000580] An “amylin receptor agonist” may be defined as a chemical entity which is capable of binding to an amylin receptor and is capable of activating or “agonising” it. In the context of the current invention, the amylin receptor agonist is capable of binding to and activating at least the amylin receptor 3 (AMYR3). The amylin receptor agonist may also be capable of agonising the calcitonin receptor, the amylin receptor 1 (AMYR1) and / or the amylin receptor 2 (AMYR2). [000581] The amylin receptor agonist is capable of activating the amylin receptor; in other words, it is “potent” on the amylin receptor. The in vitro potency of the amylin receptor agonist on amylin receptor 3 may be measured as described in WO / 2022129526, Assay 2. The potency of the compound may be described by means of its EC5o value, wherein EC5o represents the concentration of compound upon which 50% of its maximal effect is observed. The lower the EC50 value, the more potent the compound. [000582] When tested as described as described in WO2022 / 129526, Assay 2, the amylin receptor agonist as disclosed herein may have an EC50 value of less than 300 pM, such as less than 200 pM, such as less than 150 pM, preferably less than 100 pM, such as less than 75 pM, preferably less than 50 pM, such as less than 40 pM, such as less than 30 pM, such as less than 20 pM, such as less than 10 pM. [000583] In an embodiment, the amylin receptor agonist amylin RA is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra), Dacra QWII (from Eli Lilly), NN 1213, and peptide A, in particular it is cagrilintide. [000584] In an embodiment, the amylin receptor agonist amylin RA is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, Dacra QWII (from Eli Lilly), NN 1213 and peptide A, in particular it is cagrilintide. [000585] In an embodiment, the amylin receptor agonist amylin RA is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from AstraZeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly), in particular it is cagrilintide. [000586] In an embodiment, the amylin receptor agonist amylin RA is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, and Dacra QWII (from Eli Lilly), in particular it is cagrilintide. [000587] Petrelintide has the following sequence (SEQ ID NO: 9): [19CD]-isoGlu-RD()GTATK()ATERLA-Aad-FLQRSSF-Gly(Me)-A-lle(Me)-LSSTEVGSNT- Hyp-NH2 wherein. - () after amino acid symbols indicate residues whose side chains participate in an intramolecular lactam bridge - Gly(Me) is N-methylglycine [also known as sarcosine (Sar)], lle(Me) is N- methylisoleucine, - Aad is 2-aminoadipic acid, e.g. (2S)-2-aminoadipic acid [also (2S)-2- aminohexanedioic acid], also known as homo-glutamic acid - Hyp is 4-hydroxyproline - [19CD]-isoGlu- is a 19-carboxy-nonadecanoyl group [19CD] covalently attached via an amide linkage to the alpha amino group of an isoGlu linker, wherein the side chain carboxyl group of the isoGlu linker is covalently attached via an amide linkage to the backbone nitrogen of the Arg residue at position X1 of the petrelintide sequence (as described above); or a pharmaceutically acceptable salt or solvate thereof. [000588] Eloralintide, has the following sequence (SEQ ID NO: 10): {γGlu}-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gly-{Orn}-Leu-Ala-Glu-{(α-Me-Phe)}-Leu- Val-Arg-Ser-Ser-Asn-{(N-Me-Asn)}-Phe-Gly-Pro-{Lys(γGlu-γGlu-C20 diacid)}-Leu- Pro-Pro-Thr-Glu-Val-Gly-Ser-Asn-Thr-Tyr-NH2, with a methylene bridge between Cys2 and Cys7. [000589] Dacra QWII, also called colulintide, has the following sequence (SEQ ID NO: 11): ASHLS TAVLG KLSXE LHKLE DYPRT DVGAE SP 1 11 14 Lys11: N6-(N-(HYDROGEN ICOSANEDIOYL)-GAMMA-GLU- BIS(IMINOBIS(ETHYLENOXY)ACETYL))-LYSINE N-term : N-acetyl Alanine Site 14: X = Aib Also defined by N-acetyl-L-alanyl-L-seryl-L-histidyl-L-leucyl-L-seryl-L-threonyl-L-alanyl-L-valyl-L- leucyl-glycyl-N6-[(22S)-22,42-dicarboxy-10,19,24-trioxo-3,6,12,15-tetraoxa-9,18,23- triazadotetracontan-1-oyl]-L-lysyl-L-leucyl-L-seryl-2-methylalanyl-L- glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutamyl-L-aspartyl-L-tyrosinyl-L- prolyl-L-arginyl-L-threonyl-L-aspartyl-L-valyl-glycyl-L-alanyl-L-glutamyl-L-seryl-L- prolinamide [000590] Peptide A, has the following sequence (SEQ ID NO: 12):Wherein - C20DA and [gammaE] are of the following structureand - Hyp is 4-hydroxyproline. [000591] The dash line for C20DA meaning attachment to the amine of [gamma E] and the right dash line from [gammaE] meaning attachement to Lys [000592] NN 1213 has the following sequence:[000593] In an embodiment, the amylin receptor agonist amylin RA is petrelintide. [000594] In an embodiment, the amylin receptor agonist amylin RA is eloralintide [000595] In an embodiment, the amylin receptor agonist amylin RA is AZ6234 (from Astra Zeneca). [000596] In an embodiment, the amylin receptor agonist amylin RA is gubamy (from Gubra).[000597] In an embodiment, the amylin receptor agonist amylin RA is Dacra QWII (from Eli Lilly). [000598] In an embodiment, the amylin receptor agonist amylin RA is peptide A. [000599] In an embodiment, the amylin receptor agonist amylin RA is NN 1213. [000600] In an embodiment, the peptide 2 is comprised in a concentration ranging from 0.25 to 30 mg / ml. [000601] In an embodiment, the peptide 2 is comprised in a concentration ranging from 1 to 28 mg / ml. [000602] In an embodiment, the peptide 2 is comprised in a concentration ranging from 2 to 25 mg / ml. [000603] In an embodiment, the peptide 2 is comprised in a concentration ranging from 5 to 25 mg / ml. [000604] In an embodiment, the peptide 2 is comprised in a concentration ranging from 10 to 25 mg / ml. [000605] In an embodiment, the peptide 2 is comprised in a concentration ranging from 15 to 25 mg / ml. [000606] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 2 to 20 mg / ml. [000607] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 2 to 15 mg / ml. [000608] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 3 to 12 mg / ml. [000609] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 5 to 10 mg / ml. [000610] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 0.25 to 30 mg / ml. [000611] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 1 to 28 mg / ml. [000612] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 2 to 25 mg / ml. [000613] In an embodiment, the peptide 2 is an amylincomprised in a concentration ranging from 5 to 25 mg / ml.[000614] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 10 to 25 mg / ml. [000615] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 15 to 25 mg / ml. [000616] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 2 to 20 mg / ml. [000617] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 2 to 15 mg / ml. [000618] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 3 to 12 mg / ml. [000619] In an embodiment, the peptide 2 is an amylin RA comprised in a concentration ranging from 5 to 10 mg / ml. [000620] In an embodiment, the amylin receptor agonist amylin RA is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra), Dacra QWII (from Eli Lilly), NN 1213, and peptide A, in particular it is cagrilintide comprised in a concentration ranging from 0.25 to 30 mg / ml. [000621] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly) comprised in a concentration ranging from 0.25 to 30 mg / ml. [000622] In an embodiment, the amylin receptor agonist amylin RA is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, Dacra QWII, NN 1213 and peptide A, in particular it is cagrilintide comprised in a concentration ranging from 0.25 to 30 mg / ml. [000623] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, and Dacra QWII comprised in a concentration ranging from 0.25 to 30 mg / ml. [000624] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly) comprised in a concentration ranging from 1 to 28 mg / ml. [000625] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (fromGubra) and Dacra QWII (from Eli Lilly) comprised in a concentration ranging from 2 to 25 mg / ml. [000626] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly) comprised in a concentration ranging from 5 to 25 mg / ml. [000627] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly) comprised in a concentration ranging from 10 to 25 mg / ml. [000628] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly) comprised in a concentration ranging from 15 to 25 mg / ml. [000629] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly) comprised in a concentration ranging from 2 to 20 mg / ml. [000630] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly) comprised in a concentration ranging from 2 to 15 mg / ml. [000631] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly) comprised in a concentration ranging from 3 to 12 mg / ml. [000632] In an embodiment, the peptide 2 is chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly) is comprised in a concentration ranging from 5 to 10 mg / ml. [000633] In a preferred embodiment, the amylin receptor agonist in the compositions disclosed herein may be cagrilintide or a biologically active metabolite or degradation product of cagrilintide. [000634] Cagrilintide has a theoretically calculated isoelectric point of about 8.56.[000635] Cagrilintide, also called AM833, is disclosed as Example 53 in WO2012 / 168432: N-alpha-[(S)-4-Carboxy-4-(19- carboxynonadecanoylamino)butyryl]-[Glu14,Arg17,Pro37]-pramlintide. Cagrilintide may be prepared as described in WO2012 / 168432, pages 153-155. [000636] Cagrilintide may be in the form of a salt, preferably a pharmaceutically acceptable salt. [000637] A biologically active metabolite or degradation product of cagrilintide may have an aspartate (Asp) in position 21 or 22. A biologically active metabolite or degradation product of cagrilintide may have an iso-aspartate (iso-Asp) in position 21 or 22. [000638] When the potency of cagrilintide was tested using the procedure described in WO2022129526, Assay 2, cagrilintide had an EC50value of about 11 pM (WO2022 / 129526, Tables 4b and 4c). [000639] In an embodiment, the concentration of cagrilintide is going from about 0.25 mg / ml to about 22 mg / ml. [000640] In an embodiment, the concentration of cagrilintide is going from 0.3 to 20 mg / ml. [000641] In an embodiment, the concentration of cagrilintide is going from about 0.25 to 0.5 mg / ml, in particular is about 0.37 mg / ml. [000642] In an embodiment, the concentration of cagrilintide is going from about 0.5 to 1.0 mg / ml, in particular is about 0.75 mg / ml. [000643] In an embodiment, the concentration of cagrilintide is going from about 1.0 to 1.5 mg / ml, in particular is about 1.25 mg / ml. [000644] In an embodiment, the cagrilintide is comprised in a concentration ranging from 1.5 to 2.0 mg / ml. [000645] In an embodiment, the cagrilintide is comprised in a concentration ranging from 2.0 to 2.5 mg / ml. [000646] In an embodiment, the cagrilintide is comprised in a concentration ranging from 2.5 to 3.0 mg / ml. [000647] In an embodiment, the cagrilintide is comprised in a concentration ranging from 3.0 to 3.5 mg / ml, in particular about 3.25 mg / ml. [000648] In an embodiment, the cagrilintide is comprised in a concentration ranging from 3.5 to 4.0 mg / ml.