Dosing of antigen binding molecules targeting thymic stromal lymphopoietin (TSLP)
Antibodies targeting TSLP with specific CDR sequences are administered to modulate TSLP activity, effectively reducing inflammatory markers and improving lung function in pulmonary diseases.
Patent Information
- Application Number
- PCT/US2025/016909
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2025-01-31
- Filing Date
- 2025-02-21
- Publication Date
- 2025-08-28
AI Technical Summary
There is a need for therapeutic agents that can modulate thymic stromal lymphopoietin (TSLP) binding and activity to treat inflammatory pulmonary diseases.
Administration of antibodies or antigen-binding fragments thereof, comprising specific heavy and light chain complementarity determining regions, at therapeutically effective doses and intervals, to target and reduce TSLP activity in subjects.
The antibodies effectively decrease eosinophils, leukocytes, TH2 cytokines, IgE, and chemokines levels, and increase the ratio of TH1/TH2 cells, improving lung function and reducing inflammation in pulmonary diseases.
Smart Images

Figure IMGF000030_0001 
Figure IMGF000031_0001 
Figure IMGF000032_0001
Abstract
Description
DOSING OF ANTIGEN BINDING MOLECULES TARGETING THYMIC STROMAL LYMPHOPOIETIN (TSLP)RELATED APPLICATION(S)
[0001] This application claims the benefit of U.S. Provisional Application No. 63 / 752,476, filed on January 31, 2025, U.S. Provisional Application No.63 / 743, 800, filed on January 10, 2025, U.S. Provisional Application No. 63 / 690,713, filed on September 4, 2024, and U.S. Provisional Application No. 63 / 556,716, filed on February 22, 2024. The entire teachings of the above applications are incorporated herein by reference.INCORPORATION BY REFERENCE OF MATERIAL IN XML
[0002] This application incorporates by reference the Sequence Listing contained in the following extensible Markup Language (XML) file being submitted concurrently herewith: a) File name: 57081089004_SL.xml; created February 21, 2025, 61,394 Bytes in size.BACKGROUND
[0003] Thymic stromal lymphopoietin (TSLP) is a cytokine that has been implicated in the pathogenesis of a variety of inflammatory conditions. Released upon epithelial exposure to “insults” such as allergens, TSLP initiates a cascade of downstream inflammation. TSLP receptors (TSLPRs) are expressed in a wide range of cell types, including airway smooth muscle cells (ASMCs), basophils, dendritic cells, eosinophils, group 2 innate lymphoid cells (ILC2s), hematopoietic progenitor cells, lymphocytes, macrophages, mast cells and monocytes (Gauvreau et al., Thymic stromal lymphopoietin: its role and potential as a therapeutic target in asthma, Expert Opin Ther Targets 24(8):777-92 (2020)). There is compelling evidence that dysregulated TSLP expression can lead to allergic disease through the development of type 2 inflammatory responses (Ziegler et al., The biology of thymic stromal lymphopoietin (TSLP), Adv Pharmacol. 66: 129-55 (2013)).SUMMARY
[0004] There is a critical need for therapeutic agents for modulating (e.g., reducing or neutralizing) thymic stromal lymphopoietin (TSLP) binding and / or activity. The present disclosure provides methods of modulating TSLP binding and / or activity, and methods oftreating TSLP-associated diseases or conditions using an antibody as described herein, or antigen-binding fragments thereof.
[0005] In some embodiments, the present disclosure provides a method of treating an inflammatory pulmonary disease in a subject, comprising administering to the subject a therapeutically effective dose of about 10 mg to about 1000 mg of an antibody, or antigenbinding fragment thereof, that binds to TSLP at an interval of about every 3 months to about every 12 months, wherein the antibody, or antigen-binding fragment thereof, comprises: (i) a heavy chain complementarity determining region (HCDR)1 comprising the amino acid sequence of SEQ ID NO:31, a HCDR2 comprising the amino acid sequence of SEQ ID NO:35, and a HCDR3 comprising the amino acid sequence of SEQ ID NO:50, and (ii) a light chain complementarity determining region (LCDR)1 comprising the amino acid sequence of SEQ ID NO:60, a LCDR2 comprising the amino acid sequence of DDS, and a LCDR3 comprising the amino acid sequence of SEQ ID NO:71.
[0006] In some embodiments, an effective dose is about 150 mg to about 1500 mg, about 200 mg to about 1400 mg, about 250 mg to about 1300 mg, or about 300 mg to about 1200 mg (e.g., 300 mg, 600 mg, or 1200 mg).
[0007] In some embodiments, an effective dose is administered about every 3 months, about every 4 months, about every 6 months, about every 9 months, or about every 12 months. In some embodiments, an effective dose is administered about every 6 months. In some embodiments, an effective dose is administered about every 24 weeks, about every 26 weeks, or about every 28 weeks. In some embodiments, an effective dose is administered about every 26 weeks.
[0008] In some embodiments, an effective dose is administered subcutaneously, intravenously, intramuscularly, or intraperitoneally.
[0009] In some embodiments, an effective dose is administered subcutaneously as a single dose of about 10 mg, about 30 mg, about 100 mg, about 300 mg, about 600 mg, or about 1200 mg.
[0010] In some embodiments, an effective dose is administered subcutaneously as two doses of about 100 mg, two doses of about 300 mg, or two doses of about 600 mg.
[0011] In some embodiments, a method of the present disclosure provides administering an antibody disclosed herein, or antigen-binding fragment thereof, to a human subject. In some embodiments, a subject is adult.
[0012] In some embodiments, administering an effective dose of an antibody disclosed herein, or antigen-binding fragment thereof, decreases the level of eosinophils in a blood, sputum, and / or bronchoalveolar fluid sample from a subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering.
[0013] In some embodiments, administering an effective dose of an antibody disclosed herein, or antigen-binding fragment thereof, decreases the level of leukocytes in a blood, sputum, and / or bronchoalveolar fluid sample from the subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering.
[0014] In some embodiments, administering an effective dose increases the ratio of TH21OWT cells to Tn2hlghT cells in a blood, sputum, and / or bronchoalveolar fluid sample from the subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering.
[0015] In some embodiments, administering an effective dose of an antibody disclosed herein, or antigen-binding fragment thereof, decreases the level of one or more TH2 cytokines in a blood, sputum, and / or bronchoalveolar fluid sample from the subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering. In some embodiments, one or more TH2 cytokines comprise IL-4, IL-13, IL-5, or a combination thereof.
[0016] In some embodiments, administering an effective dose of an antibody disclosed herein, or antigen-binding fragment thereof, decreases the level of IgE in a blood and / or bronchoalveolar fluid sample from the subject as compared to a blood and / or bronchoalveolar fluid sample collected from the subject prior to administering.
[0017] In some embodiments, administering an effective dose of an antibody disclosed herein, or antigen-binding fragment thereof, decreases the level of one or more chemokine in a blood, sputum, and / or bronchoalveolar fluid sample from the subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering. In some embodiments, one or more chemokines comprise CCL17, CCL22, CXCL8, CCL1, CCL24, or a combination thereof.
[0018] In some embodiments, administering an effective dose of an antibody disclosed herein, or antigen-binding fragment thereof, achieves a serum half-life of the antibody, or antigen-binding fragment thereof, in a subject of about 50 to about 150 days (e.g., about 100 days).
[0019] In some embodiments, administering an effective dose of an antibody disclosed herein, or antigen-binding fragment thereof, achieves a maximum serum concentration (Cmax) of the antibody, or antigen-binding fragment thereof, in a subject of about 1 pg / ml to about 250 pg / ml.
[0020] In some embodiments, administering an effective dose of an antibody disclosed herein, or antigen-binding fragment thereof, achieves a serum AUCo-7d value of the antibody, or antigen-binding fragment thereof, in the subject of about 10 qg-day / ml to about 1500 gg'day / ml.
[0021] In some embodiments, administering an effective dose of an antibody disclosed herein, or antigen-binding fragment thereof, improves forced expiratory volume (FEV), FEVi reversibility, forced vital capacity (FVC), FeNO, Asthma Control Questionnaire-6 score, AQLQ(S)+12 score, or combination thereof.
[0022] In some embodiments, a method of the present disclosure comprises administering an antibody, or antigen-binding fragment thereof comprising a VH comprising an amino acid sequence of SEQ ID NO:5, and a VL comprising an amino acid sequence of SEQ ID NO:21. In some embodiments, an antibody comprises a HC comprising an amino acid sequence of SEQ ID NO:92, and a LC comprising an amino acid sequence of SEQ ID NO: 120. In some embodiments, an antibody comprises a HC comprising an amino acid sequence of SEQ ID NO: 106, and a LC comprising an amino acid sequence of SEQ ID NO: 120.
[0023] In some embodiments, the present disclosure provides a method of treating an inflammatory pulmonary disease in a human patient, comprising administering to the patient a therapeutically effective dose of about 10 mg to about 1,200 mg of an antibody at an interval of about every 24 weeks to about every 28 weeks, wherein the antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO: 92; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
[0024] In some embodiments, the present disclosure provides a method of treating an inflammatory pulmonary disease in a human patient, comprising administering to the patient a therapeutically effective dose of about 10 mg to about 1,200 mg of an antibody at an interval of about every 24 weeks to about every 28 weeks, wherein the antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO: 106; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
[0025] In some embodiments, a method of the present disclosure comprises administering to the human patient:a) about 10 mg of the antibody at an interval of about every 24 weeks; b) about 10 mg of the antibody at an interval of about every 26 weeks; c) about 10 mg of the antibody at an interval of about every 6 months; d) about 10 mg of the antibody at an interval of about every 28 weeks; e) about 30 mg of the antibody at an interval of about every 24 weeks; f) about 30 mg of the antibody at an interval of about every 26 weeks; g) about 30 mg of the antibody at an interval of about every 6 months; h) about 30 mg of the antibody at an interval of about every 28 weeks; i) about 100 mg of the antibody at an interval of about every 24 weeks; j) about 100 mg of the antibody at an interval of about every 26 weeks; k) about 100 mg of the antibody at an interval of about every 6 months; l) about 100 mg of the antibody at an interval of about every 28 weeks; m) about 300 mg of the antibody at an interval of about every 24 weeks; n) about 300 mg of the antibody at an interval of about every 26 weeks; o) about 300 mg of the antibody at an interval of about every 6 months; p) about 300 mg of the antibody at an interval of about every 28 weeks; q) about 600 mg of the antibody at an interval of about every 24 weeks; r) about 600 mg of the antibody at an interval of about every 26 weeks; s) about 600 mg of the antibody at an interval of about every 6 months; t) about 600 mg of the antibody at an interval of about every 28 weeks; u) about 1200 mg of the antibody at an interval of about every 24 weeks; v) about 1200 mg of the antibody at an interval of about every 26 weeks; w) about 1200 mg of the antibody at an interval of about every 6 months; or x) about 1200 mg of the antibody at an interval of about every 28 weeks.
[0026] In some embodiments, a method of the present disclosure comprises administering an antibody subcutaneously.BRIEF DESCRIPTION OF THE DRAWINGS
[0027] The foregoing will be apparent from the following more particular description of example embodiments, as illustrated in the accompanying drawings in which like reference characters refer to the same parts throughout the different views. The drawings are not necessarily to scale, emphasis instead being placed upon illustrating embodiments.
[0028] FIGs. 1A and IB depict the binding of an exemplary anti-TSLP antibody of the present disclosure to human or cynomolgus TSLP. FIG. 1A is a line graph showing the binding of AB-2b, with and without Fc YTE substitutions, to human TSLP as measured by ELISA FIG. IB is a line graph showing the binding of AB-2b, with and without Fc YTE substitutions, to cynomolgus monkey TSLP as measured by ELISA
[0029] FIGs. 2A-2J depict the design and endpoints of an exemplary study assessing the efficacy of anti-TSLP antibodies of the present disclosure in a TSLP / ovalbumin (OVA)- induced model of asthma in B-hTSLP / hTSLPR mice. FIG. 2A is schematic illustrating an exemplary OVA and anti-TSLP antibody dosing schedule in B-hTSLP / hTSLPR mice. Mice were dosed intranasally with 40 pl of PBS containing 1 pg human recombinant TSLP and 10 pg OVA, or 10 pg OVA only (negative control) every two days. Saline, isotype control (10 mg / kg), AB-2b without Fc YTE substitutions, or Tezepelumab were administered via intraperitoneal injection on Day -1 before dosing and on Day 6. FIG. 2B is a bar graph showing total serum IgE levels (ng / mL) in mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 2C is a bar graph showing OVA- specific IgE serum levels (ng / mL) in mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 2D is a bar graph showing the percentage of eosinophils in the total bronchoalveolar lavage fluid (BALF) cell count of mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 2E is a bar graph showing bronchoalveolar lavage fluid (BALF) eosinophil cell counts in mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 2F is a bar graph showing BALF TARC / CCL17 concentrations (pg / mL) in mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG.2G is a bar graph showing BALF IL-4 concentrations (pg / mL) in mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 2H is a bar graph showing BALF IL-13 concentrations (pg / mL) in mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 21 is a bar graph showing total BALF IgE levels (ng / mL) in mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 2J is a bar graph showing BALF OVA-specific IgE levels (ng / mL) in mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. ns = not significant, * p < 0.05, ** p < 0.01, *** p < 0.001, **** p < 0.0001.
[0030] FIGs. 3A-3E depict inflammatory endpoint histological scores and representative images of lung sections collected from B-hTSLP / hTSLPR mice dosed according to the schedule depicted in FIG. 2A. FIG. 3A is a bar graph showing inflammatory cell infiltration scores in lung sections collected from B-hTSLP / hTSLPR mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 3B is a bar graph showing eosinophil infiltration scores in lung sections collected from B-hTSLP / hTSLPR mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 3C shows micrographs of hematoxylin and eosin (H&E)-stained lung sections collected from B- hTSLP / hTSLPR mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti- TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 3D is a bar graph showing mucus production (% positive area) inlung sections collected from B-hTSLP / hTSLPR mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. FIG. 3E shows micrographs of Periodic acid- Schiff (PAS)-stained lung sections collected from B-hTSLP / hTSLPR mice treated with 0.3 mg / kg, 3 mg / kg, or 10 mg / kg of an exemplary anti-TSLP antibody of the present disclosure (AB-2b without Fc YTE), reference antibody (Tezepelumab), or isotype control (Isotype) and dosed with OVA according to the schedule depicted in FIG. 2A. ** p < 0.01, *** p < 0.001, **** / ? < 0.0001.
[0031] FIGs. 4A-4D depict serum concentration levels of an exemplary anti-TSLP antibody of the present disclosure in male cynomolgus monkeys. FIG. 4A is a line graph showing the serum concentrations of AB-2b antibody over the course of 2184 hours in male cynomolgus monkeys intravenously (IV) administered with a single 2 mg / kg dose of AB-2b. FIG. 4B is a line graph showing the serum concentrations of AB-2b antibody over the course of 2184 hours in male cynomolgus monkeys intravenously (IV) administered with a single 10 mg / kg dose of AB-2b. FIG. 4C is a line graph showing the serum concentrations of AB-2b antibody over the course of 2184 hours in male cynomolgus monkeys intravenously (IV) administered with a single 25 mg / kg dose of AB-2b. FIG. 4D is a line graph showing the serum concentrations of AB-2b antibody over the course of 2184 hours in male cynomolgus monkeys subcutaneously administered with a single 25 mg / kg dose of AB-2b. Dose administration on day 1 is plotted as day 0.
[0032] FIG. 5A depicts PK of AB-2b observed in cynomolgus monkeys (ti / 2 is approximately 31-34 days). FIGs. 5B-5D depict predicted pharmacokinetic (PK) and physiologically-based PK (PBPK) models for an exemplary anti-TSLP antibody of the present disclosure in humans. FIG. 5B is a line graph showing predicted serum concentrations (pg / mL) of AB-2b in humans over the course of a month following subcutaneous administration of AB-2b (210 mg) as compared to reported concentrations of Tezepelumab. FIG. 5C is a line graph showing predicted TSLP suppression in human lung epithelial lining fluid across single dose levels of 10 mg, 30 mg, 100 mg, 300 mg, or 600 mg of AB-2b (AB) with a predicted half-life of 56 days as compared to an approved 210 mg subcutaneous (SC) dosage of Tezepelumab (Teze) every four weeks (Q4W), a 700 mg IV dosage administered in 3 doses Q4W, or a 280 mg subcutaneous dosage administered every two weeks (Q2W). FIG. 5D is a line graph showing predicted TSLP suppression in humanlung epithelial lining fluid across single dose levels of 10 mg / kg, 30 mg / kg, 100 mg / kg, 300 mg / kg, or 600 mg / kg of AB-2b (AB) with a predicted half-life of 100 days as compared to an approved 210 mg subcutaneous (SC) dosage of Tezepelumab every four weeks (Q4W), a 700 mg IV dosage administered in 3 doses Q4W, or a 280 mg subcutaneous dosage administered every two weeks (Q2W).
[0033] FIGs. 6A-6F are first-in-human (FIH) PK comparisons between AB-2b and monoclonal antibody AIO-001 anti-TSLP antibody (Aiolis Bio / GSK). The data supports administering AB-2b every 26 weeks (Q26W).
[0034] FIGs. 7A-7C depict preliminary pharmacodynamic (PD) data from AB-2b in humans. FIGs. 7A-7B Reductions in Eosinophils and FeNO were observed through week 25. The baseline is defined as Day 1 pre-dose or last available result available pre-dose (i.e., day -1); Y-axis represents median % change from baseline + / - median absolute deviation. FIG. 7C. shows accumulation of total TSLP. FIG. 7D shows a 20-fold increase in affinity in AB- 2b compared to the reference antibody. FIGs. 7E-7F show dose-response data suggesting saturation of suppressive effects of treatment with AB-2b on IL-13 and IL-5, respectively.DETAILED DESCRIPTION
[0035] A description of example embodiments follows.
[0036] The present disclosure provides anti-TSLP antibodies, or antigen-binding fragments thereof, or compositions comprising anti-TSLP antibodies, or antigen-binding fragments thereof, for use in the treatment of chronic inflammatory lung diseases in a subject.
[0037] Several aspects of the disclosure are described below, with reference to examples for illustrative purposes only. It should be understood that numerous specific details, relationships, and methods are set forth to provide a full understanding of the disclosure. One having ordinary skill in the relevant art, however, will readily recognize that the disclosure can be practiced without one or more of the specific details or practiced with other methods, protocols, reagents, cell lines and animals. The disclosure is not limited by the illustrated ordering of acts or events, as some acts may occur in different orders and / or concurrently with other acts or events. Furthermore, not all illustrated acts, steps or events are required to implement a methodology in accordance with the disclosure. Many of the techniques and procedures described, or referenced herein, are well understood and commonly employed using conventional methodology by those skilled in the art.I. Definitions
[0038] Unless otherwise defined, all terms of art, notations and other scientific terms or terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this disclosure pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and / or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. It will be further understood that terms, such as those defined in commonly-used dictionaries, should be interpreted as having a meaning that is consistent with their meaning in the context of the relevant art and / or as otherwise defined herein.
[0039] The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting.
[0040] When introducing elements disclosed herein, the articles “a,” “an,” “the,” and “said” are intended to mean that there are one or more of the elements. Further, the one or more elements may be the same or different. For example, unless the context clearly indicates otherwise, “a polypeptide” includes a single polypeptide, and two or more polypeptides.
[0041] Throughout this specification and the claims which follow, unless the context requires otherwise, the term “comprise,” and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of, e.g., a stated integer or step or group of integers or steps, but not the exclusion of any other integer or step or group of integer or step. When used herein, the term “comprising” can be substituted with the term “containing” or “including.”
[0042] As used herein, the term “consisting of’ excludes any element, step, or ingredient not specified in the claim element. When used herein, the term “consisting essentially of’ does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.
[0043] Also provided herein are corresponding embodiments for each and every embodiment featuring the term “comprising,” “containing,” “including,” or “having,” wherein those terms are replaced by the term “consisting of’ and / or “consisting essentially of’.
[0044] As used herein, the conjunctive term “and / or” between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by “and / or,” a first option refers to the applicability of the firstelement without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and, therefore, satisfy the requirement of the term “and / or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and, therefore, satisfy the requirement of the term “and / or.”