[000649] In an embodiment, the cagrilintide is comprised in a concentration ranging from 4.0 to 5.0 mg / ml. [000650] In an embodiment, the cagrilintide is comprised in a concentration ranging from 5.0 to 7.5 mg / ml. [000651] In an embodiment, the cagrilintide is comprised in a concentration ranging from 7.5 to 10 mg / ml. [000652] In an embodiment, the cagrilintide is comprised in a concentration ranging from 10 to 15 mg / ml. [000653] In an embodiment, the cagrilintide is comprised in a concentration ranging from 15 to 20 mg / ml. [000654] In an embodiment, the cagrilintide is comprised in a concentration ranging from 20 to 25 mg / ml. [000655] In an embodiment, the weight ratio semaglutide / cagrilintide is going from 0.1 to 10. [000656] In an embodiment, the weight ratio semaglutide / cagrilintide is going from 0.2 to 5. [000657] In an embodiment, the weight ratio semaglutide / cagrilintide is going from 0.3 to 3. [000658] In an embodiment, the weight ratio semaglutide / cagrilintide is going from 0.5 to 2. [000659] In an embodiment, the weight ratio semaglutide / cagrilintide is going from 0.8 to 1.2. [000660] In an embodiment, the weight ratio semaglutide / cagrilintide is going from 0.9 to 1.1. [000661] In an embodiment, the weight ratio semaglutide / cagrilintide is about 1. [000662] In an embodiment the compositions comprise 3.2 mg of cagrilintide and 3.2 mg of semaglutide. [000663] The pH of compositions according to the invention is comprised in a range from 5.0 to 6.0. [000664] According to an embodiment, the pH of 6.0 can be disclaimed from the ranges of pH. [000665] According to an embodiment, the pH of exactly 6.0 can be disclaimed from the ranges of pH.In an embodiment the pH is comprised in a range from 5.0 to 5.9.[000666] In an embodiment the pH is between the exact values of 5.0 and 5.9. [000667] In an embodiment the pH is comprised in a range from 5.1 to 5.9. [000668] In an embodiment the pH is between the exact values of 5.1 and 5.9. [000669] In an embodiment the pH is comprised in a range from 5.2 to 5.9. [000670] In an embodiment the pH is between the exact values of 5.2 and 5.9. [000671] In an embodiment the pH is comprised in a range from 5.2 to 5.8. [000672] In an embodiment the pH is between the exact values of 5.2 and 5.8. [000673] In an embodiment the pH is comprised in a range from 5.2 to 5.7. [000674] In an embodiment the pH is between the exact values of 5.2 and 5.7. [000675] In an embodiment the pH is comprised in a range from 5.2 to 5.6. [000676] In an embodiment the pH is between the exact values of 5.2 and 5.6. [000677] In an embodiment the pH is comprised in a range from 5.3 to 5.5. [000678] In an embodiment the pH is between the exact values of 5.3 and 5.5. [000679] In an embodiment the pH is comprised in a range from 5.5 to 6.0. [000680] In an embodiment the pH is between the exact values of 5.5 and 6.0. [000681] In an embodiment the pH is comprised in a range from 5.5 to 5.9. [000682] In an embodiment the pH is between the exact values of 5.5 and 5.9. [000683] In one embodiment, the hydrophobic radical to peptide 1 and 2 molar ratio [Hy] / [peptide 1] + [peptide 2] ≤ 6. [000684] In one embodiment, the hydrophobic radical to peptide 1 and 2 molar ratio [Hy] / [peptide 1] + [peptide 2] ≤ 5. [000685] In one embodiment, the hydrophobic radical to peptide 1 and 2 molar ratio [Hy] / [peptide 1] + [peptide 2] ≤ 4. [000686] In one embodiment, the hydrophobic radical to peptide 1 and 2 molar ratio [Hy] / [peptide 1] + [peptide 2] ≤ 3. [000687] In one embodiment, the hydrophobic radical to peptide 1 and 2 molar ratio [Hy] / [peptide 1] + [peptide 2] ≥ 1. [000688] In one embodiment, the hydrophobic radical to peptide 1 and 2 molar ratio [Hy] / [peptide 1] + [peptide 2] ≥ 1.5. [000689] In one embodiment, the hydrophobic radical to peptide 1 and 2 molar ratio [Hy] / [peptide 1] + [peptide 2] ≥ 2.[000690] In one embodiment, the hydrophobic radical to peptide 1 and 2 molar ratio [Hy] / [peptide 1] + [peptide 2] ≥ 2.5. [000691] In an embodiment, the compositions according to the invention comprise - a peptide 1 chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388 (from Roche), survodutide, pemvidutide, mazdutide, retatrutide, dapiglutide, in particular semaglutide and - a peptide 2 chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234 (from Astra Zeneca), gubamy (from Gubra) and Dacra QWII (from Eli Lilly), in particular it is cagrilintide. [000692] In an embodiment, the compositions according to the invention comprise semaglutide and cagrilintide. [000693] In an embodiment, the compositions according to the invention comprise semaglutide and petrelintide. [000694] In an embodiment, the compositions according to the invention comprise semaglutide and eloralintide. [000695] In an embodiment, the compositions according to the invention comprise semaglutide and AZ6234 (from Astra Zeneca). [000696] In an embodiment, the compositions according to the invention comprise semaglutide and gubamy (from Gubra). [000697] In an embodiment, the compositions according to the invention comprise semaglutide and Dacra QWII (from Eli Lilly). [000698] In an embodiment, the compositions according to the invention comprise tirzepatide and cagrilintide. [000699] In an embodiment, the compositions according to the invention comprise tirzepatide and petrelintide. [000700] In an embodiment, the compositions according to the invention comprise tirzepatide and eloralintide. [000701] In an embodiment, the compositions according to the invention comprise tirzepatide and AZ6234 (from Astra Zeneca). [000702] In an embodiment, the compositions according to the invention comprise tirzepatide and gubamy (from Gubra). [000703] In an embodiment, the compositions according to the invention comprise tirzepatide and Dacra QWII (from Eli Lilly).[000704] In an embodiment, the compositions according to the invention comprise ecnoglutide and cagrilintide. [000705] In an embodiment, the compositions according to the invention comprise ecnoglutide and petrelintide. [000706] In an embodiment, the compositions according to the invention comprise ecnoglutide and eloralintide. [000707] In an embodiment, the compositions according to the invention comprise ecnoglutide and AZ6234 (from Astra Zeneca). [000708] In an embodiment, the compositions according to the invention comprise ecnoglutide and gubamy (from Gubra). [000709] In an embodiment, the compositions according to the invention comprise ecnoglutide and Dacra QWII (from Eli Lilly). [000710] In an embodiment, the compositions according to the invention comprise CT388 and cagrilintide. [000711] In an embodiment, the compositions according to the invention comprise CT388 and petrelintide. [000712] In an embodiment, the compositions according to the invention comprise CT388 and eloralintide. [000713] In an embodiment, the compositions according to the invention comprise CT388 and AZ6234 (from Astra Zeneca). [000714] In an embodiment, the compositions according to the invention comprise CT388 and gubamy (from Gubra). [000715] In an embodiment, the compositions according to the invention comprise CT388 and Dacra QWII (from Eli Lilly). [000716] In an embodiment, the compositions according to the invention comprise survodutide and cagrilintide. [000717] In an embodiment, the compositions according to the invention comprise survodutide and petrelintide. [000718] In an embodiment, the compositions according to the invention comprise survodutide and eloralintide. [000719] In an embodiment, the compositions according to the invention comprise survodutide and AZ6234 (from Astra Zeneca).[000720] In an embodiment, the compositions according to the invention comprise survodutide and gubamy (from Gubra). [000721] In an embodiment, the compositions according to the invention comprise survodutide and Dacra QWII (from Eli Lilly). [000722] In an embodiment, the compositions according to the invention comprise pemvidutide and cagrilintide. [000723] In an embodiment, the compositions according to the invention comprise pemvidutide and petrelintide. [000724] In an embodiment, the compositions according to the invention comprise pemvidutide and eloralintide. [000725] In an embodiment, the compositions according to the invention comprise pemvidutide and AZ6234 (from Astra Zeneca). [000726] In an embodiment, the compositions according to the invention comprise pemvidutide and gubamy (from Gubra). [000727] In an embodiment, the compositions according to the invention comprise pemvidutide and Dacra QWII (from Eli Lilly). [000728] In an embodiment, the compositions according to the invention comprise mazdutide and cagrilintide. [000729] In an embodiment, the compositions according to the invention comprise mazdutide and petrelintide. [000730] In an embodiment, the compositions according to the invention comprise mazdutide and eloralintide. [000731] In an embodiment, the compositions according to the invention comprise mazdutide and AZ6234 (from Astra Zeneca). [000732] In an embodiment, the compositions according to the invention comprise mazdutide and gubamy (from Gubra). [000733] In an embodiment, the compositions according to the invention comprise mazdutide and Dacra QWII (from Eli Lilly). [000734] In an embodiment, the compositions according to the invention comprise retatrutide and cagrilintide. [000735] In an embodiment, the compositions according to the invention comprise retatrutide and petrelintide.[000736] In an embodiment, the compositions according to the invention comprise retatrutide and eloralintide. [000737] In an embodiment, the compositions according to the invention comprise retatrutide and AZ6234 (from Astra Zeneca). [000738] In an embodiment, the compositions according to the invention comprise retatrutide and gubamy (from Gubra). [000739] In an embodiment, the compositions according to the invention comprise retatrutide and Dacra QWII (from Eli Lilly). [000740] In an embodiment, the compositions according to the invention comprise dapiglutide and cagrilintide. [000741] In an embodiment, the compositions according to the invention comprise dapiglutide and petrelintide. [000742] In an embodiment, the compositions according to the invention comprise dapiglutide and eloralintide. [000743] In an embodiment, the compositions according to the invention comprise dapiglutide and AZ6234 (from Astra Zeneca). [000744] In an embodiment, the compositions according to the invention comprise dapiglutide and gubamy (from Gubra). [000745] In an embodiment, the compositions according to the invention comprise dapiglutide and Dacra QWII (from Eli Lilly). [000746] In one embodiment, the compositions according to the invention also comprise buffers. [000747] In one embodiment, the composition according to the invention comprises buffers at concentrations between 0 and 100 mM. [000748] In one embodiment, the composition according to the invention comprises buffers at concentrations between 15 and 50 mM. [000749] In one embodiment, compositions according to the invention comprise a buffer chosen from the group constituted by a phosphate buffer, Tris (trishydroxymethyl-aminomethane). [000750] In one embodiment, the buffer is sodium phosphate. [000751] In one embodiment, the buffer is Tris (trishydroxymethyl-aminomethane). [000752] In one embodiment, the buffer is sodium citrate.[000753] In one embodiment, the compositions according to the invention also comprise a preservative. [000754] In one embodiment, the preservatives are chosen from the group constituted by m-cresol and phenol, alone or in mixture. [000755] In one embodiment, the concentration of the preservatives is between 10 and 100 mM. [000756] In one embodiment, the concentration of the preservatives is between 10 and 50 mM. [000757] In one embodiment, the concentration of the preservatives is between 10 and 40 mM. [000758] In one embodiment, the concentration of m-cresol is between 10 to 50 mM. [000759] In one embodiment, the concentration of m-cresol is between 20 to 50 mM. [000760] In one embodiment, the concentration of m-cresol is between 10 to 40 mM. [000761] In one embodiment, the concentration of m-cresol is between 20 to 40 mM. [000762] In one embodiment, the concentration of phenol is between 20 to 100 mM. [000763] In one embodiment, the concentration of phenol is between 40 to 100 mM. In one embodiment, the concentration of phenol is between 20 to 80 mM. [000764] In one embodiment, the concentration of phenol is between 40 to 80 mM. [000765] In an embodiment the composition comprising preservatives allows multiple use, in particular the preservatives are phenolic preservatives, more particularly are only phenolic preservatives. [000766] In an embodiment this composition comprises concentration of phenolic preservatives such as disclosed above. [000767] In an embodiment a composition able to pass the challenge tests according to both European and American pharmacopeia, EP 11thedition chapter 5.1.3 and USP 43 chapter <51>, allows multiple use, in particular for long-acting peptides. [000768] The invention is also relative to an injection device or a container comprising such a composition and thus allowing multiple use. [000769] In an embodiment the composition comprises a metal chelator. [000770] In an embodiment the metal chelator is EDTA.[000771] In an embodiment, the composition comprises a concentration of EDTA ranging from 0.5 to 5 mg / ml. [000772] In one embodiment, the compositions according to the invention also comprise a surfactant. [000773] In one embodiment, the surfactant is chosen from the group constituted by propylene glycol and polysorbate. [000774] Compositions according to the invention may also comprise additives such as osmotic agents. [000775] In one embodiment, the osmotic agents are chosen from the group constituted by glycerin, sodium chloride, mannitol and glycine. [000776] Compositions according to the invention may also comprise any pharmacopoeia compatible excipients which are also compatible with peptide 1 and peptide 2, and in particular with cagrilintide and semaglutide, at the usage concentrations. [000777] The compositions or formulations disclosed herein are suitable for parenteral injection, in particular for subcutaneous injection. [000778] In the case of local and systemic releases, the administration pathways foreseen are intravenous, subcutaneous, intra-dermal or intramuscular. [000779] In a preferred embodiment the administration is subcutaneous. [000780] In one embodiment, the composition according to the invention is characterized in that it is administered twice a week. [000781] In one embodiment, the composition according to the invention is characterized in that it is administered once a week. [000782] In one embodiment, the composition according to the invention is characterized in that it is administered twice a month. [000783] The invention also relates to single-dose formulations at a pH between 5.2 and 6.0 and comprising cagrilintide, semaglutide and co-polyamino acid as defined above. [000784] In one embodiment, the formulations are in the form of an injectable solution. [000785] If necessary, the composition of the mixture of cagrilintide, semaglutide and the co-polyamino acid is adjusted with excipients such as glycerin, m-cresol, and polysorbate (Tween®) by addition of concentrated solutions of these excipients to themixture. If necessary, the pH of the preparation is adjusted to a pH between 5.0 and 6.0.[000786] According to an embodiment, the composition is in the form of an aqueous injectable solution, whose pH is comprised from5.0 to 6.0, in particular 5.1 to 5.9, comprising:- semaglutide,- cagrilintide, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy having the following Formula A:Formula AWherein- M = 0.02 to 0.1, DP = 10 to 50, R1 H or te in with n = 21, R1 = H or pyroglutamate, with at least 95% pyroglutamate. [000787] According to an embodiment, the composition is in the form of an aqueous injectable solution, whose pH is comprised from 5.2 to 5.8, comprising: - semaglutide, - cagrilintide, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy having the following Formula A:100Formula A Wherein - M = 0.02 to 0.1, DP or n = 10 to 50, R1= H or pyroglutamate, in particular with n = 21, R1 = H or pyroglutamate, with at least 95% pyroglutamate. [000788] The instant invention further concerns compositions for use as a medicament. [000789] In an embodiment, the invention concerns a composition, in the form of an aqueous injectable solution, for use as a medicament, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - a peptide 1, which is GLP-1 receptor agonist, having an isoelectic point, pI1, of less than 6.5, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy. [000790] In an embodiment, the invention concerns a composition, in the form of an aqueous injectable solution, for use as a medicament, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - semaglutide, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy. [000791] In an embodiment, the invention concerns a composition, in the form of an aqueous injectable solution, for use as a medicament, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - a peptide 1, which is GLP-1 receptor agonist, having an isoelectic point, pI1, of less than 6.5,- a peptide 2, which is an API, in particular having an isoelectric point, pI2, which is superior or equal to pI1 + 2 (pI1 + 2 ≤ pI2), and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy. [000792] In an embodiment, the invention concerns a composition, in the form of an aqueous injectable solution, for use as a medicament, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - semaglutide as peptide 1, - a peptide 2, which is an API, in particular having an isoelectric point, pI2, which is superior or equal to pI1 + 2 (pI1 + 2 ≤ pI2), and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy. [000793] In an embodiment, the invention concerns a composition, in the form of an aqueous injectable solution, for use as a medicament, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - a GLP-1 RA, as peptide 1, - an amylin receptor agonist, also called amylin RA, as peptide 2, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy. [000794] In an embodiment, the invention concerns a composition, in the form of an aqueous injectable solution, for use as a medicament, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - semaglutide as peptide 1, - an amylin receptor agonist, also called amylin RA, as peptide 2, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy. [000795] In an embodiment, the invention concerns a composition, in the form of an aqueous injectable solution, for use as a medicament, whose pH is comprised from 5.0 to 6.0, in particular from 5.1 to 5.9, comprising: - semaglutide, - cagrilintide, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy having the following Formula A:102Wherein- M = 0.02 to 0.1, n =10 to 50, R1 = H or pyroglutamate, in particular with n = 21, R1 = H or pyroglutamate,with at least95% pyroglutamate. [000796] In an embodiment, the invention concerns a composition, in the form of an aqueous injectable solution, for use as a medicament, whose pH is comprised from 5.2 to 5.8, comprising:- semaglutide,- cagrilintide, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy having the following Formula A:- M = 0.02 to 0.1, n = to 50 R1 H or py , in p with n = 21, R1 = H or pyroglutamate, with at least 95% pyroglutamate. [000797] The invention also concerns compositions for use in a method of treatment of overweight or obesity, diabetes, cardio-vascular disease , non-alcoholicsteatohepatitis (NASH), and / or cognitive impairment, such as caused by Alzheimer Disease (AD). Diabetes, overweight and obesity could be with or without one or more associated comorbidities. [000798] In an embodiment, compositions are for use in a method of treatment of overweight or obesity. [000799] In an embodiment, compositions are for use in a method of treatment of diabetes. [000800] In an embodiment, compositions are for use in a method of treatment of Diabetes Type 1. [000801] In an embodiment, compositions are for use in a method of treatment of Diabetes Type 2. [000802] In an embodiment, compositions are for use in a method of treatment of overweight or obesity and diabetes. [000803] In an embodiment, compositions are for use in a method of treatment of overweight or obesity and Diabetes Type 1. [000804] In an embodiment, compositions are for use in a method of treatment of overweight or obesity and Diabetes Type 2. [000805] In an embodiment, compositions are for use in a method of treatment of cardio-vascular disease(s). [000806] In an embodiment, compositions are for use in a method of treatment of non-alcoholic steatohepatitis (NASH). [000807] The invention further concerns a method for the preparation of a stable, injectable aqueous solutions of peptide 1, which is a GLP-1 receptor agonist, having