[0045] It should be understood that for all numerical bounds describing some parameter in this application, such as “about,” “at least,” “less than,” “fewer than,” and “more than,” the description also necessarily encompasses any range bounded by the recited values. Accordingly, for example, the description “at least 1, 2, 3, 4, or 5” also describes, inter alia, the ranges 1-2, 1-3, 1-4, 1-5, 2-3, 2-4, 2-5, 3-4, 3-5, and 4-5, et cetera.
[0046] When a list is presented, unless stated otherwise, it is to be understood that each individual element of that list, and every combination of that list, is a separate embodiment. For example, a list of embodiments presented as “A, B, or C” is to be interpreted as including the embodiments, “A,” “B,” “C,” “A or B,” “A or C,” “B or C,” or “A, B, or C.”
[0047] As used herein, the term “about” means within an acceptable error range for a particular value, as determined by one of ordinary skill in the art. Typically, an acceptable error range for a particular value depends, at least in part, on how the value is measured or determined, e.g., the limitations of the measurement system. For example, “about” can mean within an acceptable standard deviation, per the practice in the art. Alternatively, “about” can mean a range of ±20%, e.g., ±10%, ±5% or ±1% of a given value. It is to be understood that the term “about” can precede any particular value specified herein, except for particular values used in the Exemplification. When “about” precedes a range, as in “90-99.9%,” the term “about” should be read as applying to both given values of the range, such that “about 90-99.9%” means about 90% repeats to about 99.9%.
[0048] As used herein, the term “polypeptide” refers to a polymer of at least two amino acids covalently linked by an amide bond, regardless of length or post-translational modification (e.g., glycosylation or phosphorylation). A polypeptide can comprise any suitable L- and / or D-amino acid, for example, common a-amino acids (e.g., alanine, glycine, valine), non-a-amino acids (e.g., P-alanine, 4-aminobutyric acid, 6-aminocaproic acid, sarcosine, statine), and unusual amino acids (e.g., citrulline, homocitruline, homoserine, norleucine, norvaline, ornithine). The amino, carboxyl, and / or other functional groups on a polypeptide can be free (e.g., unmodified) or protected with a suitable protecting group.Suitable protecting groups for amino and carboxyl groups, and methods for adding or removing protecting groups are known in the art and are disclosed in, for example, Green and Wuts, “Protecting Groups in Organic Synthesis,” John Wiley and Sons, 1991. The functional groups of a polypeptide can also be derivatized (e.g., alkylated) or labeled (e.g., with a detectable label, such as a fluorogen or a hapten) using methods known in the art. A polypeptide can comprise one or more modifications (e.g., amino acid linkers, acylation, acetylation, amidation, methylation, terminal modifiers (e.g., cyclizing modifications), N- methyl-a-amino group substitution), if desired. In addition, a polypeptide can be an analog of a known and / or naturally-occurring peptide, for example, a peptide analog having conservative amino acid residue substitution(s).
[0049] As used herein, a “polynucleotide” is defined as a plurality of nucleotides and / or nucleotide analogs linked together in a single molecule. In some embodiments, a polynucleotide disclosed herein comprises deoxyribonucleotides. In some embodiments, the polynucleotide comprises ribonucleotides. Non-limiting examples of polynucleotides include single-, double- or multi -stranded DNA or RNA, DNA-RNA hybrids (e.g., each “T” position may be independently substituted by a “U” or vice versa), or a polymer comprising purine and pyrimidine bases, or other natural, chemically, or biochemically modified, non-natural, or derivatized nucleotide bases. The backbone of the polynucleotide can comprise sugars and phosphate groups, modified or substituted sugar or phosphate groups, a polymer of synthetic subunits such as phosphoramidates, or a combination thereof.
[0050] As used herein, the term “sequence identity” refers to the extent to which two nucleotide sequences have the same residues at the same positions when the sequences are aligned to achieve a maximal level of identity, expressed as a percentage. For sequence alignment and comparison, typically one sequence is designated as a reference sequence, to which test sequences are compared. Sequence identity between reference and test sequences is expressed as a percentage of positions across the entire length of the reference sequence where the reference and test sequences share the same nucleotide or amino acid upon alignment of the reference and test sequences to achieve a maximal level of identity. As an example, two sequences are considered to have 70% sequence identity when, upon alignment to achieve a maximal level of identity, the test sequence has the same nucleotide residue at 70% of the same positions over the entire length of the reference sequence.
[0051] Alignment of sequences for comparison to achieve maximal levels of identity can be readily performed by a person of ordinary skill in the art using an appropriate alignmentmethod or algorithm. In some instances, alignment can include introduced gaps to provide for the maximal level of identity. Examples include the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), and visual inspection (see generally Ausubel et al., Current Protocols in Molecular Biology).
[0052] When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequent coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. A commonly used tool for determining percent sequence identity is Protein Basic Local Alignment Search Tool (BLASTP) available through National Center for Biotechnology Information, National Library of Medicine, of the United States National Institutes of Health. (Altschul et al., 1990).
[0053] As used herein, the term “substantially similar to” refers to a polypeptide disclosed herein that is substantially similar in amino acid sequence (e.g., has at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% of the amino acid residues amino acid sequence identity) and substantially preserves one or more functional properties of a specified polypeptide disclosed herein (e.g., AB-1). In some embodiments, the one or more functional properties are selected from, without limitation, a substantially similar binding affinity, a substantially similar binding specificity, a substantially similar inhibitory activity, a substantially similar neutralization activity, and a substantially similar self-association property.
[0054] As used herein, a “complementarity determining region (CDR)” encompasses any CDR defined by an art-recognized method for identifying the CDR residues on an antibody. See, e.g., Kabat, E. A., et al., (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, Chothia et al., (1989) Nature 342:877; Chothia, C. et al., (1987) J. Mol. Biol. 196:901-917; Al-lazikani et al., (1997) J. Molec. Biol. 273:927-948; and Almagro, J. Mol. Recognit. 17: 132-143 (2004). See also hgmp.mrc.ac.uk and bioinf.org.uk / abs. Two antibodies aredetermined to have the same CDR as one another with respect to a HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and / or LCDR3, when the identity of that CDR is determined for both antibodies using the same method.
[0055] The extent of the framework region and the CDRs of an antibody can be identified using one of several suitable methodologies that are well known in the art, for example, by the Kabat definition, the Chothia definition, the AbM definition, and / or the contact definition. Publicly and / or commercially available tools for identifying framework and / or CDR regions include, IgBlast (accessible at www.ncbi.nlm.nih.gov / igblast / ), Scaligner (available from drugdesigntech at www.scaligner.com / ), IMGT rules and / or tools (see, for example, www.imgt.org / IMGTScientificChart / Nomenclature / IMGT-FRCDRdefmition.html, also accessible at www.imgt.org / ), Chothia Canonical Assignment (accessible at www.bioinforg.uk / abs / chothia.html), Antigen receptor Numbering And Receptor Classification (ANARCI, accessible at opig.stats.ox.ac.uk / webapps / newsabdab / sabpred / anarci / ), or the Paratome web server (accessible at www.ofranlab.org / paratome / , or the Paratome web server (accessible at www.ofiranlab.org / paratome / see Vered Kunik, et al, Nucleic Acids Research, Volume 40, Issue Wl, 1 Jul. 2012, Pages W521-W524).
[0056] As used herein, all numbering is determined by EU index numbering as in Kabat, unless otherwise indicated.
[0057] As used herein, the term “paratope” refers to a set of amino acid residues in an antibody or an antigen-binding fragment thereof that contribute to a binding interaction with an epitope of a target protein. The binding interaction can be a hydrogen bond, a salt bridge, a van der Waal interaction, an ionic bond or a combination thereof. A binding interaction may be direct, or indirect, e.g., via a coordinated intermediate molecule, such as an ion or water. The residues of a paratope, in some embodiments, comprise only residues that are part of a defined CDR. In other embodiments, the residues of a paratope further comprise one or more residues that are not part of a defined CDR.
[0058] As used herein, the term “antibody mimetic” refers to polypeptides capable of mimicking an antibody's ability to bind an antigen, but structurally differ from native antibody structures. Examples of antibody mimetics include, but not limited to, Adnectins, Affibodies, Affilins, Affimers, Affitins, Alphabodies, Anticalins, Avimers, DARPins, Fynomers, Kunitz domain peptides, monobodies, nanobodies, nanoCLAMPs, and Versabodies.
[0059] As used herein the term “KD,” also referred to as “binding constant,” “equilibrium dissociation constant” or “affinity constant,” is a measure of the extent of a reversible association between two molecular species (e.g., antibody and target protein) and includes both the actual binding affinity as well as the apparent binding affinity. Binding affinity can be determined using methods known in the art including, for example, by measurement of surface plasmon resonance, e.g., using a Biolayer interferometry (Octet, ForteBio) or a surface plasmon resonance (Biacore) system and assay. A reference that compares various surface technologies for measuring binding affinity and kinetics is Yang, D., Singh, A., Wu, H., & Kroe-Barrett, R., Comparison of biosensor platforms in the evaluation of high affinity antibody-antigen binding kinetics, Analytical Biochemistry 508: 78-96 (2016), the contents of which are incorporated by reference herein in their entirety.
[0060] The term “subject” or “patient” refers to an animal (e.g., a mammal such as a human), diagnosed with or suspected of having a TSLP-associated disease or condition (e.g., a disease or condition associated with dysregulated TSLP expression such as, asthma or atopic dermatitis (AD)), or one at risk of developing such conditions. Diagnosis may be performed by any method or technique known in the art. One skilled in the art will understand that a subject to be treated according to the present disclosure may have been subjected to standard tests or may have been identified, without examination, as one at risk due to the presence of one or more risk factors associated with the disease or condition.
[0061] The phrase “pharmaceutically acceptable” means that the substance or composition the phrase modifies is, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response, and the like, and are commensurate with a reasonable benefit / risk ratio.
[0062] As used herein, the term “pharmaceutically acceptable salt” refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of mammals without undue toxicity, irritation, allergic response, and the like, and are commensurate with a reasonable benefit / risk ratio. Pharmaceutically acceptable salts are well known. For example, S. M. Berge et al., describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19, the relevant teachings of which are incorporated herein by reference in their entirety. Pharmaceutically acceptable salts of the agents / compounds described herein include salts derived from suitable inorganic and organic acids, and suitable inorganic and organic bases.
[0063] Examples of salts derived from suitable acids include salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid, or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other known methods, such as ion exchange. Other pharmaceutically acceptable salts derived from suitable acids include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, cinnamate, citrate, cyclopentanepropionate, di gluconate, dodecyl sulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, glutarate, glycolate, hemisulfate, heptanoate, hexanoate, hydroiodide, hydroxybenzoate, 2-hydroxy-ethanesulfonate, hydroxymaleate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 2-phenoxybenzoate, phenyl acetate, 3 -phenylpropionate, phosphate, pivalate, propionate, pyruvate, salicylate, stearate, succinate, sulfate, tartrate, thiocyanate, p- toluenesulfonate, undecanoate, valerate salts, and the like.
[0064] Either the mono-, di- or tri-acid salts can be formed, and such salts can exist in either a hydrated, solvated or substantially anhydrous form.
[0065] Salts derived from appropriate bases include salts derived from inorganic bases, such as alkali metal, alkaline earth metal, and ammonium bases, and salts derived from aliphatic, alicyclic or aromatic organic amines, such as methylamine, trimethylamine and picoline, or N+((C1-C4)alkyl)4 salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, barium and the like. Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxyl, sulfate, phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate.
[0066] “Pharmaceutically acceptable carrier” refers to a non-toxic carrier or excipient that does not destroy the pharmacological activity of the agent with which it is formulated and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the agent. Pharmaceutically acceptable carriers that may be used in the compositions described herein include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassiumhydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
[0067] “Treating” or “treatment,” as used herein, refers to taking steps to deliver a therapy to a subject, such as a mammal, in need thereof (e.g., as by administering to a mammal one or more therapeutic agents). “Treating” or “treatment” includes inhibiting the disease or condition (e.g., as by slowing or stopping its progression or causing regression of the disease or condition) and relieving the symptoms resulting from the disease or condition.
[0068] The term “treating,” or “treatment” refers to the medical management of a subject with the intent to improve, ameliorate, stabilize (i.e., not worsen), prevent, or cure a disease, pathological condition, or disorder-such as the particular indications exemplified herein. This term includes active treatment (treatment directed to improve the disease, pathological condition, or disorder), causal treatment (treatment directed to the cause of the associated disease, pathological condition, or disorder), palliative treatment (treatment designed for the relief of symptoms), preventative treatment (treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder); and supportive treatment (treatment employed to supplement another therapy). Treatment also includes diminishment of the extent of the disease or condition; preventing spread of the disease or condition; delay or slowing the progress of the disease or condition; amelioration or palliation of the disease or condition; and remission (whether partial or total), whether detectable or undetectable. “Ameliorating” or “palliating” a disease or condition means that the extent and / or undesirable clinical manifestations of the disease, disorder, or condition are lessened and / or time course of the progression is slowed or lengthened, as compared to the extent or time course in the absence of treatment. “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder, as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
[0069] A “pharmaceutical composition” refers to a formulation of one or more therapeutic agents and a medium generally accepted for delivery of a biologically active agent to subjects, e.g., humans. In some embodiments, a pharmaceutical composition may include one or more pharmaceutically acceptable excipients, diluents, or carriers. In someembodiments, a pharmaceutical composition suitable for use in methods disclosed herein further comprises one or more pharmaceutically acceptable carriers.
[0070] “Pharmaceutically acceptable carrier, diluent, or excipient” includes any adjuvant, carrier, excipient, glidant, sweetening agent, diluent, preservative, dye / colorant, flavor enhancer, surfactant, wetting agent, dispersing agent, suspending agent, stabilizer, isotonic agent, solvent, or emulsifier which has been approved by the United States Food and Drug Administration as being acceptable for use in humans or domestic animals.
[0071] “Pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical composition, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative. In some embodiments, the carrier may be a diluent, adjuvant, excipient, or vehicle with which the agent (e.g., polynucleotide) is administered. Such vehicles may be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, and the like. For example, 0.4% saline and 0.3% glycine can be used. These solutions are sterile and generally free of particulate matter. They may be sterilized by conventional, well-known sterilization techniques (e.g., filtration). The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, stabilizing, thickening, lubricating, and coloring agents, etc. The concentration of the agent in such pharmaceutical formulation may vary widely, i.e., from less than about 0.5%, to at least about 1%, or to as much as 15% or 20%, 25%, 30%, 35%, 40%, 45% or 50% by weight. The concentration will be selected primarily based on required dose, fluid volumes, viscosities, etc., according to the mode of administration. Suitable vehicles and formulations, inclusive of other human proteins, e.g., human serum albumin, are described, for example, in Remington: The Science and Practice of Pharmacy, 21st Edition, Troy, D. B. ed., Lipincott Williams and Wilkins, Philadelphia, PA 2006, Part 5, Pharmaceutical Manufacturing: 691-1092 (e.g., pages 958-89).
[0072] Non-limiting examples of pharmaceutically acceptable carriers are solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible, such as salts, buffers, antioxidants, saccharides, aqueous or non-aqueous carriers, preservatives, wetting agents, surfactants or emulsifying agents, or combinations thereof.
[0073] Non-limiting examples of buffers are acetic acid, citric acid, formic acid, succinic acid, phosphoric acid, carbonic acid, malic acid, aspartic acid, histidine, boric acid, Tris buffers, HEPPSO, and HEPES.
[0074] Non-limiting examples of antioxidants are ascorbic acid, methionine, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite, lecithin, citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, and tartaric acid.
[0075] Non-limiting examples of amino acids are histidine, isoleucine, methionine, glycine, arginine, lysine, L-leucine, tri-leucine, alanine, glutamic acid, L-threonine, and 2- phenylamine.
[0076] Non-limiting examples of surfactants are polysorbates (e.g., polysorbate-20 or polysorbate-80); polyoxamers (e.g., poloxamer 188); Triton; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl-sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-betaine (e.g., lauroamidopropyl); myristamidopropyl-, palmidopropyl-, or isostearamidopropyl- dimethylamine; sodium methyl cocoyl-, or disodium methyl oleyl-taurate; and the MONAQUA™ series (Mona Industries, Inc., Paterson, N.J.), poly ethyl glycol, polypropyl glycol, and copolymers of ethylene and propylene glycol (e.g., PLURONICS™, PF68, etc.).
[0077] Non-limiting examples of preservatives are phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride, alkylparaben (methyl, ethyl, propyl, butyl, and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate, and thimerosal, or mixtures thereof.
[0078] Non-limiting examples of saccharides are monosaccharides, di saccharides, trisaccharides, polysaccharides, sugar alcohols, reducing sugars, nonreducing sugars such as glucose, sucrose, trehalose, lactose, fructose, maltose, dextran, glycerin, dextran, erythritol, glycerol, arabitol, sylitol, sorbitol, mannitol, mellibiose, melezitose, raffinose, mannotriose, stachyose, maltose, lactulose, maltulose, glucitol, maltitol, lactitol, or iso-maltulose.
[0079] Non-limiting examples of salts are acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous, and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenylsubstituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromaticsulfonic acids, and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium, and the like, as well as from nontoxic organic amines, such as N,N'-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine, and the like. In some embodiments, the salt is sodium chloride (NaCl).
[0080] Agents (e.g., polynucleotides) described herein may be prepared in accordance with standard procedures and are administered at dosages that are selected to reduce, prevent, or eliminate, or to slow or halt progression of, a condition being treated (see, e.g., Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, PA, and Goodman and Gilman's The Pharmaceutical Basis of Therapeutics, McGraw-Hill, New York, N. Y., the contents of which are incorporated herein by reference, for a general description of methods for administering various agents for human therapy).
[0081] “Administering” or “administration,” as used herein, refers to providing a compound, composition, or pharmaceutically acceptable salt thereof described herein to a subject in need of treatment or prevention. Administering can be performed, for example, once, a plurality of times, and / or over one or more extended periods. Administration includes both direct administration (including self-administration), and indirect administration (including an act of prescribing a drug or directing a subject to consume an agent). For example, as used herein, one (e.g., a physician) who instructs a subject (e.g., a human patient) to self-administer an agent (e.g., a drug), or to have an agent administered by another and / or who provides a patient with a prescription for a drug is administering an agent to a subject.
[0082] “A therapeutically effective amount,” “an effective amount” or “an effective dosage” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result (e.g., treatment, healing, inhibition or amelioration of physiological response or condition, etc.). A full therapeutic effect does not necessarily occur by administration of one dose and may occur only after administration of a series of doses. Thus, a therapeutically effective amount may be administered in one or more administrations. A therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of a mammal (e.g., a human patient), mode of administration, and the ability of a therapeutic or a combination of therapeutics to elicit a desired response.
[0083] Desired response or desired results include effects at the cellular level, tissue level, or clinical results. As such, “a therapeutically effective amount” or synonym thereto depends upon the context in which it is being applied. For example, in some embodiments itis an amount of the composition sufficient to achieve a treatment response as compared to the response obtained without administration of the composition. In other embodiments, it is an amount that results in a beneficial or desired result in a subject as compared to a control.IL Thymic Stromal Lymphopoietin (TSLP)
[0084] As used herein, TSLP includes wild-type TSLP proteins (e.g., wild-type human TSLP proteins or homologs thereof) and truncated forms thereof, mutant, and engineered versions of full-length and truncated TSLP proteins, and modified forms (e.g., post- translationally modified forms) of full-length and truncated TSLP proteins.
[0085] A non-limiting example of a human TSLP sequence is GenBank: AAK67490.1 (SEQ ID NO: 1).MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTK STEFNNTVSC SNRPHCLTEIQ SLTFNPT AGC ASLAKEMF AMKTKAAL AIWCPGYSET QINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ (SEQ ID NO:1)
[0086] A non-limiting example of a cynomolgus monkey TSLP sequence is GenBank: EHH54440.1 (SEQ ID NO:83).MKSLGQSKKEEVSFRKFFIFQLVGLVLTYDFTNCDFQKIEADYLRTISKDLITYMSGT KSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSET QINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ (SEQ ID NO:83)
[0087] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to a wild-type TSLP protein (e.g., a TSLP protein having an amino acid sequence of SEQ ID NO: 1, SEQ ID NO:83, or both). In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to a TSLP protein comprising the amino acid sequence of SEQ ID NO: 1. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to a TSLP protein comprising the amino acid sequence of SEQ ID NO: 1 and a TSLP protein comprising the amino acid sequence of SEQ ID NO: 83.
[0088] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to a mutant or engineered TSLP protein. In some embodiments, a mutant or engineered TSLP protein comprises an amino acid sequence that has at least about 90% sequence identity to a wildtype TSLP protein, for example, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.1 %, at least about99.2%, at least about 99.3%, at least about 99.4%, at least about 99.5%, at least about 99.6%, at least about 99.7%, at least about 99.8%, or at least about 99.9% sequence identity to a wildtype TSLP protein (e.g., SEQ ID NO: 1 or SEQ ID NO:83). In some embodiments, a mutant or engineered TSLP protein comprises an amino acid sequence that has about 90 to about 99.9%, about 90 to about 99.8%, about 92 to about 99.8%, about 92 to about 99.6%, about 94 to about 99.6%, about 94 to about 99.5%, about 95 to about 99.5%, about 95 to about 99.4%, about 96 to about 99.4%, about 96 to about 99.2%, about 97 to about 99.2% or about 97 to about 99% sequence identity to a wildtype TSLP protein.
[0089] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to a modified TSLP protein.
[0090] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, is capable of binding to one or more epitope residues in a TSLP protein (e.g., a full-length human TSLP), for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 epitope residues of a TSLP protein. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, is capable of binding to one or more epitope residues (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all 15 residues) selected from N64, N65, T66, V67, S68, C69, S70, N71, R72, H74, C75, E78, R150, F151 and R153 of SEQ ID NO: 1.
[0091] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to one or more epitope residues of a TSLP protein (e.g., one or more epitope residues in SEQ ID NO: 1). In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to one or more epitope residues (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all 15 residues) selected from N64, N65, T66, V67, S68, C69, S70, N71, R72, H74, C75, E78, R150, F151 and R153 of SEQ ID NO I .III. Exemplary anti-TSLP Antibodies
[0092] As used herein, the term "antibody" or “immunoglobulin” refers to a full-length antibody comprising two heavy chains (HCs) and two light chains (LCs) inter-connected by disulfide bonds or multimers thereof (for example, IgM). Each HC comprises a variable domain (VH), a heavy chain constant domain 1 (CHI), a heavy chain constant domain 2 (CH2), and a heavy chain constant domain 3 (CH3). Each LC comprises a variable domain (VL) and a light chain constant domain (CL). VH and VL domain may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs),interspersed within framework regions (FRs). Each VH and VL comprises three CDRs and four FRs, arranged from the amino-terminus to the carboxy -terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
[0093] In some embodiments, the present disclosure provides an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 comprising an amino acid sequence of SEQ ID NO:31, a HCDR2 comprising an amino acid sequence of SEQ ID NO:35, and a HCDR3 comprising an amino acid sequence of SEQ ID NO:50; and b) a LCDR1 comprising an amino acid sequence of SEQ ID NO:60, a LCDR2 comprising an amino acid sequence of DDS, and a LCDR3 comprising an amino acid sequence of SEQ ID NO:71.
[0094] In some embodiments, the present disclosure provides an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 consisting of an amino acid sequence of SEQ ID NO:31, a HCDR2 consisting of an amino acid sequence of SEQ ID NO:35, and a HCDR3 consisting of an amino acid sequence of SEQ ID NO:50; and b) a LCDR1 consisting of an amino acid sequence of SEQ ID NO:60, a LCDR2 consisting of an amino acid sequence of DDS, and a LCDR3 consisting of an amino acid sequence of SEQ ID NO:71.
[0095] In some embodiments, the present disclosure provides an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 comprising an amino acid sequence of SEQ ID NO: 130, a HCDR2 comprising an amino acid sequence of SEQ ID NO: 131, and a HCDR3 comprising an amino acid sequence of SEQ ID NO: 132, numbered according to Kabat; and b) a LCDR1 comprising an amino acid sequence of SEQ ID NO: 133 a LCDR2 comprising an amino acid sequence of SEQ ID NO: 134, and a LCDR3 comprising an amino acid sequence of SEQ ID NO:71, numbered according to Kabat.
[0096] In some embodiments, the present disclosure provides an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 consisting of an amino acid sequence of SEQ ID NO: 130, a HCDR2 consisting of an amino acid sequence of SEQ ID NO: 131, and a HCDR3consisting of an amino acid sequence of SEQ ID NO: 132, numbered according to Kabat; and b) a LCDR1 consisting of an amino acid sequence of SEQ ID NO: 133 a LCDR2 consisting of an amino acid sequence of SEQ ID NO: 134, and a LCDR3 consisting of an amino acid sequence of SEQ ID NO:71, numbered according to Kabat.
[0097] In some embodiments, the present disclosure provides an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 comprising an amino acid sequence of SEQ ID NO: 135, a HCDR2 comprising an amino acid sequence of SEQ ID NO: 136, and a HCDR3 comprising an amino acid sequence of SEQ ID NO: 132, numbered according to Chothia; and b) a LCDR1 comprising an amino acid sequence of SEQ ID NO: 133 a LCDR2 comprising an amino acid sequence of SEQ ID NO: 134, and a LCDR3 comprising an amino acid sequence of SEQ ID NO:71, numbered according to Chothia.
[0098] In some embodiments, the present disclosure provides an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 consisting of an amino acid sequence of SEQ ID NO: 135, a HCDR2 consisting of an amino acid sequence of SEQ ID NO: 136, and a HCDR3 consisting of an amino acid sequence of SEQ ID NO: 132, numbered according to Chothia; and b) a LCDR1 consisting of an amino acid sequence of SEQ ID NO: 133 a LCDR2 consisting of an amino acid sequence of SEQ ID NO: 134, and a LCDR3 consisting of an amino acid sequence of SEQ ID NO:71, numbered according to Chothia.
[0099] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, comprises: a) a VH that is humanized, contains human framework regions, or a combination thereof; and / or b) a VL that is humanized, contains human framework regions, or a combination thereof.
[0100] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof comprises: a) a VH comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:5; and b) a VL comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity SEQ ID NO:21.
[0101] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof comprises: a) a VH consisting of an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:5; and b) a VL consisting of an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:21.
[0102] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof comprises: a) a VH comprising an amino acid sequence of SEQ ID NO:5; and b) a VL comprising an amino acid sequence of SEQ ID NO:21.
[0103] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof comprises: a) a VH consisting of an amino acid sequence of SEQ ID NO:5; and b) a VL consisting of an amino acid sequence of SEQ ID NO:21.
[0104] In some embodiments, an antigen-binding fragment of the present disclosure comprises a single-chain fragment variable (scFv), a variable heavy domain of heavy chain (VHH), a fragment antigen binding (Fab ), a Fab', or a F(ab')2.
[0105] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, is a human antibody, humanized antibody, a chimeric antibody, amonoclonal antibody, a recombinant antibody, a single-chain antibody, a monomeric antibody, an IgGl antibody, an IgG2 antibody, an IgG3 antibody, an IgG4 antibody, a diabody, a triabody, a tetrabody, an scFv, a Fab fragment, a Fab', a F(ab')2, nanobody, or camelid antibody.
[0106] In some embodiments, an antibody of the present disclosure, or antigen-binding domain thereof, comprises: a) a CHI domain; and b) a CL domain.
[0107] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, comprises one or more constant domain from an IgG antibody. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, comprises one or more constant domain from an IgGl, IgG2, IgG3, or IgG4 antibody. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, comprises a CHI, CH2, and CH3 domain of an IgGl antibody. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, comprises a CHI, CH2, and CH3 domain of an IgG2 antibody. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, comprises a CHI, CH2, and CH3 domain of an IgG3 antibody. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, comprises a CHI, CH2, and CH3 domain of an IgG4 antibody.
[0108] In some embodiments, an antibody heavy chain constant domain comprises one or more mutations which increase serum half-life of the antibody, or antigen-binding fragment thereof, in humans. In some embodiments, an antibody of the present disclosure, or antigenbinding fragment thereof, comprises a CH2 domain incorporating one or more substitutions relative to a wild-type human IgG CH2 domain at positions 252, 254, and / or 256, numbered according to the EU index as in Kabat. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, comprises a CH2 domain incorporating one or more substitutions relative to a wild-type human IgG CH2 domain at position 252 to tyrosine, at position 254 to threonine, and / or at position 256 to glutamic acid, numbered according to the EU index as in Kabat. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, comprises a CH2 domain incorporating substitutions relative to a wild-type human IgG CH2 domain at positions 252, 254, and 256, numbered according to the EU index as in Kabat. In some embodiments, an antibody of thepresent disclosure, or antigen-binding fragment thereof, comprises a CH2 domain incorporating substitutions relative to a wild-type human IgG CH2 domain at position 252 to tyrosine, at position 254 to threonine, and at position 256 to glutamic acid, numbered according to the EU index as in Kabat.
[0109] In some embodiments, an antibody heavy chain constant domain comprises one or more substitutions which ablate Clq and FcyR binding. In some embodiments, an antibody heavy chain constant domain comprises one or more substitution at positions 234, 235, and / or 329, numbered according to the EU index as in Kabat. In some embodiments, an antibody heavy chain constant domain comprises substitutions at positions 234 and 235, numbered according to the EU index as in Kabat. In some embodiments, an antibody heavy chain constant domain comprises substitutions at positions 234, 235, and 329, numbered according to the EU index as in Kabat. In some embodiments, an antibody heavy chain constant domain comprises one or more substitution at residue Leu 234 to Ala, at residue Leu 235 to Ala, and / or at residue Pro 329 to Ala or Gly, numbered according to the EU index as in Kabat. In some embodiments, an antibody heavy chain constant domain comprises substitutions at residue Leu 234 to Ala and at residue Leu 235 to Ala, numbered according to the EU index as in Kabat. In some embodiments, an antibody heavy chain constant domain comprises substitutions at residue Leu 234 to Ala, at residue Leu 235 to Ala, and at residue Pro 329 to Ala or Gly, numbered according to the EU index as in Kabat.
[0110] In some embodiments, an antibody of the present disclosure comprises: a) a HC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to of SEQ ID NO: 92; and b) a LC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to sequence of SEQ ID NO: 120.
[0111] In some embodiments, an antibody of the present disclosure comprises: a) a HC comprising an amino acid sequence of SEQ ID NO: 92; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
[0112] In some embodiments, an antibody of the present disclosure comprises:a) a HC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to of SEQ ID NO: 106; and b) a LC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to sequence of SEQ ID NO: 120.
[0113] In some embodiments, an antibody of the present disclosure comprises: a) a HC comprising an amino acid sequence of SEQ ID NO: 106; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
[0114] In some embodiments, an antibody HC is translated in a cell with a signal sequence to target the HC for secretion. In some embodiments, a HC comprises an N- terminal signal sequence that is cleaved prior to secretion. In some embodiments, an antibody HC comprises an N-terminal signal sequence having an amino acid sequence at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 178. In some embodiments, an antibody HC comprising a signal sequence has an amino acid sequence at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 174. In some embodiments, an antibody HC comprising a signal sequence has an amino acid sequence at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 176.
[0115] In some embodiments, an antibody LC is translated in a cell with a signal sequence to target the LC for secretion. In some embodiments, a LC comprises an N-terminal signal sequence that is cleaved prior to secretion. In some embodiments, an antibody LC comprises an N-terminal signal sequence having an amino acid sequence at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 179. In some embodiments, an antibody LCcomprising a signal sequence has an amino acid sequence at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 175.TABLE 1: Exemplary anti-TSLP Antibody Sequences
[0116] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof: a) binds to TSLP with a KD of about 10 pM or less (e.g., as measured by KinExA); b) binds to the AB-loop region and C-terminal region of helix D of TSLPn; c) binds to an epitope in TSLP (e.g., in a full-length human TSLP); d) competes with a Reference Antibody (e.g., Tezepelumab) for binding to TSLP; e) reduces binding of TSLP protein to TSLPR; f) modulates (e.g., reduces, inhibits, neutralizes) against a TSLP -mediated biological activity; or g) a combination thereof.
[0117] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to TSLP (e.g., human or cynomolgus monkey TSLP) with a KD of 10 pM or less (e.g., as measured by KinExA).
[0118] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to TSLP with a KD of about 0.01 to about 10 pM, about 0.05 to about 10 pM, about 0.1 to about 10 pM, about 0.15 to about 10 pM, about 0.2 to about 10 pM, about 0.25 to about 10 pM, about 0.3 to about 10 pM, about 0.35 to about 10 pM, about 0.4 to about 10 pM, about 0.45 to about 10 pM, about 0.5 to about 10 pM, about 0.55 to about 10 pM, about 0.6 to about 10 pM, about 0.65 to about 10 pM, about 0.7 to about 10 pM, about 0.75 to about 10 pM, about 0.8 to about 10 pM, about 0.85 to about 10 pM, about 0.9 to about 10 pM, about 0.95 to about 10 pM, about 1 to about 10 pM, about 1.5 to about 10 pM, about 2 to about 10 pM, about 2.5 to about 10 pM, about 3 to about 10 pM, about 3.5 to about 10pM, about 4 to about 10 pM, about 4.5 to about 10 pM, about 5 to about 10 pM, about 5.5 to about 10 pM, about 6 to about 10 pM, about 6.5 to about 10 pM, about 7 to about 10 pM, about 7.5 to about 10 pM, about 8 to about 10 pM, about 8.5 to about 10 pM, about 9 to about 10 pM, about 0.01 to about 8 pM, about 0.05 to about 8 pM, about 0.1 to about 8 pM, about 0.15 to about 8 pM, about 0.2 to about 8 pM, about 0.25 to about 8 pM, about 0.3 to about 8 pM, about 0.35 to about 8 pM, about 0.4 to about 8 pM, about 0.45 to about 8 pM, about 0.5 to about 8 pM, about 0.55 to about 8 pM, about 0.6 to about 8 pM, about 0.65 to about 8 pM, about 0.7 to about 8 pM, about 0.75 to about 8 pM, about 0.8 to about 8 pM, about 0.85 to about 8 pM, about 0.9 to about 8 pM, about 0.95 to about 8 pM, about 1 to about 8 pM, about1.5 to about 8 pM, about 2 to about 8 pM, about 2.5 to about 8 pM, about 3 to about 8 pM, about 3.5 to about 8 pM, about 4 to about 8 pM, about 4.5 to about 8 pM, about 5 to about 8 pM, about 5.5 to about 8 pM, about 6 to about 8 pM, about 6.5 to about 8 pM, about 7 to about 8 pM, about 7.5 to about 8 pM, about 0.01 to about 6 pM, about 0.05 to about 6 pM, about 0.1 to about 6 pM, about 0.15 to about 6 pM, about 0.2 to about 6 pM, about 0.25 to about 6 pM, about 0.3 to about 6 pM, about 0.35 to about 6 pM, about 0.4 to about 6 pM, about 0.45 to about 6 pM, about 0.5 to about 6 pM, about 0.55 to about 6 pM, about 0.6 to about 6 pM, about 0.65 to about 6 pM, about 0.7 to about 6 pM, about 0.75 to about 6 pM, about 0.8 to about 6 pM, about 0.85 to about 6 pM, about 0.9 to about 6 pM, about 0.95 to about 6 pM, about 1 to about 6 pM, about 1.5 to about 6 pM, about 2 to about 6 pM, about2.5 to about 6 pM, about 3 to about 6 pM, about 3.5 to about 6 pM, about 4 to about 6 pM, about 4.5 to about 6 pM, about 5 to about 6 pM, about 5.5 to about 6 pM, about 0.01 to about 4 pM, about 0.05 to about 4 pM, about 0.1 to about 4 pM, about 0.15 to about 4 pM, about 0.2 to about 4 pM, about 0.25 to about 4 pM, about 0.3 to about 4 pM, about 0.35 to about 4 pM, about 0.4 to about 4 pM, about 0.45 to about 4 pM, about 0.5 to about 4 pM, about 0.55 to about 4 pM, about 0.6 to about 4 pM, about 0.65 to about 4 pM, about 0.7 to about 4 pM, about 0.75 to about 4 pM, about 0.8 to about 4 pM, about 0.85 to about 4 pM, about 0.9 to about 4 pM, about 0.95 to about 4 pM, about 1 to about 4 pM, about 1.5 to about 4 pM, about 2 to about 4 pM, about 2.5 to about 4 pM, about 3 to about 4 pM, about 3.5 to about 4 pM, about 0.01 to about 2 pM, about 0.05 to about 2 pM, about 0.1 to about 2 pM, about 0.15 to about 2 pM, about 0.2 to about 2 pM, about 0.25 to about 2 pM, about 0.3 to about 2 pM, about 0.35 to about 2 pM, about 0.4 to about 2 pM, about 0.45 to about 2 pM, about 0.5 to about 2 pM, about 0.55 to about 2 pM, about 0.6 to about 2 pM, about 0.65 to about 2 pM, about 0.7 to about 2 pM, about 0.75 to about 2 pM, about 0.8 to about 2 pM, about 0.85 toabout 2 pM, about 0.9 to about 2 pM, about 0.95 to about 2 pM, about 1 to about 2 pM, about 1.5 to about 2 pM, about 0.01 to about 1 pM, about 0.05 to about 1 pM, about 0.1 to about 1 pM, about 0.15 to about 1 pM, about 0.2 to about 1 pM, about 0.25 to about 1 pM, about 0.3 to about 1 pM, about 0.35 to about 1 pM, about 0.4 to about 1 pM, about 0.45 to about 1 pM, about 0.5 to about 1 pM, about 0.55 to about 1 pM, about 0.6 to about 1 pM, about 0.65 to about 1 pM, about 0.7 to about 1 pM, about 0.75 to about 1 pM, about 0.8 to about 1 pM, about 0.85 to about 1 pM, about 0.9 to about 1 pM, about 0.95 to about 1 pM, about 0.01 to about 0.8 pM, about 0.05 to about 0.8 pM, about 0.1 to about 0.8 pM, about 0.15 to about 0.8 pM, about 0.2 to about 0.8 pM, about 0.25 to about 0.8 pM, about 0.3 to about 0.8 pM, about 0.35 to about 0.8 pM, about 0.4 to about 0.8 pM, about 0.45 to about 0.8 pM, about 0.5 to about 0.8 pM, about 0.55 to about 0.8 pM, about 0.6 to about 0.8 pM, about 0.65 to about 0.8 pM, about 0.7 to about 0.8 pM, about 0.75 to about 0.8 pM, about 0.01 to about 0.6 pM, about 0.05 to about 0.6 pM, about 0.1 to about 0.6 pM, about 0.15 to about 0.6 pM, about 0.2 to about 0.6 pM, about 0.25 to about 0.6 pM, about 0.3 to about 0.6 pM, about 0.35 to about 0.6 pM, about 0.4 to about 0.6 pM, about 0.45 to about 0.6 pM, about 0.5 to about 0.6 pM, about 0.55 to about 0.6 pM, about 0.01 to about 0.4 pM, about 0.05 to about 0.4 pM, about 0.1 to about 0.4 pM, about 0.15 to about 0.4 pM, about 0.2 to about 0.4 pM, about 0.25 to about 0.4 pM, about 0.3 to about 0.4 pM, about 0.35 to about 0.4 pM, about 0.01 to about 0.2 pM, about 0.05 to about 0.2 pM, about 0.1 to about 0.2 pM, about 0.15 to about 0.2 pM, or about 0.05 to about 0.1 pM. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to TSLP with a KD of about 0.01 pM, about 0.02 pM, about 0.03 pM, about 0.04 pM, about 0.05 pM, about 0.06 pM, about 0.07 pM, about 0.08 pM, about 0.09 pM, about 0.1 pM, about 0.11 pM, about 0.12 pM, about 0.13 pM, about 0.14 pM, about 0.15 pM, about 0.2 pM, about 0.3 pM, about 0.4 pM, about 0.5 pM, about 0.6 pM, about 0.7 pM, about 0.8 pM, about 0.9 pM, about 1 pM, about 2.5 pM, about 5 pM, about 7.5 pM, or about 10 pM.