an isoelectic point, pI1, of less than 6.5, comprising the step of mixing a co-polyamino acid as previously defined with the peptide 1. [000808] In an embodiment, the method is for the preparation of a stable, injectable aqueous solutions of semaglutide, as peptide 1 comprising the step of mixing a co- polyamino acid as previously defined with semaglutide. [000809] In an embodiment, the method is for the preparation of a stable, injectable aqueous solutions of semaglutide, as peptide 1 comprising the step of mixing a co- polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy having the following Formula A:104Formula A Wherein - M =0.02 to 0.1, n = 10 to 50, R1= H or pyroglutamate in particular with n = 21, R1 = H or pyroglutamate, with at least 95% pyroglutamate, with semaglutide. Following is a non-limiting list of specific embodiments of the present invention Specific embodiments 1. A composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, comprising - a peptide 1, which is a GLP-1 receptor agonist, having an isoelectic point, pI1, of less than 6.5, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy, said co-polyamino acid consisting of glutamic or aspartic units, and said hydrophobic radicals Hy being according to formula X below:Formula X in which - GpR is chosen from the radicals according to formulas VII, VII’ or VII’:Formula VII’ orFormula VII’’;- identical or different GpG and GpH are chosen from the radicals according to formulas XI or XI’:Formula XI Formula XI’ - GpA is chosen from the radicals according to formula VIII:Formula VIII in which A’ is chosen from the radicals according to formula VIII’, VIII’’ or VIII’’’:Formula VIII’ Formula VIII’’ Formula VIII’’’ - GpL is chosen from the radicals according to formula XII:Formula XII, - GpC is a radical according to formula IX:the * indicates the attachment sites of the different groups bonded by the amide functions;- a is an integer equal to 0 or to 1 and a’ = 1 if a = 0 and a’ = 1, 2 or 3 if a = 1; - a’ is an integer equal to 1, to 2, or to 3 - b is an integer equal to 0 or to 1; - c is an integer equal to 0 or to 1, and if c is equal to 0, then d is equal to 1 or to 2; - d is an integer equal to 0, to 1, or to 2; - e is an integer equal to 0 or to 1; - g is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6; - h is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6; - l is an integer equal to 0 or 1 and l’ = 1 if l = 0, and l’ = 2 if l = 1; - r is an integer equal to 0, to 1, or to 2, and - s’ is an integer equal to 0 or 1, and - if e is different from 0, then at least one of g, h or l is different from 0; - A, A1, A2 and A3, identical or different, are linear or branched alkyl radicals, and / or substituted by a radical derived from a saturated, unsaturated or aromatic ring, comprising 1 to 8 carbon atoms. - B is a linear or branched alkyl radical and / or comprising an aromatic nucleus, comprising 1 to 9 carbon atoms or an unsubstituted ether or polyether radical comprising from 4 to 14 carbon atoms and from 1 to 5 oxygen atoms; - Cx is a linear or branched monovalent alkyl radical, and / or comprising a cyclic part, in which x indicates the number of carbon atoms and: ^ when the hydrophobic radical -Hy carries 1 -GpC, then 9 ≤ x ≤ 25, ^ when the hydrophobic radical -Hy carries 2 -GpC, then 9 ≤ x ≤ 15, ^ when the hydrophobic radical -Hy carries 3 -GpC, then 7 ≤ x ≤ 13, ^ when the hydrophobic radical -Hy carries 4 -GpC, then 7 ≤ x ≤ 11, ^ when the hydrophobic radical -Hy carries at least 5 -GpC, then 6 ≤ x ≤ 11, - G is a branched alkyl radical of 1 to 8 carbon atoms, with said alkyl radical bearing one or more free carboxylic acid functions,- R is a radical chosen from the group consisting of a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms, a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms bearing one or more -CONH2 functions, or a unsubstituted ether or polyether radical comprising from 4 to 14 carbon atoms and 1 to 5 oxygen atoms: - the hydrophobic radical(s) -Hy according to formula X being bonded to the PLG: - via a covalent bond between a carbonyl of the hydrophobic radical -Hy and a nitrogen atom borne by the PLG, thus forming an amide function derived from the reaction of an amine function borne by the PLG and an acid function borne by the precursor -Hy’ of the hydrophobic radica -Hy, or - via a covalent bond between a nitrogen atom of the hydrophobic radical -Hy and a carbonyl borne by the PLG, thus forming an amide function derived from the reaction of an amine function of the precursor -Hy’ of the hydrophobic -Hy radical and an acid function borne by the PLG, - the ratio M between the number of hydrophobic radicals and the number of glutamic or aspartic units being from 0 < M ≤ 0.5; - when several hydrophobic radicals are borne by a co-polyamino acid, then they are identical or different, - the degree of polymerization DP in glutamic or aspartic units for PLG chains is comprised from 5 to 250; - free carboxylic acid functions being in the form of an alkali metal salt chosen from the group consisting of Na+and K+. 2. A composition according to embodiment 1, wherein r = 0 or 1, and when r = 1 then GpR is a radical according to Formula VII, a’ = 1, g = a = 0, h = 1, 2 or 3, in particular 1, l = 0 and l’ = 1 or l = 1 and l’ = 2 3. A composition according to embodiment 1 or 2, wherein the hydrophobic radicals Hy is according to formula X in whicho r is an integer equal to 0 or to 1, in particular r = 1, and GpR is a radical according to Formula VIIFormula VII o g = 0, a = 0, a’ = 1 o l = 1, and GpL is a radical according to formula XII:Formula XII, o A is a linear or branched alkyl radical and / or substituted by a radical derived from a saturated, unsaturated or aromatic ring, comprising 1 to 8 carbon atoms, in particular A is a linear or branched alkyl radical comprising 1 to 8 carbon atoms, more particularly A is a linear alkyl radical comprising 5 carbon atoms, o l’ = 2 o h = 1, 2 or 3, in particular h = 1, and GpH is a radical according to Formula XI:Formula XI o G is a branched alkyl radical of 1 to 8 carbon atoms, with said alkyl radical bearing one or more free carboxylic acid functions, in particular one free carboxylic acid function, o GpC is a radical according to formula IX:in which b = 0; e = 1; c = 0 or 1; d = 0, 1, or 2; and if c is equal to 0, then d is equal to 1 or to 2; in particular c = 0 and d = 1, o Cx is a linear or branched monovalent alkyl radical, and / or comprising a cyclic part, in which x indicates the number of carbon atoms and the hydrophobic radical -Hy carries 2 -GpC, with 9 ≤ x ≤ 15, in particular x = 13.4. A composition according to any embodiment 1 or 2, wherein the hydrophobic radicals Hy is according to formula X in which o r is an integer equal to 0 or to 1, in particular r = 1, and GpR is a radical according to Formula VIIFormula VII o g = 0, a = 0, a’ = 1, l = 0, l’ = 1 o h = 1, 2 or 3, in particular h = 1, and GpH is a radical according to Formula XI:Formula XI o G is a branched alkyl radical of 1 to 8 carbon atoms, with said alkyl radical bearing one or more free carboxylic acid functions, in particular one free carboxylic acid function, o GpC is a radical according to formula IX:Formula IX; in which b = 0; e = 1; c = 0 or 1; d = 0, 1, or 2; and if c is equal to 0, then d is equal to 1 or to 2; in particular c = 0 and d = 1, o Cxis a linear or branched monovalent alkyl radical, and / or comprising a cyclic part, in which x indicates the number of carbon atoms and the hydrophobic radical -Hy carries 2 -GpC, with 9 ≤ x ≤ 15, in particular x = 13 or 15. 5. A composition according to any of the preceding embodiments, wherein the co- polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXa below:formula XXXa in which - D represents, independently, either a -CH2- group (aspartic unit) or a -CH2- CH2- group (glutamic unit), - Hy is a hydrophobic radical Hy, wherein r = 1, - R’1 is a radical chosen from among the group constituted by an H, a linear acyl group in C2 to C10, a branched acyl group in C4 to C10, a benzoyl, a terminal “amino acid” and a pyroglutamate, in particular is a pyroglutamate, - R’2 is a -NR’R’’ radical with R’ and R” , either identical or different, being chosen from the group comprised by H, linear or branched or cyclic alkyls in C2 to C10, or benzyl and said R’ and R” alkyls being able to form together one or more carbonated cycles, saturated, unsaturated and / or aromatic, able to comprise hetero-atoms, chosen from the group comprised of O, N and S, in particular is -NR’R’’ radical with R’ and R”, either identical or different, being chosen from the group comprised by H, linear or branched or cyclic alkyls in C2 to C10 - X represents a cationic entity chosen from the group comprising alkaline cations; - the sum n + m represents the degree of polymerization DP of the co- polyamino acid, namely, the average number of monomeric units per co- polyamino acid chain and 9 ≤ n + m ≤ 49; and - the ratio M is comprised between 0.05 and 0.3, in particular 0.1 and 0.2.A composition according to any of embodiments 1 to 4, wherein the co- polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula XXXb below:formula XXXb - D represents, independently, either a -CH2- group (aspartic unit) or a -CH2- CH2- group (glutamic unit), - R1 is a hydrophobic radical Hy, wherein r = 0, or a radical chosen from the group constituted by an H, a linear acyl group in C2 to C10, a branched acyl group in C4 to C10, a benzoyl, a terminal “amino acid” and a pyroglutamate, - R2 is a hydrophobic radical Hy, wherein r = 1, or a -NR’R’’ radical, with R’ and R”, either identical or different, being chosen from the group comprised by H, linear or branched or cyclic alkyls in C2 to C10, or benzyl and said R’ and R” alkyls being able to form together one or more carbonated cycles, saturated, unsaturated and / or aromatic, able to comprise hetero-atoms, chosen from the group comprised of O, N and S; - At least one of R1 and R2 is a hydrophobic radical according to formula X, in particular only one of R1 and R2 is according to formula X, more particularly the other is either a pyroglutamate or a -NR’R’’ radical, with R’ and R”, either identical or different, being chosen from the group comprised by H, linear or branched or cyclic alkyls in C2 to C10; - X represents a cationic entity chosen from the group comprising alkaline cations; - the sum n + m represents the degree of polymerization DP of the co- polyamino acid, namely, the average number of monomeric units per co- polyamino acid chain and 9 ≤ m ≤ 29.A composition according to any of embodiments 1 to 4, wherein the co- polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from among the co-polyamino acids from formula A-XXXI:Formula A-XXXI Wherein - D represents, independently, either a group -CH2- (aspartic acid) or a group - CH2-CH2- (glutamic acid), - X represents a cationic entity chosen in the group comprising alkali cations, - Ra and R’a, identical or different, are either a hydrophobic radical -Hy, wherein r = 0, or a radical chosen in the group consisting of an H, a C2 to C10 linear acyl group, a C3 to C10 branched acyl group, a benzyl, a terminal "amino acid" unit and a pyroglutamate, - at least one of Ra and R’a being a hydrophobic radical -Hy, in particular both Ra and Ra’ are hydrophobic radicals -Hy, - Q is corresponding to only one Q’, chosen from the group consisting of Formula A-III, A-IV or A-Iva -Formula A-IV o wherein: - At least one of u1’’ or u2’’ is different to 0. - If u1’’ ≠ 0 then u1’ ≠ 0 and if u2’’ ≠ 0 then u2’ ≠ 0, - u1’ and u2’ are identical or different and, - 2 ≤ u ≤ 4, - 0 ≤ u1’’ ≤ 8, in particular 0 ≤ u1’’ ≤ 4,- 0 ≤ u2’ ≤ 4 - 0 ≤ u2’’ ≤ 8, in particular 0 ≤ u2’’ ≤ 4, *-Fb-(CH2)2-(O(CH2)2)aa -Fb’ Formula A-IVa wherein - aa is an integer comprised between 1 and 16, in particular between 2 and 8, and - Fb and Fb’, identical or different, are representing functions -NH- or -CO-, in particular Fb and Fb’ represents -NH-. - -Hy is as previously defined, - n’ + m’ represents the degree of polymerization DP of the co-polyamino acid, namely the mean number of monomeric units per co-polyamino acid chain and 20 ≤ n’ + m’ ≤ 100. 