[0119] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds (e.g., has a binding affinity for, has a binding specificity for) an AB- loop region and a C-terminal region of helix D of TSLP.
[0120] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, is characterized as having neutralizing activity against TSLP (e.g., a full- length human TSLP). In some embodiments, an antibody of the present disclosure, orantigen-binding fragment thereof, is characterized as having inhibitory activity against TSLP- mediated signaling.
[0121] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, binds to an epitope in a TSLP protein (e.g., in a full-length human TSLP).
[0122] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, competes with a Reference Antibody (e.g., Tezepelumab) for binding to TSLP. Techniques and assays for assessing competition between antibodies are known.
[0123] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces binding of TSLP to its cognate receptor, TSLPR (alone or in a heterodimeric complex with IL-7Ra). In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces binding of TSLP to TSLPR with an ICso of about 0.1 pM to about 500 pM, about 0.2 pM to about 500 pM, about 0.3 pM to about 500 pM, about 0.4 pM to about 500 pM, about 0.5 pM to about 500 pM, about 0.6 pM to about 500 pM, about 0.7 pM to about 500 pM, about 0.8 pM to about 500 pM, about 0.9 pM to about 500 pM, about 1 pM to about 500 pM, about 5 pM to about 500 pM, about 10 pM to about 500 pM, about 50 pM to about 500 pM, about 100 pM to about 500 pM, about 200 pM to about 500 pM, about 300 pM to about 500 pM, about 400 to about 500 pM, about 0.1 pM to about 300 pM, about 0.2 pM to about 300 pM, about 0.3 pM to about 300 pM, about 0.4 pM to about 300 pM, about 0.5 pM to about 300 pM, about 0.6 pM to about 300 pM, about 0.7 pM to about 300 pM, about 0.8 pM to about 300 pM, about 0.9 pM to about 300 pM, about 1 pM to about 300 pM, about 5 pM to about 300 pM, about 10 pM to about 300 pM, about 50 pM to about 300 pM, about 100 pM to about 300 pM, about 200 pM to about 300 pM, about 0.1 pM to about 100 pM, about 0.2 pM to about 100 pM, about 0.3 pM to about 100 pM, about 0.4 pM to about 100 pM, about 0.5 pM to about 100 pM, about 0.6 pM to about 100 pM, about 0.7 pM to about 100 pM, about 0.8 pM to about 100 pM, about 0.9 pM to about 100 pM, about 1 pM to about 100 pM, about 5 pM to about 100 pM, about 10 pM to about 100 pM, about 50 pM to about 100 pM, about 0.1 pM to about 10 pM, about 0.2 pM to about 10 pM, about 0.3 pM to about 10 pM, about 0.4 pM to about 10 pM, about 0.5 pM to about 10 pM, about 0.6 pM to about 10 pM, about 0.7 pM to about 10 pM, about 0.8 pM to about 10 pM, about 0.9 pM to about 10 pM, about 1 pM to about 10 pM, about 5 pM to about 10 pM, about 0.1 pM to about 1 pM, about 0.2 pM to about 1 pM, about 0.3 pM to about 1 pM, about 0.4 pM to about 1 pM, about 0.5 pM to about 1 pM, about 0.6 pM to about 1 pM, about 0.7 pM to about 1 pM, about 0.8 pM to about 1 pM, about 0.9 pM to about 1 pM, about0.1 pM to about 0.5 pM, about 0.2 pM to about 0.5 pM, about 0.3 pM to about 0.5 pM, or about 0.4 pM to about 0.5 pM. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces binding of TSLP to TSLPR with an ICso of about 0.1 pM, about 0.5 pM, about 1 pM, about 5 pM, about 10 pM, about 50 pM, about 100 pM, or about 500 pM or less.
[0124] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces binding of TSLP to TSLPR by about 10% to about 100%, about 15% to about 100%, about 20% to about 100%, about 25% to about 100%, about 30% to about 100%, about 35% to about 100%, about 40% to about 100%, about 45% to about 100%, about 50% to about 100%, about 55% to about 100%, about 60% to about 100%, about 65% to about 100%, about 70% to about 100%, about 75% to about 100%, about 80% to about 100%, about 85% to about 100%, about 90% to about 100%, about 95% to about 100%, about 10% to about 90%, about 15% to about 90%, about 20% to about 90%, about 25% to about 90%, about 30% to about 90%, about 35% to about 90%, about 40% to about 90%, about 45% to about 90%, about 50% to about 90%, about 55% to about 90%, about 60% to about 90%, about 65% to about 90%, about 70% to about 90%, about 75% to about 90%, about 80% to about 90%, about 85% to about 90%, about 10% to about 80%, about 15% to about 80%, about 20% to about 80%, about 25% to about 80%, about 30% to about 80%, about 35% to about 80%, about 40% to about 80%, about 45% to about 80%, about 50% to about 80%, about 55% to about 80%, about 60% to about 80%, about 65% to about 80%, about 70% to about 80%, about 75% to about 80%, about 10% to about 60%, about 15% to about 60%, about 20% to about 60%, about 25% to about 60%, about 30% to about 60%, about 35% to about 60%, about 40% to about 60%, about 45% to about 60%, about 50% to about 60%, about 55% to about 60%, about 10% to about 40%, about 15% to about 40%, about 20% to about 40%, about 25% to about 40%, about 30% to about 40%, about 35% to about 40%, about 10% to about 20%, or about 15% to about 20%. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces binding of TSLP to TSLPR by at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99%.
[0125] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, modulates (e.g., reduces, inhibits, neutralizes) a TSLP-mediated biological activity. Non-limiting examples of TSLP-mediated biological activities include: TSLPR- binding; TSLP -induced signal transducer and activator of transcription 5 (STAT5) signaling; TSLP -induced STAT3 signaling; TSLP-induced nuclear factor kappa-light-chain-enhancer of activated B cells (NFKB) signaling; TSLP-induced phosphoinositide-3 -kinase (PI3K) signaling; TSLP-induced mitogen-activated protein kinase (MAPK) signaling; activation of one or more genes encoding IL-4, IL-5, IL-9, IL-13, CCL17 and mitogen-activated protein kinase kinase 2 (MEK2); and dendritic cell activation. In some embodiments, a TSLP- mediated biological activity comprises one or more innate immune mechanisms of action and / or one or more adaptive immune mechanisms of action.
[0126] TSLP-mediated biological activities can be determined, for example, by measuring STAT5 reporter activity, dendritic cell activation, proliferation of cells expressing TSLPR, and CCL17 production (see, e.g., Verstraete etal., Structure and antagonism of the receptor complex mediated by human TSLP in allergy and asthma, Nat Commun. 8: 1493 7 (2017), the contents of which are incorporated herein by reference).
[0127] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, neutralizes a biological activity mediated by TSLP. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, neutralizes a TSLP-mediated biological activity with an ICso of about 0.1 pM to about 500 pM, about 0.2 pM to about 500 pM, about 0.3 pM to about 500 pM, about 0.4 pM to about 500 pM, about 0.5 pM to about 500 pM, about 0.6 pM to about 500 pM, about 0.7 pM to about 500 pM, about 0.8 pM to about 500 pM, about 0.9 pM to about 500 pM, about 1 pM to about 500 pM, about 5 pM to about 500 pM, about 10 pM to about 500 pM, about 50 pM to about 500 pM, about 100 pM to about 500 pM, about 200 pM to about 500 pM, about 300 pM to about 500 pM, about 400 to about 500 pM, about 0.1 pM to about 300 pM, about 0.2 pM to about 300 pM, about 0.3 pM to about 300 pM, about 0.4 pM to about 300 pM, about 0.5 pM to about 300 pM, about 0.6 pM to about 300 pM, about 0.7 pM to about 300 pM, about 0.8 pM to about 300 pM, about 0.9 pM to about 300 pM, about 1 pM to about 300 pM, about 5 pM to about 300 pM, about 10 pM to about 300 pM, about 50 pM to about 300 pM, about 100 pM to about 300 pM, about 200 pM to about 300 pM, about 0.1 pM to about 100 pM, about 0.2 pM to about 100 pM, about 0.3 pM to about 100 pM, about 0.4 pM to about 100 pM, about 0.5 pM to about 100 pM, about 0.6 pM to about 100 pM, about 0.7 pM to about 100 pM,about 0.8 pM to about 100 pM, about 0.9 pM to about 100 pM, about 1 pM to about 100 pM, about 5 pM to about 100 pM, about 10 pM to about 100 pM, about 50 pM to about 100 pM, about 0.1 pM to about 10 pM, about 0.2 pM to about 10 pM, about 0.3 pM to about 10 pM, about 0.4 pM to about 10 pM, about 0.5 pM to about 10 pM, about 0.6 pM to about 10 pM, about 0.7 pM to about 10 pM, about 0.8 pM to about 10 pM, about 0.9 pM to about 10 pM, about 1 pM to about 10 pM, about 5 pM to about 10 pM, about 0.1 pM to about 1 pM, about0.2 pM to about 1 pM, about 0.3 pM to about 1 pM, about 0.4 pM to about 1 pM, about 0.5 pM to about 1 pM, about 0.6 pM to about 1 pM, about 0.7 pM to about 1 pM, about 0.8 pM to about 1 pM, about 0.9 pM to about 1 pM, about 0.1 pM to about 0.5 pM, about 0.2 pM to about 0.5 pM, about 0.3 pM to about 0.5 pM, or about 0.4 pM to about 0.5 pM. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, neutralizes a TSLP -mediated biological activity with an ICso of about 0.1 pM, about 0.5 pM, about 1 pM, about 5 pM, about 10 pM, about 50 pM, about 100 pM, or about 500 pM or less.
[0128] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces a TSLP-mediated biological activity by about 10% to about 100%, about 15% to about 100%, about 20% to about 100%, about 25% to about 100%, about 30% to about 100%, about 35% to about 100%, about 40% to about 100%, about 45% to about 100%, about 50% to about 100%, about 55% to about 100%, about 60% to about 100%, about 65% to about 100%, about 70% to about 100%, about 75% to about 100%, about 80% to about 100%, about 85% to about 100%, about 90% to about 100%, about 95% to about 100%, about 10% to about 90%, about 15% to about 90%, about 20% to about 90%, about 25% to about 90%, about 30% to about 90%, about 35% to about 90%, about 40% to about 90%, about 45% to about 90%, about 50% to about 90%, about 55% to about 90%, about 60% to about 90%, about 65% to about 90%, about 70% to about 90%, about 75% to about 90%, about 80% to about 90%, about 85% to about 90%, about 10% to about 80%, about 15% to about 80%, about 20% to about 80%, about 25% to about 80%, about 30% to about 80%, about 35% to about 80%, about 40% to about 80%, about 45% to about 80%, about 50% to about 80%, about 55% to about 80%, about 60% to about 80%, about 65% to about 80%, about 70% to about 80%, about 75% to about 80%, about 10% to about 60%, about 15% to about 60%, about 20% to about 60%, about 25% to about 60%, about 30% to about 60%, about 35% to about 60%, about 40% to about 60%, about 45% to about 60%, about 50% to about 60%, about 55% to about 60%, about 10% to about 40%, about 15% to about 40%, about 20% to about 40%, about 25% to about 40%, about 30% to about 40%, about35% to about 40%, about 10% to about 20%, or about 15% to about 20%. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces a TSLP -mediated biological activity by at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99%.
[0129] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces one or more T2 innate immune responses induced by TSLP. Nonlimiting examples of T2 innate immune responses include: activation of innate lymphoid cells; activation, migration and / or local differentiation of eosinophil progenitor cells (EoPs) (e.g., via upregulation of ICAM-1 and / or CD18, and / or via suppression of L-selectin surface expression); increase of eosinophil viability (e.g., via production of IL-6, eosinophil-derived neurotoxin, and chemokines (including C-X-C Motif Chemokine Ligand 8 (CXCL8), CXCL1 and chemokine (C-C motif) ligand 2 (CCL2)); basophil differentiation; production of T2 cytokines by mast cells; production of chemokine CXCL8 and / or CC1 by mast cells; and macrophage differentiation (e.g., via enhancing CD80 activation marker expression).
[0130] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces one or more T2 innate immune response induced by TSLP by at least about 10% to about 100%, about 15% to about 100%, about 20% to about 100%, about 25% to about 100%, about 30% to about 100%, about 35% to about 100%, about 40% to about 100%, about 45% to about 100%, about 50% to about 100%, about 55% to about 100%, about 60% to about 100%, about 65% to about 100%, about 70% to about 100%, about 75% to about 100%, about 80% to about 100%, about 85% to about 100%, about 90% to about 100%, about 95% to about 100%, about 10% to about 90%, about 15% to about 90%, about 20% to about 90%, about 25% to about 90%, about 30% to about 90%, about 35% to about 90%, about 40% to about 90%, about 45% to about 90%, about 50% to about 90%, about 55% to about 90%, about 60% to about 90%, about 65% to about 90%, about 70% to about 90%, about 75% to about 90%, about 80% to about 90%, about 85% to about 90%, about 10% to about 80%, about 15% to about 80%, about 20% to about 80%, about 25% to about 80%, about 30% to about 80%, about 35% to about 80%, about 40% to about 80%, about 45% to about 80%, about 50% to about 80%, about 55% to about 80%, about60% to about 80%, about 65% to about 80%, about 70% to about 80%, about 75% to about 80%, about 10% to about 60%, about 15% to about 60%, about 20% to about 60%, about 25% to about 60%, about 30% to about 60%, about 35% to about 60%, about 40% to about 60%, about 45% to about 60%, about 50% to about 60%, about 55% to about 60%, about 10% to about 40%, about 15% to about 40%, about 20% to about 40%, about 25% to about 40%, about 30% to about 40%, about 35% to about 40%, about 10% to about 20%, or about 15% to about 20%. In some embodiments, an antibody of the present disclosure, or antigenbinding fragment thereof, reduces one or more T2 innate immune response induced by TSLP by at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99%.
[0131] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces one or more T2 adaptive immune responses induced by TSLP. Non-limiting examples of T2 adaptive immune responses include: increased expression of major histocompatibility complex (MHC) class II in dendritic cells; increased expression of one or more co-stimulatory molecules (e.g., CD40, CD86, CD54, CD90, CD83 and / or CD- LAMP) in dendritic cells; increased expression of one or more chemokines (e.g., CXCL8, CCL24, CCL17, CCL22 and CCL1) in dendritic cells; increased expression of 0X40 ligand (OX40L); naive T-cell differentiation and / or polarization (e.g., differentiation of naive CD4+T cells into TNFa+IL-10' T helper (TH) 2 cells); proliferation and / or differentiation of naive CD4+T cells into TH 2 cells or memory T cells; and increased expansion of CD8+T cells upon T cell receptor (TCR) stimulation.
[0132] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, reduces one or more T2 adaptive immune response induced by TSLP by at least about 10% to about 100%, about 15% to about 100%, about 20% to about 100%, about 25% to about 100%, about 30% to about 100%, about 35% to about 100%, about 40% to about 100%, about 45% to about 100%, about 50% to about 100%, about 55% to about 100%, about 60% to about 100%, about 65% to about 100%, about 70% to about 100%, about 75% to about 100%, about 80% to about 100%, about 85% to about 100%, about 90% to about 100%, about 95% to about 100%, about 10% to about 90%, about 15% to about90%, about 20% to about 90%, about 25% to about 90%, about 30% to about 90%, about 35% to about 90%, about 40% to about 90%, about 45% to about 90%, about 50% to about 90%, about 55% to about 90%, about 60% to about 90%, about 65% to about 90%, about 70% to about 90%, about 75% to about 90%, about 80% to about 90%, about 85% to about 90%, about 10% to about 80%, about 15% to about 80%, about 20% to about 80%, about 25% to about 80%, about 30% to about 80%, about 35% to about 80%, about 40% to about 80%, about 45% to about 80%, about 50% to about 80%, about 55% to about 80%, about 60% to about 80%, about 65% to about 80%, about 70% to about 80%, about 75% to about 80%, about 10% to about 60%, about 15% to about 60%, about 20% to about 60%, about 25% to about 60%, about 30% to about 60%, about 35% to about 60%, about 40% to about 60%, about 45% to about 60%, about 50% to about 60%, about 55% to about 60%, about 10% to about 40%, about 15% to about 40%, about 20% to about 40%, about 25% to about 40%, about 30% to about 40%, about 35% to about 40%, about 10% to about 20%, or about 15% to about 20%. In some embodiments, an antibody of the present disclosure, or antigenbinding fragment thereof, reduces one or more T2 adaptive immune response induced by TSLP by at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99%.
[0133] Antibodies and antigen-binding fragments thereof disclosed herein, e.g., AB-2b, are believed to have one or more beneficial properties or effects selected from: a half life of about 89 days in humans, sustained drug concentration (e.g., in vivo) for a period of about six months, target saturation (e.g., leading to a reduction in total TSLP, total IL-13, total IL-5, or a combination thereof), a reduction in eosinophils, a reduction in FeNO, good tolerability, low elicitation of anti-drug antibody (ADA) response, and no impact of ADA response on its pharmacokinetic (PK) profile.IV. Reference Antibody
[0134] As used herein, the term "reference" or "reference antibody" refers to an antibody (e.g., immunoglobulin molecule) that specifically binds to a TSLP protein (e.g., a polypeptidecomprising an amino acid sequence of SEQ ID NO: 1) and is used as a comparison for an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof.
[0135] In some embodiments, a reference antibody may be used as a comparator to characterize one or more structural differences of an anti-TSLP antibody disclosed herein, or an antigen-binding fragment thereof.
[0136] In some embodiments, a reference antibody may be used as a comparator to characterize one of more pharmacokinetic property of an anti-TSLP antibody disclosed herein, or an antigen-binding fragment thereof. In some embodiments, a reference antibody may be used as a comparator to characterize a dissociation constant (KD) of an anti-TSLP antibody disclosed herein, or an antigen-binding fragment thereof. In some embodiments, a reference antibody may be used as a comparator to characterize a dissociation constant (KD) of an anti-TSLP antibody disclosed herein, or an antigen-binding fragment thereof.
[0137] In some embodiments, a reference antibody may be used as a comparator to characterize an effective concentration of an anti-TSLP antibody disclosed herein, or antigenbinding fragment thereof, needed to detectably bind a TSLP polypeptide. For example, in some embodiments, a reference antibody may be used as a comparator to characterize a half- maximal effective concentration (ECso) needed for an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, to bind a TSLP polypeptide. In some embodiments, a reference antibody may be used as a comparator to characterize an 80%-maximal effective concentration (ECso) needed for an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, to bind a TSLP polypeptide. In some embodiments, a reference antibody may be used as a comparator to characterize a 90%-maximal effective concentration (EC90) needed for an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, to bind a TSLP polypeptide.
[0138] In some embodiments, a reference antibody may be used as a comparator to characterize the efficacy of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, in achieving a particular biological outcome in an in vitro assay. In some embodiments, a reference antibody may be used as a comparator to characterize the efficacy of an anti-TSLP antibody disclosed herein, to inhibit the activity of TSLP in an in vitro reporter assay. For example, in some embodiments, a reference antibody may be used as a comparator to characterize the half-maximal concentration (e.g., IC50) of an antibody disclosed herein, or antigen-binding fragment thereof, needed to inhibit TSLP activation of a Baf / 3-STAT5 luciferase assay.
[0139] In some embodiments, a reference antibody may be used as a comparator to characterize the efficacy of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, in achieving a particular biological outcome in an in vitro cell-based assay. In some embodiments, a reference antibody may be used as a comparator to characterize the efficacy of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, to inhibit the TSLP-activated release of one or more cytokine and / or chemokine. In some embodiments, a reference antibody may be used as a comparator to characterize the half- maximal concentration (e.g., IC50) of an antibody disclosed herein, or antigen-binding fragment thereof, needed to inhibit TSLP-activated release of one or more cytokine and / or chemokine from peripheral blood mononuclear cells (PBMCs). In some embodiments, a reference antibody may be used as a comparator to characterize the half-maximal concentration (e.g., IC50) of an antibody disclosed herein, or antigen-binding fragment thereof, needed to inhibit TSLP-activated release of one or more cytokine and / or chemokine from myeloid dendritic cells (DCs). In some embodiments, a reference antibody may be used as a comparator to characterize the half-maximal concentration (e.g., IC50) of an antibody disclosed herein, or antigen-binding fragment thereof, needed to inhibit TSLP-activated release of Thymus and Activation-Regulated Chemokine (TARC) / CCL17 from PBMCs and / or myeloid DCs.
[0140] In some embodiments, a reference antibody may be used as a comparator to characterize the efficacy of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, in achieving a particular biological outcome in an in vivo model of a chronic inflammatory lung disease. In some embodiments, a reference antibody may be used as a comparator to characterize the efficacy of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, in achieving a particular biological outcome in an in vivo model of allergic asthma. In some embodiments, a reference antibody may be used as a comparator to characterize the efficacy of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, at inhibiting: total serum levels of IgE, serum levels of antigen-specific IgE (e.g., ovalbumin (OVA-specific IgE)), or a combination thereof, in a murine model of allergic asthma. In some embodiments, a reference antibody may be used as a comparator to characterize the efficacy of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, at inhibiting: eosinophil infiltration, the concentration of one or more chemokines (e.g., CCL17), total levels of IgE, levels of antigen-specific IgE (e.g., ovalbumin (OVA-specific IgE)), or a combination thereof, in bronchoalveolar lavagefluid in a murine model of allergic asthma. In some embodiments, a reference antibody may be used as a comparator to characterize the efficacy of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof, at inhibiting: inflammatory cell infiltration, eosinophil infiltration, mucus production, or a combination thereof, in lung histological samples in a murine model of allergic asthma.
[0141] In some embodiments, a reference antibody may be used as a comparator to characterize the plasma half-life of an anti-TSLP antibody disclosed herein, or antigenbinding fragment thereof. In some embodiments, a reference antibody may be used as a comparator to characterize the plasma half-life of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof when administered (e.g., intravenously, subcutaneously, intraperitoneally, intranasally) to a subject (e.g., human, non-human primate (e.g., cynomolgus monkey)). In some embodiments, a reference antibody may be used as a comparator to characterize the pharmacokinetic and / or physiologically-based pharmacokinetic profile of an anti-TSLP antibody disclosed herein, or antigen-binding fragment thereof in an in silico prediction model.
[0142] In some embodiments, a reference antibody comprises: a) a heavy chain complementarity determining region 1 (HCDR1), a heavy chain complementarity determining region 2 (HCDR2), and a heavy chain complementarity determining region 3 (HCDR3) sequence of SEQ ID NO:31, SEQ ID NO:33 and SEQ ID NO:48, respectively; and / or b) a light chain complementarity determining region 1 (LCDR1), a light chain complementarity determining region 2 (LCDR2), and a light chain complementarity determining region 3 (LCDR3) sequence of SEQ ID NO: 59, DDS, and SEQ ID NO:69, respectively.
[0143] In some embodiments, a reference antibody comprises: a) a HCDR1, a HCDR2, and a HCDR3 sequence of SEQ ID NO:31, SEQ ID NO:33, and SEQ ID NO:48, respectively; and b) a LCDR1, a LCDR2, and a LCDR3 sequence of SEQ ID NO:59, DDS, and SEQ ID NO:69, respectively.
[0144] In some embodiments, a reference antibody comprises: a) an immunoglobulin heavy chain variable domain (VH) comprising the amino acid sequence of SEQ ID NO:3; and / orb) an immunoglobulin light chain variable domain (VL) comprising the amino acid sequence of SEQ ID NO: 19.
[0145] In some embodiments, a reference antibody comprises: a) an immunoglobulin heavy chain variable domain (VH) comprising the amino acid sequence of SEQ ID NO:3; and b) an immunoglobulin light chain variable domain (VL) comprising the amino acid sequence of SEQ ID NO: 19.
[0146] In some embodiments, a reference antibody comprises: a) an immunoglobulin heavy chain (HC) comprising the amino acid sequence of SEQ ID NO:81; and b) an immunoglobulin light chain (LC) comprising the amino acid sequence of SEQ ID NO:82.
[0147] In some embodiments, a reference antibody comprises or consists of Tezepelumab.TABLE 2: Reference anti-TSLP Antibody SequencesV. Nucleic Acids, Vectors, Host Cells
[0148] In some embodiments, the present disclosure provides one or more polynucleotides (e.g., DNA, RNA, or analogs thereof) encoding any antibody disclosed herein, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, is encoded by a single polynucleotide. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, is encoded by two or more polynucleotides.
[0149] In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, is encoded by one or more linear polynucleotides. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, is encoded by one or more circular polynucleotides. In some embodiments, an antibody of the present disclosure, or antigen-binding fragment thereof, is encoded by one or more circular RNAs (circRNAs). In some embodiments, a circRNA comprises one or more ribozyme sequences. In some embodiments, a ribozyme sequence is activated for autocleavage in a host cell, thereby resulting in linearization of a circRNA.
[0150] In some embodiments, one or more polynucleotides (e.g., DNA, RNA, or analogs thereof) encoding an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof, incorporates one or more modified nucleotide. In some embodiments, a modified nucleotide results from a chemical modification of a nucleobase, backbone, or combination thereof. In some embodiments, a chemically modified polynucleotide (e.g., RNA, mRNA) comprises one or more anti-reverse cap analogs (ARCA): m27.3'-OGP3G, GP3G (Unmethylated Cap Analog), m7GP3G (Monomethylated Cap Analog), m32.2.7GP3G (Trimethylated Cap Analog), m5CTP (5'-methyl-cytidinetriphosphate), m6ATP (N6-methyl-adenosine-5 '-triphosphate), s2UTP (2 -thio-uridine triphosphate), and Y (pseudouridine triphosphate).
[0151] In some embodiments, one or more polynucleotides (e.g., DNA, RNA, or analogs thereof) encoding an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof, incorporates one or more nucleosides selected from dihydrouridine, inosine, 7-m ethylguanosine, 5-methylcytidine (5mC), 5' Phosphate ribothymidine, 2'-O-methyl ribothymidine, 2'-O-ethyl ribothymidine, 2'-fluoro ribothymidine, C-5 propynyl-deoxycytidine (pdC), C-5 propynyl-deoxyuridine (pdU), C-5 propynyl-cytidine (pC), C-5 propynyl-uridine (pU), 5-methyl cytidine, 5-methyl uridine, 5- methyl deoxy cytidine, 5-methyl deoxyuridine methoxy, 2,6-diaminopurine, 5'- Dimethoxytrityl-N4-ethyl-2'-deoxycytidine, C-5 propynyl-f-cytidine (pfC), C-5 propynyl-f- uridine (pfU), 5-methyl f-cytidine, 5-methyl f-uridine, C-5 propynyl-m-cytidine (pmC), C-5 propynyl-f-uridine (pmU), 5-methyl m-cytidine, 5-methyl m-uridine, LNA (locked nucleic acid), MGB (minor groove binder) pseudouridine ( ), 1-N-methylpseudouridine (l-Me-'P), and 5-methoxyuridine (5-MO-U). In some embodiments, a polynucleotide of the present disclosure comprises one or more locked nucleotides.
[0152] In some embodiments, one or more polynucleotides encoding an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof, comprises a sequence that is codon optimized for human expression. In some embodiments, codon optimization may be performed such that codons for which frequently occurring tRNAs are available are inserted in place of “rare codons.” In some embodiments, codon-optimization may include increasing guanosine / cytosine (G / C) content of a coding region of a polyribonucleotide described herein as compared to the G / C content of the corresponding coding sequence of a wild-type or reference polyribonucleotide. In some embodiments, codon-optimization may include increasing guanosine / cytosine (G / C) content of a coding region of a polyribonucleotide described herein as compared to the G / C content of the corresponding coding sequence of a wild-type or reference polyribonucleotide, wherein the amino acid sequence encoded by the polyribonucleotide is not modified compared to the amino acid sequence. In some embodiments, a coding sequence is codon optimized for expression in a particular cell or tissue.
[0153] In some embodiments, the present disclosure provides a vector (e.g., an expression vector, including a viral-delivery vector) comprising one or more polynucleotidesencoding an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof.
[0154] As used herein, the term “expression vector” refers to a replicable nucleic acid from which one or more polypeptides can be expressed when the expression vector is transformed into a suitable expression host cell.
[0155] Various expression vectors can be employed to express a polynucleotide encoding an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof. Both viral -based and nonviral expression vectors can be used to produce antibodies in a mammalian host cell. Non-viral vectors and systems include plasmids, episomal vectors, typically with an expression cassette for expressing a protein or RNA, and human artificial chromosomes. In some embodiments, nonviral vectors useful for expression of an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof in mammalian (e.g., human) cells include pThioHis A, B & C, pcDNA3.1 / His, pEBVHis A, B & C, MPSV vectors, and numerous other known vectors for protein expression. In some embodiments, viral vectors include vectors based on retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, vectors based on SV40, papilloma virus, HBP Epstein Barr virus, vaccinia virus vectors and Semliki Forest virus (SFV).
[0156] In some embodiments, a vector (e.g., expression vector) further comprises an expression control polynucleotide sequence operably linked to one or more polynucleotides encoding an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof. In some embodiments, an expression control polynucleotide sequence comprises a promoter sequence, an enhancer sequence, a transcription terminator, or combination thereof. In some embodiments, an expression control polynucleotide sequence comprises an inducible promoter sequence. As used herein, the term “promoter” refers to a region of DNA to which RNA polymerase binds and initiates the transcription of a gene. As used herein, the term “operably linked” refers to a nucleic acid positioned in a recombinant polynucleotide (e.g., vector) in such a way that enables expression of a nucleic acid (e.g., a polynucleotide encoding an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof) under control of the element e.g., promoter) to which it is linked.
[0157] In some embodiments, a vector (e.g., expression vector) disclosed herein further comprises a polynucleotide sequence encoding a selectable marker. As used herein, the term“selectable marker” refers to an element that confers a trait suitable for artificial selection of a transformed or transduced cell. In some embodiments, selectable markers can be negative or positive selection markers.
[0158] Expression vectors can include expression control sequences, such as an origin of replication, a promoter, and an enhancer, and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences. These expression vectors usually contain promoters derived from genes from host cells (e.g., mammalian cells), or viral genes from viruses that target said host cells. Suitable promoters may be constitutive, cell type-specific, stage-specific, and / or modulatable or regulatable. Useful promoters include, but are not limited to, the metallothionein promoter, the constitutive adenovirus major late promoter, the dexamethasone-inducible MMTV promoter, the SV40 promoter, the MRP poIIII promoter, the constitutive MPSV promoter, the tetracycline-inducible CMV promoter (such as the human immediate-early CMV promoter), the constitutive CMV promoter, and known promoter-enhancer combinations.
[0159] In some embodiments, the present disclosure provides host cells for harboring and expressing polynucleotides encoding an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof. In some embodiments, a host cell can be prokaryotic or eukaryotic. For example, in some embodiments, E. coli is a prokaryotic host cell used for cloning and expressing the one or more polynucleotides encoding an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof. In some embodiments, other prokaryotic host cells are suitable for use including bacilli, such as Bacillus subtilis, and other enterobacteriaceae, such as Salmonella, Serratia, and various Pseudomonas species. In some embodiments, prokaryotic host cells can be used to propagate expression vectors, which typically contain expression control sequences compatible with a host cell (e.g., an origin of replication). In addition, any number of a variety of well-known promoters can be used, such as the lactose promoter system, a tryptophan (trp) promoter system, a beta-lactamase promoter system, or a promoter system from phage lambda. The promoters typically control expression, optionally with an operator sequence, and have ribosome binding site sequences for initiating and completing transcription and translation. In some embodiments, other cells, such as yeast (e.g., Pichia pastoris cells) and insect cells, can be used as host cells.
[0160] In some embodiments, mammalian cells are used as host cells to express and produce an antibody of the present disclosure, antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof. In some embodiments, a mammalian host cell can be either a hybridoma cell line expressing endogenous immunoglobulin genes or a mammalian cell line harboring an exogenous expression vector. Various suitable mammalian host cell lines have been developed that are capable of secreting intact immunoglobulins. In some embodiments, mammalian host cells used for expressing an antibody of the present disclosure, or antigen-binding fragment thereof, or polypeptide chain (e.g., HC or LC) thereof, includes Chinese hamster ovary (CHO) cells, COS cells, human embryonic kidney (HEK), HeLa cells, myeloma cell lines, transformed B-cells, and hybridomas.VI. Compositions
[0161] In some embodiments, the present disclosure provides a composition comprising an antibody disclosed herein, or antigen-binding fragment thereof. In some embodiments, a composition is a pharmaceutical composition.
[0162] In some embodiments, a composition (e.g., a pharmaceutical composition) further comprises one or more pharmaceutically acceptable carriers, excipients, stabilizers, diluents or tonifiers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)). Suitable pharmaceutically acceptable carriers, excipients, or stabilizers are non-toxic to recipients at the dosages and concentrations employed. Non-limiting examples of pharmaceutically acceptable carriers, excipients, stabilizers, diluents or tonifiers include: buffers (e.g., phosphate, citrate, histidine); antioxidants (e.g., ascorbic acid or methionine); preservatives; proteins (e.g., serum albumin, gelatin); hydrophilic polymers; amino acids; carbohydrates (e.g., monosaccharides, disaccharides, glucose, mannose or dextrins); chelating agents (e.g., EDTA); sugars (e.g., sucrose, mannitol, trehalose or sorbitol); salt-forming counter-ions (e.g., sodium); metal complexes (e.g., Zn-protein complexes); non-ionic surfactants (e.g., Tween), PLURONICS™; and polyethylene glycol (PEG).
[0163] In some embodiments, a composition (e.g., a pharmaceutical composition) is formulated for a suitable administration schedule and route. In some embodiments, a composition (e.g., a pharmaceutical composition) is formulated for parenteral administration. Non-limiting examples of administration routes include subcutaneous, intravenous, intraperitoneal, oral, rectal, intranasal, mucosal, intramuscular, etc. In some embodiments, acomposition (e.g., a pharmaceutical composition) is stored as an aqueous solution or as a dried formulation (e.g., lyophilized).
[0164] In some embodiments, a composition disclosed herein is formulated for subcutaneous administration. In some embodiments, a composition disclosed herein is formulated intravenous administration.
[0165] In some embodiments, a composition (e.g., a pharmaceutical composition) disclosed herein is provided in a dosage form, e.g., in a prefilled syringe or autoinjector.