8. A composition according to any of preceding embodiments, wherein the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is ranging from 5 to 50 mg / ml. 9. A composition according to any of preceding embodiments, wherein the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is ranging from 7.5 to 40 mg / ml. 10. A composition according to any of preceding embodiments, wherein the concentration of co-polyamino acid bearing carboxylate charges and hydrophobic radicals is ranging from 10 to 30 mg / ml. 11. A composition according to any of preceding embodiments, wherein the peptide 1 is a long acting peptide. 12. A composition according to any of preceding embodiments, wherein pI1 is comprised between 3.5 to 6.5. 13. A composition according to any of preceding embodiments, wherein pI1 is comprised between 4.0 to 6.0. 14. A composition according to any of preceding embodiments, wherein pI1is comprised between 4.0 to 5.6. 15. A composition according to any of preceding embodiments, wherein pI1 is comprised between 4.5 to 5.5 16. A composition according to any of preceding embodiments 1 to 13, wherein pI1 is comprised between 4.0 to 4.5.17. A composition according to any of preceding embodiments 1 to 12, wherein pI1 is comprised between 3.8 to 5.8. 18. A composition according to any of preceding embodiments 1 to 12, wherein pI1 is comprised between 3.9 and 5.7. 19. A composition according to any of embodiments 1 and 11, wherein the GLP-1 RA is semaglutide. 20. A composition according to any of embodiments 1 and 11, wherein the GLP-1 RA is ecnoglutide. 21. A composition according to any of embodiments 1 and 11, wherein the GLP-1 RA is tirzepatide. 22. A composition according to any of embodiments 1 and 11, wherein the GLP-1 RA is CT388. 23. A composition according to any of embodiments 1 and 8, wherein the GLP-1 RA is survodutide. 24. A composition according to any of embodiments 1 and 11, wherein the GLP-1 RA is pemvidutide. 25. A composition according to any of embodiments 1 and 11, wherein the GLP-1 RA is mazdutide. 26. A composition according to any of embodiments 1 and 11, wherein the GLP-1 RA is retatrutide. 27. A composition according to any of embodiments 1 and 11, wherein the GLP-1 RA is dapiglutide. 28. A composition according to any of embodiments 1 and 11, wherein the GLP-1 RA is AZD 9550. 29. A composition according to any of preceding embodiments, wherein the GLP-1 RA is comprised in a concentration ranging from 0.25 to 30 mg / ml 30. A composition according to any of preceding embodiments, wherein the GLP-1 RA is comprised in a concentration ranging from 1 to 28 mg / ml. 31. A composition according to any of preceding embodiments, wherein the GLP-1 RA is comprised in a concentration ranging from 2 to 25 mg / ml. 32. A composition according to any of preceding embodiments, wherein the GLP-1 RA is comprised in a concentration ranging from 5 to 25 mg / ml. 33. A composition according to any of preceding embodiments, wherein the GLP-1 RA is comprised in a concentration ranging from 10 to 25 mg / ml. 34. A composition according to any of preceding embodiments, wherein the GLP-1 RA is comprised in a concentration ranging from 15 to 25 mg / ml.35. A composition according to any of preceding embodiments 1 to 31, wherein the GLP-1 RA is comprised in a concentration ranging from 2 to 20 mg / ml. 36. A composition according to any of preceding embodiments 1 to 31, wherein the GLP-1 RA is comprised in a concentration ranging from 2 to 15 mg / ml. 37. A composition according to any of preceding embodiments 1 to 31, wherein the GLP-1 RA is comprised in a concentration ranging from 3 to 12 mg / ml. 38. A composition according to any of preceding embodiments 1 to 31, wherein the GLP-1 RA is comprised in a concentration ranging from 5 to 10 mg / ml. 39. A composition according to any of preceding embodiments further comprising an amylin RA. 40. A composition according to the embodiment 39, wherein the amylin RA is a long-acting amylin RA, 41. A composition according to the embodiment 39 or 40, wherein the amylin RA has an isoelectric point, pI2, which is superior or equal to pI1 + 2 (pI1 + 2 ≤ pI2) or ranging from 6 to 12. 42. A composition according to the embodiment 41, wherein the amylin RA has a pI2 ranging from 6 to 12. 43. A composition according to the embodiment 41, wherein the amylin RA has a pI2 ranging from 8 to 12. 44. A composition according to the embodiment 41, wherein the amylin RA has a pI2 ranging from 8 to 9. 45. A composition according to any of preceding embodiments 39 to 41, wherein the amylin RA is cagrilintide. 46. A composition according to any of preceding embodiments 39 to 41, wherein the amylin RA is petrelintide. 47. A composition according to any of preceding embodiments 39 to 41, wherein the amylin RA is eloralintide. 48. A composition according to any of preceding embodiments 39 to 41, wherein the amylin RA is AZ6234. 49. A composition according to any of preceding embodiments 39 to 41, wherein the amylin RA is gubamy. 50. A composition according to any of preceding embodiments 39 to 41, wherein the amylin RA is Dacra QWII, also called Colulintide. 51. A composition according to any of preceding embodiments 39 to 41, wherein the amylin RA is peptide A.52. A composition according to any of preceding embodiments 39 to 41, wherein the amylin RA is NN 1213. 53. A composition according to any of preceding embodiments 39 to 52, wherein the amylin RA is comprised in a concentration ranging from 0.25 to 30 mg / ml. 54. A composition according to any of preceding embodiments 39 to 52, wherein the amylin RA is comprised in a concentration ranging from 1 to 28 mg / ml. 55. A composition according to any of preceding embodiments 39 to 52, wherein the amylin RA is comprised in a concentration ranging from 2 to 25 mg / ml. 56. A composition according to any of preceding embodiments 39 to 52, wherein the amylin RA is comprised in a concentration ranging from 5 to 25 mg / ml. 57. A composition according to any of preceding embodiments 39 to 52, wherein the amylin RA is comprised in a concentration ranging from 10 to 25 mg / ml. 58. A composition according to any of preceding embodiments 39 to 52. wherein the amylin RA is comprised in a concentration ranging from 15 to 25 mg / ml. 59. A composition according to any of preceding embodiments 39 to 52, wherein the amylin RA is comprised in a concentration ranging from 2 to 20 mg / ml. 60. A composition according to any of preceding embodiments 39 to 52, wherein the amylin RA is comprised in a concentration ranging from 2 to 15 mg / ml. 61. A composition according to any of preceding embodiments 39 to 52, wherein the amylin RA is comprised in a concentration ranging from 3 to 12 mg / ml. 62. A composition according to any of preceding embodiments 39 to 52, wherein the amylin RA is comprised in a concentration ranging from 5 to 10 mg / ml. 63. A composition according to any of preceding embodiments, further comprising phenolic preservatives. 64. A composition according to embodiment 63, wherein phenolic preservatives are chosen from the group constituted by m-cresol and phenol, alone or in mixture. 65. A composition according to embodiment 64, wherein phenolic preservatives are present at a concentration between 10 and 100 mM. 66. A composition according to embodiment 65, wherein phenolic preservatives are present at a concentration between 10 and 50 mM. 67. A composition according to embodiment 66, wherein phenolic preservatives are present at a concentration between 10 and 40 mM. 68. A composition according to embodiment 67, wherein the concentration of m- cresol is between 10 to 50 mM.69. A composition according to embodiment 68, wherein the concentration of m- cresol is between 20 to 50 mM. 70. A composition according to embodiment 69, wherein the concentration of m- cresol is between 10 to 40 mM. 71. A composition according to embodiment 70, wherein the concentration of m- cresol is between 20 to 40 mM. 72. A composition according to embodiment 71, wherein the concentration of m- cresol is between 20 to 100 mM. 73. A composition according to embodiment 72, wherein the concentration of m- cresol is between 40 to 100 mM. 74. A composition according to embodiment 73, wherein the concentration of phenol is between 20 to 80 mM. 75. A composition according to embodiment 74, wherein the concentration of phenol is between 40 to 80 mM. 76. A composition according to any preceding embodiments, further comprising EDTA, in particular at a concentration ranging from 0.5 to 5 mg / ml. 77. A composition according to any preceding embodiments, passing the preservative challenge tests according to both European and American pharmacopeia, EP 11thedition chapter 5.1.3 and USP 43 chapter <51>, in particular EP criteria A. 78. A composition according to any preceding embodiments, allowing multiple use. 79. A composition according to any preceding embodiments, exhibiting an improved chemical and / or physical stability. 80. A composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, comprising: o semaglutide, o cagrilintide, and o a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy having the following Formula A:Formula AWhereino M = 0.02 to 0.1, DP = 10 to 50, R1 = H or pyroglutamate, in particular with n = 21, R1 = H or pyroglutamate, with at least 95% pyroglutamate. 