[0166] In some embodiments, a composition (e.g., a pharmaceutical composition) comprises from about 10 mg to 1500 mg of an antibody of the present disclosure, or antigenbinding fragment thereof. In some embodiments, a composition (e.g., a pharmaceutical composition) comprises from about 10 mg to about 1500 mg, about 20 mg to about 1500 mg, about 30 mg to about 1500 mg, about 40 mg to about 1500 mg, about 50 mg to about 1500 mg, about 60 mg to about 1500 mg, about 70 mg to about 1500 mg, about 80 mg to about 1500 mg, about 90 mg to about 1500 mg, about 100 mg to about 1500 mg, about 150 mg to about 1500 mg, about 200 mg to about 1500 mg, about 250 mg to about 1500 mg, about 300 mg to about 1500 mg, about 350 mg to about 1500 mg, about 400 mg to about 1500 mg, about 450 mg to about 1500 mg, about 500 mg to about 1500 mg, about 550 mg to about 1500 mg, about 600 mg to about 1500 mg, about 650 mg to about 1500 mg, about 700 mg to about 1500 mg, about 750 mg to about 1500 mg, about 800 mg to about 1500 mg, about 850 mg to about 1500 mg, about 900 mg to about 1500 mg, about 950 mg to about 1500 mg, about 1000 mg to about 1500 mg, about 1050 mg to about 1500 mg, about 1100 mg to about 1500 mg, about 1150 mg to about 1500 mg, about 1200 mg to about 1500 mg, about 1250 mg to about 1500 mg, about 1300 mg to about 1500 mg, about 1350 mg to about 1500 mg, about 1400 mg to about 1500 mg, about 1450 mg to about 1500 mg, about 10 mg to about 1400 mg, about 20 mg to about 1400 mg, about 30 mg to about 1400 mg, about 40 mg to about 1400 mg, about 50 mg to about 1400 mg, about 60 mg to about 1400 mg, about 70 mg to about 1400 mg, about 80 mg to about 1400 mg, about 90 mg to about 1400 mg, about 100 mg to about 1400 mg, about 150 mg to about 1400 mg, about 200 mg to about 1400 mg, about 250 mg to about 1400 mg, about 300 mg to about 1400 mg, about 350 mg to about 1400 mg, about 400 mg to about 1400 mg, about 450 mg to about 1400 mg, about 500 mg to about 1400 mg, about 550 mg to about 1400 mg, about 600 mg to about 1400 mg, about 650 mg to about 1400 mg, about 700 mg to about 1400 mg, about 750 mg to about 1400 mg, about 800 mg to about 1400 mg, about 850 mg to about 1400 mg, about 900 mg to about 1400 mg,about 950 mg to about 1400 mg, about 1000 mg to about 1400 mg, about 1050 mg to about 1400 mg, about 1100 mg to about 1400 mg, about 1150 mg to about 1400 mg, about 1200 mg to about 1400 mg, about 1250 mg to about 1400 mg, about 1300 mg to about 1400 mg, about 1350 mg to about 1400 mg, about 10 mg to about 1300 mg, 20 mg to about 1300 mg, 30 mg to about 1300 mg, 40 mg to about 1300 mg, 50 mg to about 1300 mg, about 60 mg to about 1300 mg, about 70 mg to about 1300 mg, about 80 mg to about 1300 mg, about 90 mg to about 1300 mg, about 100 mg to about 1300 mg, about 150 mg to about 1300 mg, about 200 mg to about 1300 mg, about 250 mg to about 1300 mg, about 300 mg to about 1300 mg, about 350 mg to about 1300 mg, about 400 mg to about 1300 mg, about 450 mg to about 1300 mg, about 500 mg to about 1300 mg, about 550 mg to about 1300 mg, about 600 mg to about 1300 mg, about 650 mg to about 1300 mg, about 700 mg to about 1300 mg, about 750 mg to about 1300 mg, about 800 mg to about 1300 mg, about 850 mg to about 1300 mg, about 900 mg to about 1300 mg, about 950 mg to about 1300 mg, about 1000 mg to about 1300 mg, about 1050 mg to about 1300 mg, about 1100 mg to about 1300 mg, about 1150 mg to about 1300 mg, about 1200 mg to about 1300 mg, about 1250 mg to about 1300 mg, about 10 mg to about 1200 mg, 20 mg to about 1200 mg, 30 mg to about 1200 mg, 40 mg to about 1200 mg, 50 mg to about 1200 mg, about 60 mg to about 1200 mg, about 70 mg to about 1200 mg, about 80 mg to about 1200 mg, about 90 mg to about 1200 mg, about 100 mg to about 1200 mg, about 150 mg to about 1200 mg, about 200 mg to about 1200 mg, about 250 mg to about 1200 mg, about 300 mg to about 1200 mg, about 350 mg to about 1200 mg, about 400 mg to about 1200 mg, about 450 mg to about 1200 mg, about 500 mg to about 1200 mg, about 550 mg to about 1200 mg, about 600 mg to about 1200 mg, about 650 mg to about 1200 mg, about 700 mg to about 1200 mg, about 750 mg to about 1200 mg, about 800 mg to about 1200 mg, about 850 mg to about 1200 mg, about 900 mg to about 1200 mg, about 950 mg to about 1200 mg, about 1000 mg to about 1200 mg, about 1050 mg to about 1200 mg, about 1100 mg to about 1200 mg, about 1150 mg to about 1200 mg, about 10 mg to about 1100 mg, 20 mg to about 1100 mg, 30 mg to about 1100 mg, 40 mg to about 1100 mg, 50 mg to about 1100 mg, about 60 mg to about 1100 mg, about 70 mg to about 1100 mg, about 80 mg to about 1100 mg, about 90 mg to about 1100 mg, about 100 mg to about 1100 mg, about 150 mg to about 1100 mg, about 200 mg to about 1100 mg, about 250 mg to about 1100 mg, about 300 mg to about 1100 mg, about 350 mg to about 1100 mg, about 400 mg to about 1100 mg, about 450 mg to about 1100 mg, about 500 mg to about 1100 mg, about 550 mg to about 1100 mg, about 600 mg to about 1100 mg, about 650 mg to about 1100 mg,about 700 mg to about 1100 mg, about 750 mg to about 1100 mg, about 800 mg to about 1100 mg, about 850 mg to about 1100 mg, about 900 mg to about 1100 mg, about 950 mg to about 1100 mg, about 1000 mg to about 1100 mg, about 1050 mg to about 1100 mg, about 10 mg to about 1000 mg, about 20 mg to about 1000 mg, about 30 mg to about 1000 mg, about 40 mg to about 1000 mg, about 50 mg to about 1000 mg, about 60 mg to about 1000 mg, about 70 mg to about 1000 mg, about 80 mg to about 1000 mg, about 90 mg to about 1000 mg, about 100 mg to about 1000 mg, about 150 mg to about 1000 mg, about 200 mg to about 1000 mg, about 250 mg to about 1000 mg, about 300 mg to about 1000 mg, about 350 mg to about 1000 mg, about 400 mg to about 1000 mg, about 450 mg to about 1000 mg, about 500 mg to about 1000 mg, about 550 mg to about 1000 mg, about 600 mg to about 1000 mg, about 650 mg to about 1000 mg, about 700 mg to about 1000 mg, about 750 mg to about 1000 mg, about 800 mg to about 1000 mg, about 850 mg to about 1000 mg, about 900 mg to about 1000 mg, about 950 mg to about 1000 mg, about 10 mg to about 900 mg, about 20 mg to about 900 mg, about 30 mg to about 900 mg, about 40 mg to about 900 mg, about 50 mg to about 900 mg, about 60 mg to about 900 mg, about 70 mg to about 900 mg, about 80 mg to about 900 mg, about 90 mg to about 900 mg, about 100 mg to about 900 mg, about 150 mg to about 900 mg, about 200 mg to about 900 mg, about 250 mg to about 900 mg, about 300 mg to about 900 mg, about 350 mg to about 900 mg, about 400 mg to about 900 mg, about 450 mg to about 900 mg, about 500 mg to about 900 mg, about 550 mg to about 900 mg, about 600 mg to about 900 mg, about 650 mg to about 900 mg, about 700 mg to about 900 mg, about 750 mg to about 900 mg, about 800 mg to about 900 mg, about 850 mg to about 900 mg, about 10 mg to about 800 mg, about 20 mg to about 800 mg, about 30 mg to about800 mg, about 40 mg to about 800 mg, about 50 mg to about 800 mg, about 60 mg to about800 mg, about 70 mg to about 800 mg, about 80 mg to about 800 mg, about 90 mg to about800 mg, about 100 mg to about 800 mg, about 150 mg to about 800 mg, about 200 mg to about 800 mg, about 250 mg to about 800 mg, about 300 mg to about 800 mg, about 350 mg to about 800 mg, about 400 mg to about 800 mg, about 450 mg to about 800 mg, about 500 mg to about 800 mg, about 550 mg to about 800 mg, about 600 mg to about 800 mg, about 650 mg to about 800 mg, about 700 mg to about 800 mg, about 750 mg to about 800 mg, about 10 mg to about 700 mg, about 20 mg to about 700 mg, about 30 mg to about 700 mg, about 40 mg to about 700 mg, about 50 mg to about 700 mg, about 60 mg to about 700 mg, about 70 mg to about 700 mg, about 80 mg to about 700 mg, about 90 mg to about 700 mg, about 100 mg to about 700 mg, about 150 mg to about 700 mg, about 200 mg to about 700mg, about 250 mg to about 700 mg, about 300 mg to about 700 mg, about 350 mg to about 700 mg, about 400 mg to about 700 mg, about 450 mg to about 700 mg, about 500 mg to about 700 mg, about 550 mg to about 700 mg, about 600 mg to about 700 mg, about 650 mg to about 700 mg, about 10 mg to about 600 mg, about 20 mg to about 600 mg, about 30 mg to about 600 mg, about 40 mg to about 600 mg, about 50 mg to about 600 mg, about 60 mg to about 600 mg, about 70 mg to about 600 mg, about 80 mg to about 600 mg, about 90 mg to about 600 mg, about 100 mg to about 600 mg, about 150 mg to about 600 mg, about 200 mg to about 600 mg, about 250 mg to about 600 mg, about 300 mg to about 600 mg, about 350 mg to about 600 mg, about 400 mg to about 600 mg, about 450 mg to about 600 mg, about 500 mg to about 600 mg, about 550 mg to about 600 mg, about 10 mg to about 500 mg, about 20 mg to about 500 mg, about 30 mg to about 500 mg, about 40 mg to about 500 mg, about 50 mg to about 500 mg, about 60 mg to about 500 mg, about 70 mg to about 500 mg, about 80 mg to about 500 mg, about 90 mg to about 500 mg, about 100 mg to about 500 mg, about 150 mg to about 500 mg, about 200 mg to about 500 mg, about 250 mg to about 500 mg, about 300 mg to about 500 mg, about 350 mg to about 500 mg, about 400 mg to about 500 mg, about 450 mg to about 500 mg, about 10 mg to about 400 mg, about 20 mg to about 400 mg, about 30 mg to about 400 mg, about 40 mg to about 400 mg, about 50 mg to about 400 mg, about 60 mg to about 400 mg, about 70 mg to about 400 mg, about 80 mg to about 400 mg, about 90 mg to about 400 mg, about 100 mg to about 400 mg, about 150 mg to about 400 mg, about 200 mg to about 400 mg, about 250 mg to about 400 mg, about 300 mg to about 400 mg, about 350 mg to about 400 mg, about 10 mg to about 300 mg, about 20 mg to about 300 mg, about 30 mg to about 300 mg, about 40 mg to about 300 mg, about 50 mg to about 300 mg, about 60 mg to about 300 mg, about 70 mg to about 300 mg, about 80 mg to about 300 mg, about 90 mg to about 300 mg, about 100 mg to about 300 mg, about 150 mg to about 300 mg, about 200 mg to about 300 mg, about 250 mg to about 300 mg, about 10 mg to about 200 mg, about 20 mg to about 200 mg, about 30 mg to about 200 mg, about 40 mg to about 200 mg, about 50 mg to about 200 mg, about 60 mg to about 200 mg, about 70 mg to about 200 mg, about 80 mg to about 200 mg, about 90 mg to about 200 mg, about 100 mg to about 200 mg, about 150 mg to about 200 mg, about 10 mg to about 100 mg, about 20 mg to about 100 mg, about 30 mg to about 100 mg, about 40 mg to about 100 mg, about 50 mg to about 100 mg, about 60 mg to about 100 mg, about 70 mg to about 100 mg, about 80 mg to about 100 mg, about 90 mg to about 100 mg, about 10 mg to about 80 mg, about 20 mg to about 80 mg, about 30 mg to about 80 mg, about 40 mg to about 80 mg, about 50 mg to about80 mg, about 60 mg to about 80 mg, about 70 mg to about 80 mg, about 10 mg to about 60 mg, about 20 mg to about 60 mg, about 30 mg to about 60 mg, about 40 mg to about 60 mg, about 50 mg to about 60 mg, about 10 mg to about 40 mg, about 20 mg to about 40 mg, about 30 mg to about 40 mg, or about 10 mg to about 20 mg of an antibody of the present disclosure, or antigen-binding fragment thereof.
[0167] In some embodiments, a composition (e.g., a pharmaceutical composition) comprises about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about 130 mg, about 140 mg, about 150 mg, about 160 mg, about 170 mg, about 180 mg, about 190 mg, about 200 mg, about 210 mg, about 220 mg, about 230 mg, about 250 mg, about 260 mg, about 270 mg, about 280 mg, about 290 mg, about 300 mg, about 310 mg, about 320 mg, about 330 mg, about 340 mg, about 350 mg, about 360 mg, about 370 mg, about 380 mg, about 390 mg, about 400 mg, about 410 mg, about 420 mg, about 430 mg, about 440 mg, about 450 mg, about 460 mg, about 470 mg, about 480 mg, about 490 mg, about 500 mg, about 510 mg, about 520 mg, about 530 mg, about 540 mg, about 550 mg, about 560 mg, about 570 mg, about 580 mg, about 590 mg, about 600 mg, about 610 mg, about 620 mg, about 630 mg, about 640 mg, about 650 mg, about 660 mg, about 670 mg, about 680 mg, about 690 mg, about 700 mg, about 710 mg, about 720 mg, about 730 mg, about 740 mg, about 750 mg, about 760 mg, about 770 mg, about 780 mg, about 790 mg, about 800 mg, about 810 mg, about 820 mg, about 830 mg, about 840 mg, about 850 mg, about 860 mg, about 870 mg, about 880 mg, about 890 mg, about 900 mg, about 910 mg, about 920 mg, about 930 mg, about 940 mg, about 950 mg, about 960 mg, about 970 mg, about 980 mg, about 990 mg, about 1000 mg, about 1025 mg, about 1050 mg, about 1075 mg, about 1100 mg, about 1125 mg, about 1150 mg, about 1175 mg, about 1200 mg, about 1225 mg, about 1250 mg, about 1275 mg, about 1300 mg, about 1325 mg, about 1350 mg, about 1375 mg, about 1400 mg, about 1425 mg, about 1450 mg, about 1475 mg, or about 1500 mg of an antibody of the present disclosure, or antigen-binding fragment thereof.
[0168] In some embodiments, a composition (e.g., a pharmaceutical composition) comprises about 10 mg of an antibody of the present disclosure, or antigen-binding fragment thereof. In some embodiments, a composition (e.g., a pharmaceutical composition) comprises about 30 mg of an antibody of the present disclosure, or antigen-binding fragment thereof. In some embodiments, a composition (e.g., a pharmaceutical composition) comprises about 100 mg of an antibody of the present disclosure, or antigen-binding fragment thereof. In someembodiments, a composition (e.g., a pharmaceutical composition) comprises about 300 mg of an antibody of the present disclosure, or antigen-binding fragment thereof. In some embodiments, a composition (e.g., a pharmaceutical composition) comprises about 600 mg of an antibody of the present disclosure, or antigen-binding fragment thereof. In some embodiments, a composition (e.g., a pharmaceutical composition) comprises about 1200 mg of an antibody of the present disclosure, or antigen-binding fragment thereof.
[0169] In some embodiments, a composition (e.g., a pharmaceutical composition) comprises from about 10 mg / mL to about 1500 mg / mL of an antibody of the present disclosure, or antigen-binding fragment thereof. In some embodiments, a composition (e.g., a pharmaceutical composition) comprises from about 10 mg / mL to about 1500 mg / mL, about 20 mg / mL to about 1500 mg / mL, about 30 mg / mL to about 1500 mg / mL, about 40 mg / mL to about 1500 mg / mL, about 50 mg / mL to about 1500 mg / mL, about 60 mg / mL to about 1500 mg / mL, about 70 mg / mL to about 1500 mg / mL, about 80 mg / mL to about 1500 mg / mL, about 90 mg / mL to about 1500 mg / mL, about 100 mg / mL to about 1500 mg / mL, about 150 mg / mL to about 1500 mg / mL, about 200 mg / mL to about 1500 mg / mL, about 250 mg / mL to about 1500 mg / mL, about 300 mg / mL to about 1500 mg / mL, about 350 mg / mL to about 1500 mg / mL, about 400 mg / mL to about 1500 mg / mL, about 450 mg / mL to about 1500 mg / mL, about 500 mg / mL to about 1500 mg / mL, about 550 mg / mL to about 1500 mg / mL, about 600 mg / mL to about 1500 mg / mL, about 650 mg / mL to about 1500 mg / mL, about 700 mg / mL to about 1500 mg / mL, about 750 mg / mL to about 1500 mg / mL, about 800 mg / mL to about 1500 mg / mL, about 850 mg / mL to about 1500 mg / mL, about 900 mg / mL to about 1500 mg / mL, about 950 mg / mL to about 1500 mg / mL, about 1000 mg / mL to about 1500 mg / mL, about 1050 mg / mL to about 1500 mg / mL, about 1100 mg / mL to about 1500 mg / mL, about 1150 mg / mL to about 1500 mg / mL, about 1200 mg / mL to about 1500 mg / mL, about 1250 mg / mL to about 1500 mg / mL, about 1300 mg / mL to about 1500 mg / mL, about 1350 mg / mL to about 1500 mg / mL, about 1400 mg / mL to about 1500 mg / mL, about 1450 mg / mL to about 1500 mg / mL, about 10 mg / mL to about 1400 mg / mL, about 20 mg / mL to about 1400 mg / mL, about 30 mg / mL to about 1400 mg / mL, about 40 mg / mL to about 1400 mg / mL, about 50 mg / mL to about 1400 mg / mL, about 60 mg / mL to about 1400 mg / mL, about 70 mg / mL to about 1400 mg / mL, about 80 mg / mL to about 1400 mg / mL, about 90 mg / mL to about 1400 mg / mL, about 100 mg / mL to about 1400 mg / mL, about 150 mg / mL to about 1400 mg / mL, about 200 mg / mL to about 1400 mg / mL, about 250 mg / mL to about 1400 mg / mL, about 300 mg / mL to about 1400 mg / mL, about 350 mg / mL to about 1400mg / mL, about 400 mg / mL to about 1400 mg / mL, about 450 mg / mL to about 1400 mg / mL, about 500 mg / mL to about 1400 mg / mL, about 550 mg / mL to about 1400 mg / mL, about 600 mg / mL to about 1400 mg / mL, about 650 mg / mL to about 1400 mg / mL, about 700 mg / mL to about 1400 mg / mL, about 750 mg / mL to about 1400 mg / mL, about 800 mg / mL to about 1400 mg / mL, about 850 mg / mL to about 1400 mg / mL, about 900 mg / mL to about 1400 mg / mL, about 950 mg / mL to about 1400 mg / mL, about 1000 mg / mL to about 1400 mg / mL, about 1050 mg / mL to about 1400 mg / mL, about 1100 mg / mL to about 1400 mg / mL, about 1150 mg / mL to about 1400 mg / mL, about 1200 mg / mL to about 1400 mg / mL, about 1250 mg / mL to about 1400 mg / mL, about 1300 mg / mL to about 1400 mg / mL, about 1350 mg / mL to about 1400 mg / mL, about 10 mg / mL to about 1300 mg / mL, about 20 mg / mL to about 1300 mg / mL, about 30 mg / mL to about 1300 mg / mL, about 40 mg / mL to about 1300 mg / mL, about 50 mg / mL to about 1300 mg / mL, about 60 mg / mL to about 1300 mg / mL, about 70 mg / mL to about 1300 mg / mL, about 80 mg / mL to about 1300 mg / mL, about 90 mg / mL to about 1300 mg / mL, about 100 mg / mL to about 1300 mg / mL, about 150 mg / mL to about 1300 mg / mL, about 200 mg / mL to about 1300 mg / mL, about 250 mg / mL to about 1300 mg / mL, about 300 mg / mL to about 1300 mg / mL, about 350 mg / mL to about 1300 mg / mL, about 400 mg / mL to about 1300 mg / mL, about 450 mg / mL to about 1300 mg / mL, about 500 mg / mL to about 1300 mg / mL, about 550 mg / mL to about 1300 mg / mL, about 600 mg / mL to about 1300 mg / mL, about 650 mg / mL to about 1300 mg / mL, about 700 mg / mL to about 1300 mg / mL, about 750 mg / mL to about 1300 mg / mL, about 800 mg / mL to about 1300 mg / mL, about 850 mg / mL to about 1300 mg / mL, about 900 mg / mL to about 1300 mg / mL, about 950 mg / mL to about 1300 mg / mL, about 1000 mg / mL to about 1300 mg / mL, about 1050 mg / mL to about 1300 mg / mL, about 1100 mg / mL to about 1300 mg / mL, about 1150 mg / mL to about 1300 mg / mL, about 1200 mg / mL to about 1300 mg / mL, about 1250 mg / mL to about 1300 mg / mL, about 10 mg / mL to about 1200 mg / mL, about 20 mg / mL to about 1200 mg / mL, about 30 mg / mL to about 1200 mg / mL, about 40 mg / mL to about 1200 mg / mL, about 50 mg / mL to about 1200 mg / mL, about 60 mg / mL to about 1200 mg / mL, about 70 mg / mL to about 1200 mg / mL, about 80 mg / mL to about 1200 mg / mL, about 90 mg / mL to about 1200 mg / mL, about 100 mg / mL to about 1200 mg / mL, about 150 mg / mL to about 1200 mg / mL, about 200 mg / mL to about 1200 mg / mL, about 250 mg / mL to about 1200 mg / mL, about 300 mg / mL to about 1200 mg / mL, about 350 mg / mL to about 1200 mg / mL, about 400 mg / mL to about 1200 mg / mL, about 450 mg / mL to about 1200 mg / mL, about 500 mg / mL to about 1200 mg / mL, about 550 mg / mL to about 1200 mg / mL, about 600mg / mL to about 1200 mg / mL, about 650 mg / mL to about 1200 mg / mL, about 700 mg / mL to about 1200 mg / mL, about 750 mg / mL to about 1200 mg / mL, about 800 mg / mL to about 1200 mg / mL, about 850 mg / mL to about 1200 mg / mL, about 900 mg / mL to about 1200 mg / mL, about 950 mg / mL to about 1200 mg / mL, about 1000 mg / mL to about 1200 mg / mL, about 1050 mg / mL to about 1200 mg / mL, about 1100 mg / mL to about 1200 mg / mL, about 1150 mg / mL to about 1200 mg / mL, about 10 mg / mL to about 1100 mg / mL, about 20 mg / mL to about 1100 mg / mL, about 30 mg / mL to about 1100 mg / mL, about 40 mg / mL to about 1100 mg / mL, about 50 mg / mL to about 1100 mg / mL, about 60 mg / mL to about 1100 mg / mL, about 70 mg / mL to about 1100 mg / mL, about 80 mg / mL to about 1100 mg / mL, about 90 mg / mL to about 1100 mg / mL, about 100 mg / mL to about 1100 mg / mL, about 150 mg / mL to about 1100 mg / mL, about 200 mg / mL to about 1100 mg / mL, about 250 mg / mL to about 1100 mg / mL, about 300 mg / mL to about 1100 mg / mL, about 350 mg / mL to about 1100 mg / mL, about 400 mg / mL to about 1100 mg / mL, about 450 mg / mL to about 1100 mg / mL, about 500 mg / mL to about 1100 mg / mL, about 550 mg / mL to about 1100 mg / mL, about 600 mg / mL to about 1100 mg / mL, about 650 mg / mL to about 1100 mg / mL, about 700 mg / mL to about 1100 mg / mL, about 750 mg / mL to about 1100 mg / mL, about 800 mg / mL to about 1100 mg / mL, about 850 mg / mL to about 1100 mg / mL, about 900 mg / mL to about 1100 mg / mL, about 950 mg / mL to about 1100 mg / mL, about 1000 mg / mL to about 1100 mg / mL, about 1050 mg / mL to about 1100 mg / mL, about 10 mg / mL to about 1000 mg / mL, about 20 mg / mL to about 1000 mg / mL, about 30 mg / mL to about 1000 mg / mL, about 40 mg / mL to about 1000 mg / mL, about 50 mg / mL to about 1000 mg / mL, about 60 mg / mL to about 1000 mg / mL, about 70 mg / mL to about 1000 mg / mL, about 80 mg / mL to about 1000 mg / mL, about 90 mg / mL to about 1000 mg / mL, about 100 mg / mL to about 1000 mg / mL, about 150 mg / mL to about 1000 mg / mL, about 200 mg / mL to about 1000 mg / mL, about 250 mg / mL to about 1000 mg / mL, about 300 mg / mL to about 1000 mg / mL, about 350 mg / mL to about 1000 mg / mL, about 400 mg / mL to about 1000 mg / mL, about 450 mg / mL to about 1000 mg / mL, about 500 mg / mL to about 1000 mg / mL, about 550 mg / mL to about 1000 mg / mL, about 600 mg / mL to about 1000 mg / mL, about 650 mg / mL to about 1000 mg / mL, about 700 mg / mL to about 1000 mg / mL, about 750 mg / mL to about 1000 mg / mL, about 800 mg / mL to about 1000 mg / mL, about 850 mg / mL to about 1000 mg / mL, about 900 mg / mL to about 1000 mg / mL, about 950 mg / mL to about 1000 mg / mL, about 10 mg / mL to about 900 mg / mL, about 20 mg / mL to about 900 mg / mL, about 30 mg / mL to about 900 mg / mL, about 40 mg / mL to about 900 mg / mL, about 50 mg / mL to about 900 mg / mL, about 60 mg / mL toabout 900 mg / mL, about 70 mg / mL to about 900 mg / mL, about 80 mg / mL to about 900 mg / mL, about 90 mg / mL to about 900 mg / mL, about 100 mg / mL to about 900 mg / mL, about 150 mg / mL to about 900 mg / mL, about 200 mg / mL to about 900 mg / mL, about 250 mg / mL to about 900 mg / mL, about 300 mg / mL to about 900 mg / mL, about 350 mg / mL to about 900 mg / mL, about 400 mg / mL to about 900 mg / mL, about 450 mg / mL to about 900 mg / mL, about 500 mg / mL to about 900 mg / mL, about 550 mg / mL to about 900 mg / mL, about 600 mg / mL to about 900 mg / mL, about 650 mg / mL to about 900 mg / mL, about 700 mg / mL to about 900 mg / mL, about 750 mg / mL to about 900 mg / mL, about 800 mg / mL to about 900 mg / mL, about 850 mg / mL to about 900 mg / mL, about 10 mg / mL to about 800 mg / mL, 20 mg / mL to about 800 mg / mL, about 30 mg / mL to about 800 mg / mL, about 40 mg / mL to about 800 mg / mL, about 50 mg / mL to about 800 mg / mL, about 60 mg / mL to about 800 mg / mL, about 70 mg / mL to about 800 mg / mL, about 80 mg / mL to about 800 mg / mL, about 90 mg / mL to about 800 mg / mL, about 100 mg / mL to about 800 mg / mL, about 150 mg / mL to about 800 mg / mL, about 200 mg / mL to about 800 mg / mL, about 250 mg / mL to about 800 mg / mL, about 300 mg / mL to about 800 mg / mL, about 350 mg / mL to about 800 mg / mL, about 400 mg / mL to about 800 mg / mL, about 450 mg / mL to about 800 mg / mL, about 500 mg / mL to about 800 mg / mL, about 550 mg / mL to about 800 mg / mL, about 600 mg / mL to about 800 mg / mL, about 650 mg / mL to about 800 mg / mL, about 700 mg / mL to about 800 mg / mL, about 750 mg / mL to about 800 mg / mL, about 10 mg / mL to about 700 mg / mL, about 20 mg / mL to about 700 mg / mL, about 30 mg / mL to about 700 mg / mL, about 40 mg / mL to about 700 mg / mL, about 50 mg / mL to about 700 mg / mL, about 60 mg / mL to about 700 mg / mL, about 70 mg / mL to about 700 mg / mL, about 80 mg / mL to about 700 mg / mL, about 90 mg / mL to about 700 mg / mL, about 100 mg / mL to about 700 mg / mL, about 150 mg / mL to about 700 mg / mL, about 200 mg / mL to about 700 mg / mL, about 250 mg / mL to about 700 mg / mL, about 300 mg / mL to about 700 mg / mL, about 350 mg / mL to about 700 mg / mL, about 400 mg / mL to about 700 mg / mL, about 450 mg / mL to about 700 mg / mL, about 500 mg / mL to about 700 mg / mL, about 550 mg / mL to about 700 mg / mL, about 600 mg / mL to about 700 mg / mL, about 650 mg / mL to about 700 mg / mL, about 10 mg / mL to about 600 mg / mL, about 20 mg / mL to about 600 mg / mL, about 30 mg / mL to about 600 mg / mL, about 40 mg / mL to about 600 mg / mL, about 50 mg / mL to about 600 mg / mL, about 60 mg / mL to about 600 mg / mL, about 70 mg / mL to about 600 mg / mL, about 80 mg / mL to about 600 mg / mL, about 90 mg / mL to about 600 mg / mL, about 100 mg / mL to about 600 mg / mL, about 150 mg / mL to about 600 mg / mL, about 200 mg / mL to about 600 mg / mL, about 250 mg / mLto about 600 mg / mL, about 300 mg / mL to about 600 mg / mL, about 350 mg / mL to about 600 mg / mL, about 400 mg / mL to about 600 mg / mL, about 450 mg / mL to about 600 mg / mL, about 500 mg / mL to about 600 mg / mL, about 550 mg / mL to about 600 mg / mL, about 10 mg / mL to about 500 mg / mL, about 20 mg / mL to about 500 mg / mL, about 30 mg / mL to about 500 mg / mL, about 40 mg / mL to about 500 mg / mL, about 50 mg / mL to about 500 mg / mL, about 60 mg / mL to about 500 mg / mL, about 70 mg / mL to about 500 mg / mL, about 80 mg / mL to about 500 mg / mL, about 90 mg / mL to about 500 mg / mL, about 100 mg / mL to about 500 mg / mL, about 150 mg / mL to about 500 mg / mL, about 200 mg / mL to about 500 mg / mL, about 250 mg / mL to about 500 mg / mL, about 300 mg / mL to about 500 mg / mL, about 350 mg / mL to about 500 mg / mL, about 400 mg / mL to about 500 mg / mL, about 450 mg / mL to about 500 mg / mL, about 10 mg / mL to about 400 mg / mL, about 20 mg / mL to about 400 mg / mL, about 30 mg / mL to about 400 mg / mL, about 40 mg / mL to about 400 mg / mL, about 50 mg / mL to about 400 mg / mL, about 60 mg / mL to about 400 mg / mL, about 70 mg / mL to about 400 mg / mL, about 80 mg / mL to about 400 mg / mL, about 90 mg / mL to about 400 mg / mL, about 100 mg / mL to about 400 mg / mL, about 150 mg / mL to about 400 mg / mL, about 200 mg / mL to about 400 mg / mL, about 250 mg / mL to about 400 mg / mL, about 300 mg / mL to about 400 mg / mL, about 350 mg / mL to about 400 mg / mL, about 10 mg / mL to about 300 mg / mL, about 20 mg / mL to about 300 mg / mL, about 30 mg / mL to about 300 mg / mL, about 40 mg / mL to about 300 mg / mL, about 50 mg / mL to about 300 mg / mL, about 60 mg / mL to about 300 mg / mL, about 70 mg / mL to about 300 mg / mL, about 80 mg / mL to about 300 mg / mL, about 90 mg / mL to about 300 mg / mL, about 100 mg / mL to about 300 mg / mL, about 150 mg / mL to about 300 mg / mL, about 200 mg / mL to about 300 mg / mL, about 250 mg / mL to about 300 mg / mL, about 10 mg / mL to about 200 mg / mL, about 20 mg / mL to about 200 mg / mL, about 30 mg / mL to about 200 mg / mL, about 40 mg / mL to about 200 mg / mL, about 50 mg / mL to about 200 mg / mL, about 60 mg / mL to about 200 mg / mL, about 70 mg / mL to about 200 mg / mL, about 80 mg / mL to about 200 mg / mL, about 90 mg / mL to about 200 mg / mL, about 100 mg / mL to about 200 mg / mL, about 150 mg / mL to about 200 mg / mL, about 10 mg / mL to about 100 mg / mL, about 20 mg / mL to about 100 mg / mL, about 30 mg / mL to about 100 mg / mL, about 40 mg / mL to about 100 mg / mL, about 50 mg / mL to about 100 mg / mL, about 60 mg / mL to about 100 mg / mL, about 70 mg / mL to about 100 mg / mL, about 80 mg / mL to about 100 mg / mL, about 90 mg / mL to about 100 mg / mL, about 10 mg / mL to about 80 mg / mL, about 20 mg / mL to about 80 mg / mL, about 30 mg / mL to about 80 mg / mL, about 40 mg / mL to about 80 mg / mL, about 50 mg / mL to about80 mg / mL, about 60 mg / mL to about 80 mg / mL, about 70 mg / mL to about 80 mg / mL, about 10 mg / mL to about 60 mg / mL, about 20 mg / mL to about 60 mg / mL, about 30 mg / mL to about 60 mg / mL, about 40 mg / mL to about 60 mg / mL, about 50 mg / mL to about 60 mg / mL, about 10 mg / mL to about 40 mg / mL, about 20 mg / mL to about 40 mg / mL, about 30 mg / mL to about 40 mg / mL, or about 10 mg / mL to about 20 mg / mL of an antibody of the present disclosure, or antigen-binding fragment thereof.
[0170] In some embodiments, a composition (e.g., a pharmaceutical composition) comprises about 10 mg / mL, about 20 mg / mL, about 30 mg / mL, about 40 mg / mL, about 50 mg / mL, about 60 mg / mL, about 70 mg / mL, about 80 mg / mL, about 90 mg / mL, about 100 mg / mL, about 110 mg / mL, about 120 mg / mL, about 130 mg / mL, about 140 mg / mL, about 150 mg / mL, about 160 mg / mL, about 170 mg / mL, about 180 mg / mL, about 190 mg / mL, about 200 mg / mL, about 210 mg / mL, about 220 mg / mL, about 230 mg / mL, about 250 mg / mL, about 260 mg / mL, about 270 mg / mL, about 280 mg / mL, about 290 mg / mL, about 300 mg / mL, about 310 mg / mL, about 320 mg / mL, about 330 mg / mL, about 340 mg / mL, about 350 mg / mL, about 360 mg / mL, about 370 mg / mL, about 380 mg / mL, about 390 mg / mL, about 400 mg / mL, about 410 mg / mL, about 420 mg / mL, about 430 mg / mL, about 440 mg / mL, about 450 mg / mL, about 460 mg / mL, about 470 mg / mL, about 480 mg / mL, about 490 mg / mL, about 500 mg / mL, about 510 mg / mL, about 520 mg / mL, about 530 mg / mL, about 540 mg / mL, about 550 mg / mL, about 560 mg / mL, about 570 mg / mL, about 580 mg / mL, about 590 mg / mL, about 600 mg / mL, about 610 mg / mL, about 620 mg / mL, about 630 mg / mL, about 640 mg / mL, about 650 mg / mL, about 660 mg / mL, about 670 mg / mL, about 680 mg / mL, about 690 mg / mL, about 700 mg / mL, about 710 mg / mL, about 720 mg / mL, about 730 mg / mL, about 740 mg / mL, about 750 mg / mL, about 760 mg / mL, about 770 mg / mL, about 780 mg / mL, about 790 mg / mL, about 800 mg / mL, about 810 mg / mL, about 820 mg / mL, about 830 mg / mL, about 840 mg / mL, about 850 mg / mL, about 860 mg / mL, about 870 mg / mL, about 880 mg / mL, about 890 mg / mL, about 900 mg / mL, about 910 mg / mL, about 920 mg / mL, about 930 mg / mL, about 940 mg / mL, about 950 mg / mL, about 960 mg / mL, about 970 mg / mL, about 980 mg / mL, about 990 mg / mL, about 1000 mg / mL, about 1025 mg / mL, about 1050 mg / mL, about 1075 mg / mL, about 1100 mg / mL, about 1125 mg / mL, about 1150 mg / mL, about 1175 mg / mL, about 1200 mg / mL, about 1225 mg / mL, about 1250 mg / mL, about 1275 mg / mL, about 1300 mg / mL, about 1325 mg / mL, about 1350 mg / mL, about 1375 mg / mL, about 1400 mg / mL, about 1425 mg / mL,about 1450 mg / mL, about 1475 mg / mL, or about 1500 mg / mL of an antibody of the present disclosure, or antigen-binding fragment thereof.
[0171] In some embodiments, a composition disclosed herein is formulated to be administered with a second therapeutic agent as a combination therapy. In some embodiments, a second therapeutic agent comprises: a corticosteroid; a beta-agonist (e.g., a long-acting beta-agonist); a muscarinic antagonist; an anti-inflammatory agent; an IL-4 and / or IL- 13 antagonist (e.g., an antibody or antigen-binding fragment thereof targeting IL- 13, IL-4, or IL-4R); or any combination thereof.
[0172] In some embodiments, a second therapeutic agent comprises a corticosteroid (e.g., an inhaled corticosteroid). Non-limiting examples of inhaled corticosteroids include beclomethasone dipropionate, budesonide, ciclesonide, fluticasone furoate, fluticasone propionate, mometasone, and mometasone furoate.
[0173] In some embodiments, a combination therapy comprises a beta-agonist (e.g., a long-acting beta-agonist). Non-limiting examples of long-acting beta-agonists include albuterol sulfate, formoterol fumarate, salmeterol xinafoate, arformoterol tartrate, olodaterol, and combinations thereof.
[0174] In some embodiments, a combination therapy comprises a muscarinic antagonist.
[0175] In some embodiments, a combination therapy comprises an IL-4 and / or IL- 13 antagonist (e.g., for the treatment of allergic and / or asthmatic conditions). Non-limiting examples of IL-4 and / or IL-13 antagonists include: Pitrakinra; anti-IL-13 antibodies, or antigen-binding fragments thereof; anti-IL-4 antibodies, or antigen-binding fragments thereof; and anti-IL-4R antibodies, or antigen-binding fragments thereof. Non-limiting examples of antibodies or antigen-binding fragments thereof include: anti-IL-13 antibodies, or antigen-binding fragments thereof (e.g., Lebrikizumab, Tralokinumab, and Anrukinzumab); anti-IL-4 antibodies, or antigen-binding fragments thereof (e.g., Pascolizumab (SB 240683)); and anti-IL-4R antibodies, or antigen-binding fragments thereof (e.g., Dupilumab).
[0176] In some embodiments, a composition disclosed herein is formulated to be administered with an inhaled corticosteroid (ICS), a long-acting p2-agonist (LABA), a long- acting muscarinic antagonist (LAMA), or any combination thereof.
[0177] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, or antigen-binding fragment thereof, comprising,i. a VH comprising a HCDR1 comprising an amino acid sequence of SEQ ID NO:31, a HCDR2 comprising an amino acid sequence of SEQ ID NO:35, and a HCDR3 comprising an amino acid sequence of SEQ ID NO:50; and ii. a VL comprising a LCDR1 comprising an amino acid sequence of SEQ ID NO: 60, a LCDR2 comprising an amino acid sequence of DDS, and a LCDR3 comprising an amino acid sequence of SEQ ID NO:71, and b) a pharmaceutically acceptable carrier.
[0178] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, or antigen-binding fragment thereof, comprising, i. a VH comprising a HCDR1 consisting of an amino acid sequence of SEQ ID NO:31, a HCDR2 consisting of an amino acid sequence of SEQ ID NO:35, and a HCDR3 consisting of an amino acid sequence of SEQ ID NO:50; and ii. a VL comprising a LCDR1 consisting of an amino acid sequence of SEQ ID NO:60, a LCDR2 consisting of an amino acid sequence of DDS, and a LCDR3 consisting of an amino acid sequence of SEQ ID NO:71, and b) a pharmaceutically acceptable carrier.
[0179] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, or antigen-binding fragment thereof, comprising, i. a VH comprising a HCDR1 comprising an amino acid sequence of SEQ ID NO: 130, a HCDR2 comprising an amino acid sequence of SEQ ID NO: 131, and a HCDR3 comprising an amino acid sequence of SEQ ID NO: 132, numbered according to Kabat; and ii. a VL comprising a LCDR1 comprising an amino acid sequence of SEQ ID NO: 133 a LCDR2 comprising an amino acid sequence of SEQ ID NO: 134, and a LCDR3 comprising an amino acid sequence of SEQ ID NO:71, numbered according to Kabat, and b) a pharmaceutically acceptable carrier.
[0180] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, or antigen-binding fragment thereof, comprising, i. a VH comprising a HCDR1 consisting of an amino acid sequence of SEQ ID NO: 130, a HCDR2 consisting of an amino acid sequence of SEQ ID NO: 131, and a HCDR3 consisting of an amino acid sequence of SEQ ID NO: 132, numbered according to Kabat; and ii. a VL comprising a LCDR1 consisting of an amino acid sequence of SEQ ID NO: 133 a LCDR2 consisting of an amino acid sequence of SEQ ID NO: 134, and a LCDR3 consisting of an amino acid sequence of SEQ ID NO:71, numbered according to Kabat, and b) a pharmaceutically acceptable carrier.
[0181] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, or antigen-binding fragment thereof, comprising, i. a VH comprising a HCDR1 comprising an amino acid sequence of SEQ ID NO: 135, a HCDR2 comprising an amino acid sequence of SEQ ID NO: 136, and a HCDR3 comprising an amino acid sequence of SEQ ID NO: 132, numbered according to Chothia; and ii. a VL comprising a LCDR1 comprising an amino acid sequence of SEQ ID NO: 133 a LCDR2 comprising an amino acid sequence of SEQ ID NO: 134, and a LCDR3 comprising an amino acid sequence of SEQ ID NO:71, numbered according to Chothia, and b) a pharmaceutically acceptable carrier.
[0182] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, or antigen-binding fragment thereof, comprising, i. a VH comprising a HCDR1 consisting of an amino acid sequence of SEQ ID NO: 135, a HCDR2 consisting of an amino acid sequence of SEQ ID NO: 136, and a HCDR3 consisting of an amino acid sequence of SEQ ID NO: 132, numbered according to Chothia; and ii. a VL comprising a LCDR1 consisting of an amino acid sequence of SEQ ID NO: 133 a LCDR2 consisting of an amino acid sequence ofSEQ ID NO: 134, and a LCDR3 consisting of an amino acid sequence of SEQ ID NO:71, numbered according to Chothia, and b) a pharmaceutically acceptable carrier.
[0183] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, or antigen-binding fragment thereof, comprising, i. a VH comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID N0:5; and ii. a VL comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity SEQ ID N0:21, and b) a pharmaceutically acceptable carrier.
[0184] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, or antigen-binding fragment thereof, comprising, i. a VH consisting of an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO: 5; and ii. a VL consisting of an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:21, and b) a pharmaceutically acceptable carrier.
[0185] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises:a) an antibody, or antigen-binding fragment thereof, comprising, i. a VH comprising an amino acid sequence of SEQ ID NO:5; and ii. a VL comprising an amino acid sequence of SEQ ID NO:21, and b) a pharmaceutically acceptable carrier.
[0186] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, or antigen-binding fragment thereof, comprising, i. a VH consisting of an amino acid sequence of SEQ ID NO:5; and ii. a VL consisting of an amino acid sequence of SEQ ID NO:21, and b) a pharmaceutically acceptable carrier.
[0187] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, comprising, i. a HC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to of SEQ ID NO: 92; and ii. a LC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to sequence of SEQ ID NO: 120, and b) a pharmaceutically acceptable carrier.
[0188] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, comprising, i. a HC comprising an amino acid sequence of SEQ ID NO: 92; and ii. a LC comprising an amino acid sequence of SEQ ID NO: 120, and b) a pharmaceutically acceptable carrier.
[0189] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, comprising,i. a HC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to of SEQ ID NO: 106; and ii. a LC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to sequence of SEQ ID NO: 120, and b) a pharmaceutically acceptable carrier.
[0190] In some embodiments, a composition (e.g., a pharmaceutical composition) of the present disclosure comprises: a) an antibody, comprising, i. a HC comprising an amino acid sequence of SEQ ID NO: 106; and ii. a LC comprising an amino acid sequence of SEQ ID NO: 120, and b) a pharmaceutically acceptable carrier.VII. Dosing
[0191] Methods described herein include administering at least one dose of an antibody or antigen-binding fragment thereof, that specifically binds to TSLP.
[0192] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 comprising an amino acid sequence of SEQ ID NO:31, a HCDR2 comprising an amino acid sequence of SEQ ID NO:35, and a HCDR3 comprising an amino acid sequence of SEQ ID NO:50; and b) a LCDR1 comprising an amino acid sequence of SEQ ID NO:60, a LCDR2 comprising an amino acid sequence of DDS, and a LCDR3 comprising an amino acid sequence of SEQ ID NO:71.
[0193] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 consisting of an amino acid sequence of SEQ ID NO:31, a HCDR2 consisting of an amino acid sequence of SEQ ID NO:35, and a HCDR3 consisting of an amino acid sequence of SEQ ID NO:50; andb) a LCDR1 consisting of an amino acid sequence of SEQ ID NO:60, a LCDR2 consisting of an amino acid sequence of DDS, and a LCDR3 consisting of an amino acid sequence of SEQ ID NO:71.