81. A composition according to any of preceding embodiments, whose pH is comprised between 5.1 to 5.9. 82. A composition according to any of preceding embodiments, for use as a medicament. 83. A composition according to embodiment 82, for use for treatment of overweight, obesity, diabetes, cardio-vascular disease(s), non-alcoholic steatohepatitis (NASH), and / or cognitive impairment, such as caused by Alzheimer Disease (AD). 84. Injection device, cartridge or vial, comprising a composition according to embodiments 82 or 83, in particular intended for a multiple use.EXAMPLES Part A – Chemistry [000810] Precursors of Hydrophobic Grafts and Co-polyamino acids bearing Carboxylate Charges and Hydrophobic Grafts can be obtained as described in US2020306379A1 and in WO2019110773. [000811] The sum of glutamate units and pyroglutamate (R1) in the co-polyamino acid bearing carboxylate charges is abbreviated SumG+P. The N-ter-glutamate unit is essentially a pyroglutamate (>95%). [000812] The SumG+P is the mole ratio of the glutamate monomer precursor used per hydrophobic graft (Hy) in the synthesis. In particular, A1 has been obtained according to the method described for polymer B22 in US2020306379A1 and in WO2019110773. [000813] The percentage of pyroglutamate is estimated by an analysis performed by Reversed-Phase High-Performance-Liquid-Chromatography (RP-HPLC) with UV detection and in gradient elution made with mobile phases containing acidic aqueous solution, acetonitrile and methanol. N-Ter-glutamate are quantified using Area Normalization Method. [000814] The determination of Mn, Mw, and Ð (dispersity) is performed by Size Exclusion Chromatography (SEC) with Refractive Index detector and under isocratic flow with a mobile phase containing a mix of methanol and aqueous salt solution (NaCl & AcONH4). Mn, Mw and Ð are determined using an external calibration of PEG standards. The measures of Mn may vary ± 15%. No. CO-POLYAMINO ACIDS BEARING CARBOXYLATE CHARGES AND HYDROPHOBIC RADICALS A1 n= 21 R1 = H or pyroglutamate with >95% pyroglutamateSumG+P = 22 Mn measured by SEC: 1983 g / mol (equivalent to PEG) Ð measured by SEC: 1.05 A2 Same Formula as A1 with: n = 9 R1 = H or pyroglutamate with >95% pyroglutamate SumG+P = 10 A3 Same Formula as A1 with: n = 29 R1 = H or pyroglutamate, with >95% pyroglutamate SumG+P = 30 A4 Same Formula as A1 with: n = 24 R1 = H or pyroglutamate, with >95% pyroglutamate SumG+P = 25 A5 Same Formula as A1 with: n = 15 R1 = H or pyroglutamate, with >95% pyroglutamate SumG+P = 16 A6 (random PLG) n + m = 39 R1 = H or pyroglutamate, with >95% pyroglutamate SumG+P = 40 i = n / (n+m+P) = 0.15A7 n + m = 24 A8 Same Formula as A1 with: n = 11 R1= H or pyroglutamate, with >95% pyroglutamate SumG+P = 12 A9 n= 21 R1 = H or pyroglutamate with >95% pyroglutamate SumG+P = 22 Co-polyamino acids A1, A2, A3, A4, A5, A8 and A9 have been obtained by a process similar to the one from co-polyamino acid B22 from WO2019110773; Random, statistic co-polyamino acids A6 has been obtained by a process similar to the one from co- polyamino acid B22 from WO2019110773 : Co-polyamino acids A7 has been obtained by a process similar to the one from co-polyamino acid B29 from WO2019110774. Part B – Compositions Example B1: Stock Solutions Example B1a: Solutions of Cagrilintide[000815] Solutions of cagrilintide have been prepared by weighing the adequate amount of cagrilintide powder and adding the desired amount of water to reach the desired concentration. A clear solution was obtained by gentle mixing via vial inversions. Example B1b: Solutions of Semaglutide [000816] Solutions of semaglutide have been prepared by weighing the adequate amount of semaglutide powder and adding the desired amount of water to reach the desired concentration. A clear solution was obtained by gentle mixing via vial inversions. Example B1b’: Solutions of Tirzepatide [000817] Solutions of tirzepatide have been prepared by weighing the adequate amount of tirzepatide powder and adding the desired amount of water to reach the desired concentration. A clear solution was obtained by gentle mixing via vial inversions. Example B1c: Solutions of Co-polyamino acid A1 [000818] Solutions of co-polyamino acid A1 were prepared by weighing the adequate amount of co-polyaminoacid A1 powder, then dissolving it in water. An adjustement to pH 5.4 using NaOH and HCl 1M was done prior to adding water to reach the desired concentration. A clear solution was obtained. Example B2: Compositions of the invention comprising Cagrilintide and Semaglutide or Cagrilintide and Tirzepatide Example B2a: Compositions of Cagrilintide, Semaglutide and Co-polyamino acid A1 [000819] Solutions according to the invention were prepared as follows: - Addition of concentrated aqueous solutions of excipients (i.e. m-cresol (m-cr), mannitol (man), phenol) to the solution of co-polyaminoacid A1 (PLG-A1). - pH adjustment of this solution to the desired pH when needed (5.4;5.8) - addition of semaglutide (Sema) solution - addition of cagrilintide (Cagri) solution - final pH adjustment if needed, using NaOH 1N or HCl 1N - addition of water to reach the final desired volume and concentrations. [000820] A final filtration onto 0.22µm filter was done prior to filling.The following compositions have been prepared: Example [Sema] [Cagri] PLG-A1 Excipients pH (mg / ml) (mg / ml) (mg / ml) B2a-2 3.2 3.2 15 man 36 mg / mL 5.4;5.8 B2a-3 3.2 3.2 15 man 36 mg / mL, 5.4;5.8 m-cr 35 mmol / L B2a-4 3.2 3.2 15 man 36 mg / mL, 5.6 m-cr 35 mmol / L B2a-5 3.2 3.2 10 man 29 mg / mL, 5.8 phenol 70 mmol / L [000821] Using these compositions, 3 mL cartridges have been filled with 0.5 mL of formulation and sealed without the presence of air bubbles. Example B2b: Compositions of Cagrilintide, Tirzepatide and Co-polyamino acid A1 [000822] Solutions according to the invention were prepared as follows: - Addition of concentrated aqueous solutions of excipients (i.e. phenol, mannitol (man)) to the solution of co-polyaminoacid A1 (PLG-A1). - pH adjustment of this solution to the desired pH when needed (5.4;5.8) - addition of tirzepatide (Tirze) solution - addition of cagrilintide (Cagri) solution - final pH adjustment if needed, using NaOH 1N or HCl 1N - addition of water to reach the final desired volume and concentrations. [000823] A final filtration onto 0.22µm filter was done prior to filling. The following compositions have been prepared: Example [Tirze] [Cagri] PLG-A1 Excipients pH (mg / ml) (mg / ml) (mg / ml)B2b-1 6.7 3.2 12.5 man 32 mg / mL, 5.8 phenol 70mmol / L B2b-2 13.3 3.2 20 man 27 mg / mL, 5.8 phenol 70 mmol / L Example B3: Compositions comprising Cagrilintide and Semaglutide with A1 or with Cyclodextrins at pH 5.8 [000824] The solutions disclosed in the following Table were prepared as follows: - Addition of concentrated aqueous solutions of excipients (i.e. m-cresol (m-cr), mannitol (man), phenol, histidine (his)), when needed to either a solution of co-polyaminoacid A1.or a solution of hydroxypropyl-beta-cyclodextrin (HPBCD) KLEPTOSE® HPB PARENTERAL GRADE, with a degree of substitution 0.58-0.68. - pH adjustment of this solution to pH 5.8 - addition of semaglutide (Sema) solution - addition of cagrilintide (Cagri) solution - final pH adjustment to pH 5.8 if needed, using NaOH 1N or HCl 1N - addition of water to reach the final desired volume and concentrations. [000825] A final filtration onto 0.22µm filter was done prior to filling. Example [Sema] [Cagri] A1 HPBCD Excipients (mg / ml) (mg / ml) (mg / ml) (mg / ml) B3-1 3.2 3.2 15 - man 31 mg / ml m-cr 35 mmol / L B3-2 3.2 3.2 15 - man 25 mg / mL phenol 70 mmol / L B3-3 3.2 3.2 - 150 man 14 mg / ml m-cr 35 mmol / L B3-4 3.2 3.2 - 150 man 7 mg / mL phenol 70 mmol / L B3-5 3.2 3.2 - 150 his 6 mmol / Lman 20 mg / ml Example B4: Compositions comprising Cagrilintide and Semaglutide with PLG A3, A6, A7 and A8 at pH 5.8 [000826] Solutions according to the invention were prepared as follows: - Addition of concentrated aqueous solutions of excipients (i.e. m-cresol (m-cr), mannitol (man), phenol) to the solution of the adequate co-polyaminoacid (PLG). - pH adjustment of this solution to pH 5.8 when needed - addition of semaglutide (Sema) solution - addition of cagrilintide (Cagri) solution - final pH adjustment to pH 5.8 if needed, using NaOH 1N or HCl 1N - addition of water to reach the final desired volume and concentrations. [000827] A final filtration onto 0.22µm filter was done prior to filling. Example [Sema] [Cagri] [PLG] Excipients (mg / ml) (mg / ml) (mg / ml) B4-1 3.2 3.2 A7 man 25 mg / mL (13) phenol 70 mmol / L B4-2 3.2 3.2 A8 man 25 mg / mL (8) phenol 70 mmol / L B4-3 3.2 3.2 A3 man 25 mg / mL (13) phenol 70 mmol / L B4-4 3.2 3.2 A6 man 25 mg / mL (12) phenol 70 mmol / L B4-5 3.2 3.2 A9 man 25 mg / mL (12) phenol 70 mmol / L Example B5: Compositions comprising Cagrilintide and Semaglutide with A1 [000828] Solutions according to the invention were prepared as follows:- Addition of concentrated aqueous solutions of excipients (i.e. m-cresol (m-cr), mannitol (man), phenol) to the solution of co-polyaminoacid A1 (PLG-A1).- pH adjustment of this solution to pH 5.8 - addition of semaglutide (Sema) solution - addition of cagrilintide (Cagri) solution - final pH adjustment if needed, using NaOH 1N or HCl 1N - addition of water to reach the final desired volume and concentrations. [000829] A final filtration onto 0.22µm filter was done prior to filling. B5-1 3.2 3.2 15 Phenol (70) Sorbitol (30) 0 5.8 B5-2 3.2 3.2 15 Phenol (70) Trehalose (57) 0 5.8 B5-3 3.2 3.2 15 Phenol (70) Glycerol (15) 0 5.8 B5-4 6.4 6.4 30 0 0 0 5.8 B5-5 9.6 9.6 45 0 0 0 5.8 B5-6 3.2 3.2 15 Phenol (58) Sorbitol (32) 0 5.8 B5-7 3.2 3.2 15 m-cr (27) Sorbitol (38) 0 5.8 B5-8 3.2 3.2 15 Phenol (16) Sorbitol (37) 0 5.8 and m-cr (16) B5-9 3.2 3.2 15 Phenol (70) Mannitol (30) EDTA (0.2) 5.8 B5-10 3.2 3.2 12 Phenol (70) Mannitol (28) Methionine 5.8 (1.5) B5-11 3.2 3.2 12 Phenol (70) Mannitol (28) 0 5.8 Part C – Stability Example C1: Monitoring stabilityMonitoring of Physical Stability [000830] The cartridges containing the compositions were placed at 30°C.A physical stress was applied to the cartridges in the form of 20 daily container manual inversions (40 inversions on Mondays ans Fridays, none on Saturdays ans Sundays). [000831] At times specified in the following tables, one cartridge per composition was retrieved for physical stability assessment. Physical stability was monitored by visual inspection under USP<790> conditions, as well as by MFI sub-visible particle content measurement. [000832] For MFI measurements, the cartridges were opened, and 100µL were sampled without moving the plunger. These 100µL were added to 900µL of water filtered onto 0.22µm filter to yield 1mL of sample for MFI measurement. Sub-visible particle content per mL was then measured on the diluted sample. Using the dilution factor of 10, the number of sub-visible particles per mL of formulation was then calculated. Monitoring of Chemical Stability [000833] For the monitoring of chemical stability, cartridges were placed at 37°C. At times specified in the following tables, one cartridge per composition was retrieved for analysis. [000834] Chemical stability was assessed both by RP-HPLC or RP-UPLC analysis to monitor each peptide’s purity, and by SEC-HPLC to monitor the formation of high molecular weight products (HMWP). Example C2: Stability Results Example C2-1: Stability study on Cagrilintide / Semaglutide compositions [000835] Results of visual inspection and MFI measurements done on day 14 and 26 of accelerated physical stability at 30°C studies are presented below: Formulation – Part >5µm Part>10µm Part>25µm Visual pH ( / mL) ( / mL) ( / mL) inspection T14D T26D T14D T26D T14D T26D T14D T26D B2a-2 - 5.4 161 161 46 69 0 46 clear clear B2a-2 – 5.8 2799 1399 1055 413 321 183 clear clear B2a-3 – 5.4 160 1054 0 206 0 46 clear clearB2a-3 – 5.8 321 390 46 161 0 92 clear clear [000836] These formulations appeared stable during this accelerated stability study, with visual aspect and sub-visible particle amounts remaining satisfactory. [000837] Results of the chemical stability (RP-HPLC and SEC-HPLC methods) are presented below. Formulation – pH Cagrilintide Semaglutide HMWP content impurity levels impurity levels (%, delta vs T0) (%, delta vs T0) (%, delta vs T0) T14D T26D T14D T26D T14D T26D B2a-2 - 5.4 +1.8 +2.2 +1.3 +2.6 +0.0 +0.1 B2a-2 - 5.8 +1.8 +2.4 +1.2 +2.3 +0.0 +0.1 B2a-3 - 5.4 +0.8 +1.4 +1.4 +2.6 +0.1 +0.2 B2a-3 - 5.8 +1.5 +1.9 +1.3 +2.3 +0.1 +0.3 [000838] As can be seen from the table above, the level of impurities after 26 days at 37°C is below 2.5% for cagrilintide and below 3% for semaglutide. [000839] For comparison, Novo’s application WO2023 / 187067 disclosed a higher level of impurity increase at 37°C at 28 days for cagrilintide and for semaglutide. [000840] Furthermore, B2a-3 – 5.4 was tested for preservative efficacy using Staphylococcus aureus strain under conditions specified in EP 5.1.3 and USP <51>. The results showed conformity to EP(B) and USP. Example C2-2: Stability study on Cagrilintide / Semaglutide compositions [000841] Results of visual inspection done on day 14, 28 and 42 of accelerated stability at 37°C studies are presented below: Visual aspect T0 T14D T28D T42D atB2a-4 Clear, Clear, Clear, Clear, colorless colorless colorless colorless B2a-5 Clear, Clear, Clear, Clear, colorless colorless colorless colorless [000842] These formulations appeared stable during this accelerated stability study, with visual aspect remaining satisfactory during the storage period. [000843] Results of the chemical stability (RP-UPLC and SEC-HPLC methods) are presented below. Cagrilintide impuritySemaglutide HMWP content levels (%, delta vs impurity levels (%, (%, delta vs T0) T0) delta vs T0) T14D T28D T42D T14D T28D T42D T14D T28D T42D B2a-4 +2.9 +6.8 +9.1 +2.9 +5.7 +7.9 +0.2 +0.4 +0.6 B2a-5 +2.8 +6.5 +9.8 +2.8 +5.6 +7.6 +0.2 +0.6 +0.9 [000844] As can be seen from the table above, the increase of impurities after 42 days at 37°C is around 10% for cagrilintide and 8% for semaglutide. The increase of HMWP content remains less than 1% after 42 days at 37°C. [000845] For comparison, Novo’s application WO2023 / 187067 disclosed a higher level of impurity increase at 37°C for cagrilintide. Example C2-3: Stability study on Cagrilintide / Tirzepatide compositions [000846] Results of visual inspection done on day 14,28 and 45 of accelerated physical stability at 30°C studies are presented below: Visual aspect T0 T14D T28D T45D at B2b-1 Clear, Clear, Clear, Clear, colorless colorless colorless colorlessB2b-1 Clear, Clear, Clear, Clear, colorless colorless colorless colorless [000847] These formulations appeared stable during this accelerated stability study, with visual aspect remaining satisfactory during the storage period. [000848] Results of the chemical stability (RP-UPLC and SEC-HPLC methods) are presented below. Cagrilintide impurityTirzepatide impurity HMWP content levels (%, delta vs levels (%, delta vs T0) T0) (%, delta vs T0) T14D T28D T45D T14D T28D T45D T14D T28D T45D B2b-1 +4.3 +8.2 +11.8 +1.3 +2.8 +3.8 +0.1 +0.3 +0.5 B2b-2 +4.4 +9.1 +13.7 +1.6 +3.0 +4.0 +0.0 +0.2 +0.3 [000849] As can be seen from the table above, the increase of impurities after 45 days at 37°C was less than 14% for cagrilintide and less or equal to 4% for tirzepatide. The increase of HMWP content remained less than 1% after 45 days at 37°C. Example C2-4: Stability study on Cagrilintide / Semaglutide compositions with co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals [000850] Results of the chemical stability (RP-UPLC and SEC-HPLC methods) are presented below. Cagrilintide impuritySemaglutide HMWP content levels (%, delta vs impurity levels (%, T0) delta vs T0) (%, delta vs T0) T14D T28D T14D T28D T14D T28D C2-4-1 B4-1 +3.0 +5.8 +2.1 +4.7 +0.1 +0.2 C2-4-2 B4-2+2.6 +5.4 +1.9 +3.7 +0.2 +0.3C2-4-3 B4-3 +3.0 +5.7 +1.5 +3.1 +0.1 +0.3 [000851] These results show that compositions according to the invention comprising certaintypes of co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals are able to stabilize co-formulated cagrilintide and semaglutide. Example C2-5: Stability study on Cagrilintide / Semaglutide compositions with A1 [000852] Results of the chemical stability (RP-UPLC and SEC-HPLC methods) are presented below. Cagrilintide impuritySemaglutide HMWP content levels (%, delta vs impurity levels (%, T0) delta vs T0) (%, delta vs T0) T14D T28D T14D T28D T14D T28D C2-5-1 B5-1 +3.3 +6.6 +2.0 +3.3 < +1 < +1 C2-5-2 B5-2+3.9 +6.7 +1.4 +3.0 < +1 < +1C2-5-3 B5-3 +3.8 +6.2 +1.7 +3.2 < +1 < +1 C2-5-4 B5-4 +3.8 +7.1 +1.5 +2.9 < +1 < +1 C2-5-5 B5-5 +4.3 +7.7 +1.5 +2.9 < +1 < +1 C2-5-6 B5-6 +3.4 +6.6 +1.6 +2.9 < +1 < +1 C2-5-7 B5-7 +3.2 +6.3 +2.1 +3.3 < +1 < +1 C2-5-8 B5-8 +3.0 +5.8 +1.7 +3.2 < +1 < +1 C2-5-9 B5-9 +3.1 +5.9 +1.5 +3.2 < +1 < +1 C2-5- B5-10 +3.0 +5.0 +1.9 +3.1 < +1 < +1 10 [000853] These results show that compositions with variations, as excipients, concentration of co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals and concentration of peptides, lead to similar results regarding chemical stability of peptides.Example C3: Preservatives challenge test [000854] Challenge tests were conducted according to both EP 11thedition chapter 5.1.3 and USP 43 chapter <51>. Exam Formulat T6H T24H T7D T14D T28D USP Strain EP 5.1.3 ple ion (log10) (log10) (log10) (log10) (log10) <51> Pa > 5.0 > 5.0 > 5.0 > 5.0 > 5.0 Sa 2.7 > 4.8 > 4.8 > 4.8 > 4.8 Conform C3-1 B3-1 Ec > 5.1 > 5.1 > 5.1 > 5.1 > 5.1 (Criteria Conform Ca 0.2 2.0 > 4.9 > 4.9 > 4.9 A) Ab 1.2 4.1 > 4.6 > 4.6 > 4.6 Pa > 5.0 > 5.0 > 5.0 > 5.0 > 5.0 Sa 2.0 > 4.8 > 4.8 > 4.8 > 4.8 Conform C3-2 B3-2 Ec 2.6 > 5.1 > 5.1 > 5.1 > 5.1 (Criteria Conform Ca 0.0 1.6 > 4.9 > 4.9 > 4.9 A) Ab 1.0 4.0 > 4.6 > 4.6 > 4.6 Pa 0.0 0.1 < -0.7 < 0.3 -1.4 Sa - 0.5 - 0.4 0.5 2.2 4.8 Not Not C3-3 B3-3 Ec - 0.2 < - 0.6 - 0.4 < 0.4 0.7 conform conform Ca < - 0.1 < - 0.1 - 0.1 0.4 0.1 Ab - 0.1 - 0.1 0.7 1.0 < 0.6 Pa 0.2 0.3 1.3 1.8 2.1 Sa - 0.4 - 0.4 0.6 2.7 > 4.8 Not Not C3-4 B3-4 Ec - 0.2 - 0.6 - 0.4 < 0.4 1.3 conform conform Ca < - 0.1 - 0.2 0.0 0.4 0.3 Ab - 0.2 0.1 1.0 2.8 > 4.6 Pa : Pseudomonas aeruginosa / Sa : Staphylococcus aureus / Ec : Escherichia coli / Ca : Candida albicans / Ab : Aspergillus brasiliensis[000855] These results show that formulations from the invention (B3-1 and B3-2) are conform to Criteria A of EP and to USP while formulations from prior art are not conform either to EP nor to USP. Example C4: Stability Study [000856] Monitoring of chemical stability was performed as detailed in part C. [000857] The formulations B5-11 and B3-5 were prepared as disclosed above [000858] Results of the chemical stability (RP-UPLC and SEC-HPLC methods) are presented below. CagrilintideSemaglutide HMWP content impurity levels impurity levels (%, delta vs T0) (%, delta vs T0) (%, delta vs T0) T14D T28D T14D T28D T14D T28D C4-1 B5-11 +2.9 +4.7 +2.0 +3.4 < +0.5 < +0.5 C4-2 B3-5 +9.5 +14.9 +3.4 +5.8 < 0.5 < 0.5 [000859] This comparison between a formulation according to the invention (Example C4-1 with formulation B5-11) with a formulation of the prior art (Example C4-2 with formulation 3-5) from Novo Nordisk (WO202 / 3110833) shows that the invention leads an improved chemical stability of both cagrilintide and semaglutide.Part D –Pharmacokinetics (PK) Example D1: Pharmacokinetic Study of composition B2a-5 compared to separate injections of cagrilinide and semaglutide [000860] A Pharmacokinetic (PK) study was conducted in Göttingen mini pigs to evaluate the pharmacokinetics (PK) of cagrilintide and semaglutide after subcutaneous (sc) administration of a single injection of the composition described in example B2a- 5 or of separate simultaneous injections of cagrilintide and semaglutide. [000861] Two parallel groups of 6 female mini pigs, weighing approximately 50 kg, were injected with about 150 µL of the composition B2a-5 or 150 µL of semaglutideformulation and 150 µL of cagrilintide formulation. Concentrations of APIs were the same in the composition B2a-5 and formulations of cagrilintide and semaglutide. Blood was sampled at predefined time points up to 432h. [000862] Plasma concentrations of cagrilintide and semaglutide were determined using an LC-MS / MS method. Non-compartimental PK analysis, using individual plasma concentration-time profiles, was performed. [000863] Composition B2a-5 showed an exposure similar to separate injections for cagrilintide and for semaglutide. Ratio of mean AUCinf / dose were of 0.93 for cagrilintide and 1.06 for semaglutide. Moreover, no difference was observed in terminal half-life. Ratio were 0.97 for cagrilintide and 0.99 for semaglutide. [000864] In addition, the absorption rate of the APIs was slowed down when administered as composition B2a-5. Indeed, delayed of median Tmax were observed for cagrilintide and semaglutide (from 6h to 36h and from 8h to 36h respectively). A large decrease of Cmax was also observed for cagrilintide. The ratio of mean Cmax / dose was 0.64. [000865] These results show that composition B2a-5 allows single injection of cagrilintide and semaglutide. Moreover, the slowing down of the absorption rate of APIs and / or decrease of Cmax can lead to interesting advantages (e.g. reducing side effects).

Claims

CLAIMS 1. A composition, in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, comprising - a peptide 1, which is a GLP-1 receptor agonist, having an isoelectic point, pI1, of less than 6.5, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy,said co-polyamino acid consisting of glutamic or aspartic units, and said hydrophobic radicals Hy being according to formula X below:Formula X in which - GpR is chosen from the radicals according to formulas VII, VII’ or VII’:- identical or different GpG and GpH are chosen from the radicals according to formulas XI or XI’: Formula XI Formula XI’ - GpA is chosen from the radicals according to formula VIII:Formula VIII in which A’ is chosen from the radicals according to formula VIII’, VIII’’ or VIII’’’:Formula VIII’ Formula VIII’’ Formula VIII’’’ - GpL is chosen from the radicals according to formula XII:- GpC is a radical according to formula IX:the * indicates the attachment sites of the different groups bonded by the amide functions; - a is an integer equal to 0 or to 1 and a’ = 1 if a = 0 and a’ = 1, 2 or 3 if a = 1; - a’ is an integer equal to 1, to 2, or to 3 - b is an integer equal to 0 or to 1; - c is an integer equal to 0 or to 1, and if c is equal to 0, then d is equal to 1 or to 2; - d is an integer equal to 0, to 1, or to 2; - e is an integer equal to 0 or to 1; - g is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6; - h is an integer equal to 0, to 1, to 2, to 3, to 4, to 5 or to 6; - l is an integer equal to 0 or 1 and l’ = 1 if l = 0, and l’ = 2 if l = 1; - r is an integer equal to 0, to 1, or to 2, and - s’ is an integer equal to 0 or 1, and - if e is different from 0, then at least one of g, h or l is different from 0;- A, A1, A2 and A3, identical or different, are linear or branched alkyl radicals, and / or substituted by a radical derived from a saturated, unsaturated or aromatic ring, comprising 1 to 8 carbon atoms. - B is a linear or branched alkyl radical and / or comprising an aromatic nucleus, comprising 1 to 9 carbon atoms or an unsubstituted ether or polyether radical comprising from 4 to 14 carbon atoms and from 1 to 5 oxygen atoms; - Cx is a linear or branched monovalent alkyl radical, and / or comprising a cyclic part, in which x indicates the number of carbon atoms and: ^ when the hydrophobic radical -Hy carries 1 -GpC, then 9 ≤ x ≤ 25, ^ when the hydrophobic radical -Hy carries 2 -GpC, then 9 ≤ x ≤ 15, ^ when the hydrophobic radical -Hy carries 3 -GpC, then 7 ≤ x ≤ 13, ^ when the hydrophobic radical -Hy carries 4 -GpC, then 7 ≤ x ≤ 11, ^ when the hydrophobic radical -Hy carries at least 5 -GpC, then 6 ≤ x ≤ 11, - G is a branched alkyl radical of 1 to 8 carbon atoms, with said alkyl radical bearing one or more free carboxylic acid functions, - R is a radical chosen from the group consisting of a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms, a divalent alkyl radical, linear or branched, comprising 1 to 12 carbon atoms bearing one or more -CONH2 functions, or a unsubstituted ether or polyether radical comprising from 4 to 14 carbon atoms and 1 to 5 oxygen atoms: - the hydrophobic radical(s) -Hy according to formula X being bonded to the PLG: - via a covalent bond between a carbonyl of the hydrophobic radical -Hy and a nitrogen atom borne by the PLG, thus forming an amide function derived from the reaction of an amine function borne by the PLG and an acid function borne by the precursor -Hy’ of the hydrophobic radica -Hy, or - via a covalent bond between a nitrogen atom of the hydrophobic radical -Hy and a carbonyl borne by the PLG, thus forming an amide function derived from thereaction of an amine function of the precursor -Hy’ of the hydrophobic -Hy radical and an acid function borne by the PLG, - the ratio M between the number of hydrophobic radicals and the number of glutamic or aspartic units being from 0 < M ≤ 0.5; - when several hydrophobic radicals are borne by a co-polyamino acid, then they are identical or different, - the degree of polymerization DP in glutamic or aspartic units for PLG chains is comprised from 5 to 250; - free carboxylic acid functions being in the form of an alkali metal salt chosen from the group consisting of Na+and K+.

2. A composition according to Claim 1, characterized in that the GLP-1 RA has a pI1of less than 6.0, in particular in the range of 3.5 to 6.

0.

3. A composition according to Claim 1 or 2, characterized in that the GLP-1 RA is chosen from the list consisting of semaglutide, ecnoglutide, tirzepatide, CT388, survodutide, pemvidutide, mazdutide, retatrutide, AZD 9550 and dapiglutide, in particular is chosen from semaglutide and tirzepatide.

4. A composition according to Claim 3, characterized in that the peptide chosen from the list comprising semaglutide, ecnoglutide, tirzepatide, CT388, survodutide, pemvidutide, mazdutide, retatrutide,dapiglutide and AZD 9550, in particular chosen from semaglutide and tizepatide, is at a concentration ranging from 0.25 mg / ml to 30 mg / ml.

5. A composition according to any one of Claims 1 to 4, characterized in that it further comprises a peptide 2, which is an API, in particular having an isoelectric point, pI2, which is superior or equal to pI1 + 2 (pI1 + 2 ≤ pI2) or the pI2 is in the range from 6 to 12.

6. A composition according to Claim 5, characterized in that the peptide 2 is an amylin RA, in particular chosen from the list consisting of cagrilintide, petrelintide,eloralintide, AZ6234, gubamy, NN 1213, peptide A and Dacra QWII, also called cololuntide, more particularly is cagrilintide.

7. A composition according to Claims 5 or 6, characterized in that it comprises the peptide 2 which is is an amylin RA, in particular chosen from the list consisting of cagrilintide, petrelintide, eloralintide, AZ6234, gubamy, NN 1213, peptide A and Dacra QWII, and more particularly cagrilintide, at a concentration ranging from 0.25 mg / ml to 30 mg / ml.

8. A composition according any one of Claims 1 to 7, characterized in that the co- polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from the co-polyamino acids according to formula XXXa’ below:formula XXXa’ in which - D represents, independently, either a -CH2- group (aspartic unit) or a -CH2-CH2- group (glutamic unit), - Hy is a hydrophobic radical chosen from the hydrophobic radicals according to formula X, in which r=1 and GpR is a radical according to formula VII, - R1is a hydrophobic radical chosen from the hydrophobic radicals according to formula X in which r=0 or r=1 and GpR is a radical according to formula VII’, or a radical chosen from the group consisting of an H, a linear acyl group in C2 to C10, a branched acyl group in C4 to C10, a benzoyl, a terminal “amino acid” unit and a pyroglutamate,- R2 is a hydrophobic radical chosen from the hydrophobic radicals according to formula X in which r=1 and GpR is a radical according to formula VII, or a -NR’R’’ radical, R’ and R”, either identical or different, being chosen from the group comprised by H, linear or branched or cyclic alkyls in C2 to C10, or benzyl, and said R’ and R” alkyls which may form together one or more carbonated, saturated, unsaturated and / or aromatic cycle(s), and / or may comprise hetero-atoms, chosen from the group comprised of O, N and S; - X represents a cationic entity chosen from the group comprising alkaline cations; - n + m represents the degree of polymerization DP of the co-polyamino acid, namely, the average number of monomeric units per co-polyamino acid chain and 5 ≤ n + m ≤ 250.

9. A composition according any one of Claims 1 to 8, characterized in that the co- polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from the co-polyamino acids according to formula XXXa’ in which n = 0 according to formula XXXb below:formula XXXb in which m, X, D, R1 and R2 have the definitions given in Claim 8 and at least R1 or R2 is hydrophobic radical according to formula X.

10. The composition according to claim 9, characterized in that the co- polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from the co-polyamino acids according to formula XXXb in which R2 is a hydrophobic radical according to formula X in which r = 1 and GpR is according to formula VII.

11. A composition according any one of Claims 1 to 6, characterized in that the co- polyamino acid bearing carboxylate charges and hydrophobic radicals is chosen from the co-polyamino acids according to formula co-polyamino acids of formula A-XXXI:Formula A-XXXI Wherein 85. D represents, independently, either a group -CH2- (aspartic acid) or a group - CH2-CH2- (glutamic acid), 86. X represents a cationic entity chosen in the group comprising alkali cations, 87. Ra and R’a, identical or different, are either a hydrophobic radical -Hy, or a radical chosen in the group consisting of an H, a C2 to C10 linear acyl group, a C3 to C10 branched acyl group, a benzyl, a terminal "amino acid" unit and a pyroglutamate, 88. at least one of Ra and R’a being a hydrophobic radical -Hy, in particular both Ra and Ra’ are hydrophobic radicals -Hy, 89. n’ + m’ represents the degree of polymerization DP of the co-polyamino acid, namely the mean number of monomeric units per co-polyamino acid chain and 8 ≤ n’ + m’ ≤ 250.

90. Q is corresponding to only one Q’, in particular chosen from the group consisting of Formula A-III, A-IV and A-IvaFormula A-III 91. wherein 1 ≤ t ≤ 8, in particular with Fa and Fa’ being -NH-,Formula A-IV wherein:

92. at least one of u1’’ or u2’’ is different to 0.

93. If u1’’ ≠ 0 then u1’ ≠ 0 and if u2’’ ≠ 0 then u2’ ≠ 0, 94. u1’ and u2’ are identical or different and, 95.2 ≤ u ≤ 4, 96.0 ≤ u1’ ≤ 4, 97.0 ≤ u1’’ ≤ 8, in particular 0 ≤ u1’’ ≤ 4, 98.0 ≤ u2’ ≤ 4 99.0 ≤ u2’’ ≤ 8, in particular 0 ≤ u2’’ ≤ 4, and *-Fb-(CH2)2-(O(CH2)2)aa -Fb’ Formula A-IVa wherein aa is an integer comprised between 1 and 16, in particular between 2 and 8, and 100. Fb and Fb’, identical or different, are representing functions -NH- or -CO- , in particular Fb andFb’ represents -NH-.composition acc12. Theording to anyof claims 1 to11, characterized in that it further comprises a preservative.

13. The composition according to any of claims 1 to 12, characterized in that said composition is in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, comprising- semaglutide,- cagrilintide, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy having the following Formula A:wherein- M = 0.02 to 0.1, n = 10 to 50, R1 = H or pyroglutamate,inparticular with n = 21, R1 = H or pyroglutamate, with atleast 95% pyroglutamate.

14. The composition according to any of claims 1 to 12, characterized in that said composition is in the form of an aqueous injectable solution, whose pH is comprised from 5.0 to 6.0, comprising- tirzepatide,- cagrilintide, and - a co-polyamino acid (PLG) bearing carboxylate charges and hydrophobic radicals Hy having the following Formula A:wherein- M = 0.02 to 0.1, n = 10 to 50, R1 = H o pyroglutamate, in particular with n = 21, R1 = H or pyroglutamate, with at least 95% pyroglutamate.

15. The composition according to any of claims 1 to 14, for use as a medicament.

16. The composition according to any of claims 1 to 15, for use for treatment of overweight, obesity, diabetes, cardio-vascular disease(s), non-alcoholic steatohepatitis (NASH), and / or cognitive impairment, such as caused by Alzheimer Disease (AD).

17. Injection device, cartridge or vial comprising a composition as disclosed in any one of the claims 1 to 16, in particular intended for a multiple use.

Citation Information

Patent Citations

  • Colloidal suspensions of block and diblock polyaminoacid copolymers useful as carriers for pharmaceutical, nutritional, phytosanitary, and cosmetically active materials, giving increased biodispersibility

    FR2801226A1

  • New polyamino acids having grafted alpha-tocopherol moieties, useful as biodegradable, biocompatible carriers for active agents, e.g. drugs, nutrients, cosmetic agents or plant protectants

    FR2840614A1

  • Injectable solution at ph 7 comprising at least one basal insulin wherein the pi is comprised form 5.8 to 8.5 and a co-polyamino acid bearing carboxylate charges and hydrophobic radicals

    US20190275115A1

  • Injectable ph 7 solution comprising at least one basal insulin having a pi from 5.8 to 8.5 and a co-polyamino acid bearing carboxylate charges and hydrophobic radicals

    US20200306379A1

  • Injectable solution at ph 7 comprising at least a basal insulin which pi is comprised between 5.8 and 8.5 and a copolyamino acid bearing carboxylate charges and hydrophobic radicals

    US20220040099A1