[0194] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 comprising an amino acid sequence of SEQ ID NO: 130, a HCDR2 comprising an amino acid sequence of SEQ ID NO: 131, and a HCDR3 comprising an amino acid sequence of SEQ ID NO: 132, numbered according to Kabat; and b) a LCDR1 comprising an amino acid sequence of SEQ ID NO: 133 a LCDR2 comprising an amino acid sequence of SEQ ID NO: 134, and a LCDR3 comprising an amino acid sequence of SEQ ID NO:71, numbered according to Kabat.
[0195] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a) a HCDR1 consisting of an amino acid sequence of SEQ ID NO: 130, a HCDR2 consisting of an amino acid sequence of SEQ ID NO: 131, and a HCDR3 consisting of an amino acid sequence of SEQ ID NO: 132, numbered according to Kabat; and b) b) a LCDR1 consisting of an amino acid sequence of SEQ ID NO: 133 a LCDR2 consisting of an amino acid sequence of SEQ ID NO: 134, and a LCDR3 consisting of an amino acid sequence of SEQ ID NO:71, numbered according to Kabat.
[0196] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a) a HCDR1 comprising an amino acid sequence of SEQ ID NO: 135, a HCDR2 comprising an amino acid sequence of SEQ ID NO: 136, and a HCDR3 comprising an amino acid sequence of SEQ ID NO: 132, numbered according to Chothia; and b) b) a LCDR1 comprising an amino acid sequence of SEQ ID NO: 133 a LCDR2 comprising an amino acid sequence of SEQ ID NO: 134, and a LCDR3 comprising an amino acid sequence of SEQ ID NO:71, numbered according to Chothia.
[0197] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a HCDR1 consisting of an amino acid sequence of SEQ ID NO: 135, a HCDR2 consisting of an amino acid sequence of SEQ ID NO: 136, and a HCDR3 consisting of an amino acid sequence of SEQ ID NO: 132, numbered according to Chothia; and b) a LCDR1 consisting of an amino acid sequence of SEQ ID NO: 133 a LCDR2 consisting of an amino acid sequence of SEQ ID NO: 134, and a LCDR3 consisting of an amino acid sequence of SEQ ID NO:71, numbered according to Chothia.
[0198] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a VH that is humanized, contains human framework regions, or a combination thereof; and / or b) a VL that is humanized, contains human framework regions, or a combination thereof.
[0199] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a VH comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:5; and b) a VL comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity SEQ ID NO:21.
[0200] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a VH consisting of an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:5; andb) a VL consisting of an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:21.
[0201] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a VH comprising an amino acid sequence of SEQ ID NO:5; and b) a VL comprising an amino acid sequence of SEQ ID NO:21.
[0202] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, or antigen-binding fragment thereof, comprising: a) a VH consisting of an amino acid sequence of SEQ ID NO:5; and b) a VL consisting of an amino acid sequence of SEQ ID NO:21.
[0203] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, comprising: a) a HC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to of SEQ ID NO: 92; and b) a LC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to sequence of SEQ ID NO: 120.
[0204] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody (AB-2b without Fc YTE substitutions), comprising: a) a HC comprising an amino acid sequence of SEQ ID NO: 92; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
[0205] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody, comprising: a) a HC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to of SEQ ID NO: 106; andb) a LC comprising an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to sequence of SEQ ID NO: 120.
[0206] In some embodiments, a method of the present disclosure includes administering at least one dose of an anti-TSLP antibody (AB-2b, with Fc YTE substitutions), comprising: a) a HC comprising an amino acid sequence of SEQ ID NO: 106; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
[0207] In some embodiments, a dose of an antibody described herein (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, comprises from about 10 mg to about 1500 mg of the antibody, or antigen-binding fragment thereof. In some embodiments, a dose of an antibody described herein, or antigen-binding fragment thereof, comprises from about 10 mg to about 1500 mg, about 20 mg to about 1500 mg, about 30 mg to about 1500 mg, about 40 mg to about 1500 mg, about 50 mg to about 1500 mg, about 60 mg to about 1500 mg, about 70 mg to about 1500 mg, about 80 mg to about 1500 mg, about 90 mg to about 1500 mg, about 100 mg to about 1500 mg, about 150 mg to about 1500 mg, about 200 mg to about 1500 mg, about 250 mg to about 1500 mg, about 300 mg to about 1500 mg, about 350 mg to about 1500 mg, about 400 mg to about 1500 mg, about 450 mg to about 1500 mg, about 500 mg to about 1500 mg, about 550 mg to about 1500 mg, about 600 mg to about 1500 mg, about 650 mg to about 1500 mg, about 700 mg to about 1500 mg, about 750 mg to about 1500 mg, about 800 mg to about 1500 mg, about 850 mg to about 1500 mg, about 900 mg to about 1500 mg, about 950 mg to about 1500 mg, about 1000 mg to about 1500 mg, about 1050 mg to about 1500 mg, about 1100 mg to about 1500 mg, about 1150 mg to about 1500 mg, about 1200 mg to about 1500 mg, about 1250 mg to about 1500 mg, about 1300 mg to about 1500 mg, about 1350 mg to about 1500 mg, about 1400 mg to about 1500 mg, about 1450 mg to about 1500 mg, about 10 mg to about 1400 mg, about 20 mg to about 1400 mg, about 30 mg to about 1400 mg, about 40 mg to about 1400 mg, about 50 mg to about 1400 mg, about 60 mg to about 1400 mg, about 70 mg to about 1400 mg, about 80 mg to about 1400 mg, about 90 mg to about 1400 mg, about 100 mg to about 1400 mg, about 150 mg to about 1400 mg, about 200 mg to about 1400 mg, about 250 mg to about 1400 mg, about 300 mg to about 1400 mg, about 350 mg to about 1400 mg, about 400 mg to about 1400 mg, about 450 mg to about 1400 mg, about 500 mg to about 1400 mg, about 550 mg to about 1400 mg, about 600 mg to about 1400 mg, about 650 mg to about 1400 mg,about 700 mg to about 1400 mg, about 750 mg to about 1400 mg, about 800 mg to about 1400 mg, about 850 mg to about 1400 mg, about 900 mg to about 1400 mg, about 950 mg to about 1400 mg, about 1000 mg to about 1400 mg, about 1050 mg to about 1400 mg, about 1100 mg to about 1400 mg, about 1150 mg to about 1400 mg, about 1200 mg to about 1400 mg, about 1250 mg to about 1400 mg, about 1300 mg to about 1400 mg, about 1350 mg to about 1400 mg, about 10 mg to about 1300 mg, about 20 mg to about 1300 mg, about 30 mg to about 1300 mg, about 40 mg to about 1300 mg, about 50 mg to about 1300 mg, about 60 mg to about 1300 mg, about 70 mg to about 1300 mg, about 80 mg to about 1300 mg, about 90 mg to about 1300 mg, about 100 mg to about 1300 mg, about 150 mg to about 1300 mg, about 200 mg to about 1300 mg, about 250 mg to about 1300 mg, about 300 mg to about 1300 mg, about 350 mg to about 1300 mg, about 400 mg to about 1300 mg, about 450 mg to about 1300 mg, about 500 mg to about 1300 mg, about 550 mg to about 1300 mg, about 600 mg to about 1300 mg, about 650 mg to about 1300 mg, about 700 mg to about 1300 mg, about 750 mg to about 1300 mg, about 800 mg to about 1300 mg, about 850 mg to about 1300 mg, about 900 mg to about 1300 mg, about 950 mg to about 1300 mg, about 1000 mg to about 1300 mg, about 1050 mg to about 1300 mg, about 1100 mg to about 1300 mg, about 1150 mg to about 1300 mg, about 1200 mg to about 1300 mg, about 1250 mg to about 1300 mg, about 10 mg to about 1200 mg, about 20 mg to about 1200 mg, about 30 mg to about 1200 mg, about 40 mg to about 1200 mg, about 50 mg to about 1200 mg, about 60 mg to about 1200 mg, about 70 mg to about 1200 mg, about 80 mg to about 1200 mg, about 90 mg to about 1200 mg, about 100 mg to about 1200 mg, about 150 mg to about 1200 mg, about 200 mg to about 1200 mg, about 250 mg to about 1200 mg, about 300 mg to about 1200 mg, about 350 mg to about 1200 mg, about 400 mg to about 1200 mg, about 450 mg to about 1200 mg, about 500 mg to about 1200 mg, about 550 mg to about 1200 mg, about 600 mg to about 1200 mg, about 650 mg to about 1200 mg, about 700 mg to about 1200 mg, about 750 mg to about 1200 mg, about 800 mg to about 1200 mg, about 850 mg to about 1200 mg, about 900 mg to about 1200 mg, about 950 mg to about 1200 mg, about 1000 mg to about 1200 mg, about 1050 mg to about 1200 mg, about 1100 mg to about 1200 mg, about 1150 mg to about 1200 mg, about 10 mg to about 1100 mg, about 20 mg to about 1100 mg, about 30 mg to about 1100 mg, about 40 mg to about 1100 mg, about 50 mg to about 1100 mg, about 60 mg to about 1100 mg, about 70 mg to about 1100 mg, about 80 mg to about 1100 mg, about 90 mg to about 1100 mg, about 100 mg to about 1100 mg, about 150 mg to about 1100 mg, about 200 mg to about 1100 mg, about 250 mg to about 1100 mg, about 300 mg to about1100 mg, about 350 mg to about 1100 mg, about 400 mg to about 1100 mg, about 450 mg to about 1100 mg, about 500 mg to about 1100 mg, about 550 mg to about 1100 mg, about 600 mg to about 1100 mg, about 650 mg to about 1100 mg, about 700 mg to about 1100 mg, about 750 mg to about 1100 mg, about 800 mg to about 1100 mg, about 850 mg to about 1100 mg, about 900 mg to about 1100 mg, about 950 mg to about 1100 mg, about 1000 mg to about 1100 mg, about 1050 mg to about 1100 mg, about 10 mg to about 1000 mg, about 20 mg to about 1000 mg, about 30 mg to about 1000 mg, about 40 mg to about 1000 mg, about 50 mg to about 1000 mg, about 60 mg to about 1000 mg, about 70 mg to about 1000 mg, about 80 mg to about 1000 mg, about 90 mg to about 1000 mg, about 100 mg to about 1000 mg, about 150 mg to about 1000 mg, about 200 mg to about 1000 mg, about 250 mg to about 1000 mg, about 300 mg to about 1000 mg, about 350 mg to about 1000 mg, about 400 mg to about 1000 mg, about 450 mg to about 1000 mg, about 500 mg to about 1000 mg, about 550 mg to about 1000 mg, about 600 mg to about 1000 mg, about 650 mg to about 1000 mg, about 700 mg to about 1000 mg, about 750 mg to about 1000 mg, about 800 mg to about 1000 mg, about 850 mg to about 1000 mg, about 900 mg to about 1000 mg, about 950 mg to about 1000 mg, about 10 mg to about 900 mg, about 20 mg to about 900 mg, about 30 mg to about 900 mg, about 40 mg to about 900 mg, about 50 mg to about 900 mg, about 60 mg to about 900 mg, about 70 mg to about 900 mg, about 80 mg to about 900 mg, about 90 mg to about 900 mg, about 100 mg to about 900 mg, about 150 mg to about 900 mg, about 200 mg to about 900 mg, about 250 mg to about 900 mg, about 300 mg to about 900 mg, about 350 mg to about 900 mg, about 400 mg to about 900 mg, about 450 mg to about 900 mg, about 500 mg to about 900 mg, about 550 mg to about 900 mg, about 600 mg to about 900 mg, about 650 mg to about 900 mg, about 700 mg to about 900 mg, about 750 mg to about 900 mg, about 800 mg to about 900 mg, about 850 mg to about 900 mg, about 10 mg to about 800 mg, about 20 mg to about 800 mg, about 30 mg to about 800 mg, about 40 mg to about 800 mg, about 50 mg to about 800 mg, about 60 mg to about 800 mg, about 70 mg to about 800 mg, about 80 mg to about 800 mg, about 90 mg to about 800 mg, about 100 mg to about 800 mg, about 150 mg to about 800 mg, about 200 mg to about 800 mg, about 250 mg to about 800 mg, about 300 mg to about 800 mg, about 350 mg to about 800 mg, about 400 mg to about 800 mg, about 450 mg to about 800 mg, about 500 mg to about 800 mg, about 550 mg to about 800 mg, about 600 mg to about 800 mg, about 650 mg to about 800 mg, about 700 mg to about 800 mg, about 750 mg to about 800 mg, about 10 mg to about 700 mg, about 20 mg to about 700 mg, about 30 mg to about 700 mg, about 40 mg to about 700 mg, about 50mg to about 700 mg, about 60 mg to about 700 mg, about 70 mg to about 700 mg, about 80 mg to about 700 mg, about 90 mg to about 700 mg, about 100 mg to about 700 mg, about 150 mg to about 700 mg, about 200 mg to about 700 mg, about 250 mg to about 700 mg, about 300 mg to about 700 mg, about 350 mg to about 700 mg, about 400 mg to about 700 mg, about 450 mg to about 700 mg, about 500 mg to about 700 mg, about 550 mg to about 700 mg, about 600 mg to about 700 mg, about 650 mg to about 700 mg, about 10 mg to about 600 mg, about 20 mg to about 600 mg, about 30 mg to about 600 mg, about 40 mg to about 600 mg, about 50 mg to about 600 mg, about 60 mg to about 600 mg, about 70 mg to about 600 mg, about 80 mg to about 600 mg, about 90 mg to about 600 mg, about 100 mg to about 600 mg, about 150 mg to about 600 mg, about 200 mg to about 600 mg, about 250 mg to about 600 mg, about 300 mg to about 600 mg, about 350 mg to about 600 mg, about 400 mg to about 600 mg, about 450 mg to about 600 mg, about 500 mg to about 600 mg, about 550 mg to about 600 mg, about 10 mg to about 500 mg, about 20 mg to about 500 mg, about 30 mg to about 500 mg, about 40 mg to about 500 mg, about 50 mg to about 500 mg, about 60 mg to about 500 mg, about 70 mg to about 500 mg, about 80 mg to about 500 mg, about 90 mg to about 500 mg, about 100 mg to about 500 mg, about 150 mg to about 500 mg, about 200 mg to about 500 mg, about 250 mg to about 500 mg, about 300 mg to about 500 mg, about 350 mg to about 500 mg, about 400 mg to about 500 mg, about 450 mg to about 500 mg, about 10 mg to about 400 mg, about 20 mg to about 400 mg, about 30 mg to about 400 mg, about 40 mg to about 400 mg, about 50 mg to about 400 mg, about 60 mg to about 400 mg, about 70 mg to about 400 mg, about 80 mg to about 400 mg, about 90 mg to about 400 mg, about 100 mg to about 400 mg, about 150 mg to about 400 mg, about 200 mg to about 400 mg, about 250 mg to about 400 mg, about 300 mg to about 400 mg, about 350 mg to about 400 mg, about 10 mg to about 300 mg, about 20 mg to about 300 mg, about 30 mg to about 300 mg, about 40 mg to about 300 mg, about 50 mg to about 300 mg, about 60 mg to about 300 mg, about 70 mg to about 300 mg, about 80 mg to about 300 mg, about 90 mg to about 300 mg, about 100 mg to about 300 mg, about 150 mg to about 300 mg, about 200 mg to about 300 mg, about 250 mg to about 300 mg, about 10 mg to about 200 mg, about 20 mg to about 200 mg, about 30 mg to about 200 mg, about 40 mg to about 200 mg, about 50 mg to about 200 mg, about 60 mg to about 200 mg, about 70 mg to about 200 mg, about 80 mg to about 200 mg, about 90 mg to about 200 mg, about 100 mg to about 200 mg, about 150 mg to about 200 mg, about 10 mg to about 100 mg, about 20 mg to about 100 mg, about 30 mg to about 100 mg, about 40 mg to about 100 mg, about 50 mg to about 100 mg, about 60 mg toabout 100 mg, about 70 mg to about 100 mg, about 80 mg to about 100 mg, about 90 mg to about 100 mg, about 10 mg to about 80 mg, about 20 mg to about 80 mg, about 30 mg to about 80 mg, about 40 mg to about 80 mg, about 50 mg to about 80 mg, about 60 mg to about 80 mg, about 70 mg to about 80 mg, about 10 mg to about 60 mg, about 20 mg to about 60 mg, about 30 mg to about 60 mg, about 40 mg to about 60 mg, about 50 mg to about 60 mg, about 10 mg to about 40 mg, about 20 mg to about 40 mg, about 30 mg to about 40 mg, or about 10 mg to about 20 mg of an antibody of the present disclosure, or antigen-binding fragment thereof.
[0208] In some embodiments, a dose of an antibody described herein (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, comprises about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about 130 mg, about 140 mg, about 150 mg, about 160 mg, about 170 mg, about 180 mg, about 190 mg, about 200 mg, about 210 mg, about 220 mg, about 230 mg, about 250 mg, about 260 mg, about 270 mg, about 280 mg, about 290 mg, about 300 mg, about 310 mg, about 320 mg, about 330 mg, about 340 mg, about 350 mg, about 360 mg, about 370 mg, about 380 mg, about 390 mg, about 400 mg, about 410 mg, about 420 mg, about 430 mg, about 440 mg, about 450 mg, about 460 mg, about 470 mg, about 480 mg, about 490 mg, about 500 mg, about 510 mg, about 520 mg, about 530 mg, about 540 mg, about 550 mg, about 560 mg, about 570 mg, about 580 mg, about 590 mg, about 600 mg, about 610 mg, about 620 mg, about 630 mg, about 640 mg, about 650 mg, about 660 mg, about 670 mg, about 680 mg, about 690 mg, about 700 mg, about 710 mg, about 720 mg, about 730 mg, about 740 mg, about 750 mg, about 760 mg, about 770 mg, about 780 mg, about 790 mg, about 800 mg, about 810 mg, about 820 mg, about 830 mg, about 840 mg, about 850 mg, about 860 mg, about 870 mg, about 880 mg, about 890 mg, about 900 mg, about 910 mg, about 920 mg, about 930 mg, about 940 mg, about 950 mg, about 960 mg, about 970 mg, about 980 mg, about 990 mg, about 1000 mg, about 1025 mg, about 1050 mg, about 1075 mg, about 1100 mg, about 1125 mg, about 1150 mg, about 1175 mg, about 1200 mg, about 1225 mg, about 1250 mg, about 1275 mg, about 1300 mg, about 1325 mg, about 1350 mg, about 1375 mg, about 1400 mg, about 1425 mg, about 1450 mg, about 1475 mg, or about 1500 mg of the antibody, or antigen-binding fragment thereof.
[0209] In some embodiments, a dose of an antibody described herein (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, comprises about 150 mgto about 1500 mg of the antibody, or antigen-binding fragment thereof. In some embodiments, a dose of an antibody described herein, or antigen-binding fragment thereof, comprises about 200 mg to about 1400 mg of the antibody, or antigen-binding fragment thereof. In some embodiments, a dose of an antibody described herein, or antigen-binding fragment thereof, comprises about 250 mg to about 1300 mg, or about 300 mg to about 1200 mg of the antibody, or antigen-binding fragment thereof. In some embodiments, a dose of an antibody described herein, or antigen-binding fragment thereof, comprises about 300 mg to about 1200 mg of the antibody, or antigen-binding fragment thereof. In some embodiments, a dose of an antibody described herein, or antigen-binding fragment thereof, comprises about 300 mg of the antibody, or antigen-binding fragment thereof. In some embodiments, a dose of an antibody described herein, or antigen-binding fragment thereof, comprises about 600 mg of the antibody, or antigen-binding fragment thereof. In some embodiments, a dose of an antibody described herein, or antigen-binding fragment thereof, comprises about 1200 mg of the antibody, or antigen-binding fragment thereof.
[0210] In some embodiments, a dose of an antibody described herein (e.g., AB-2b with or without Fc YTE substitutions) comprises about 10 mg of the antibody. In some embodiments, a dose of an antibody described herein (e.g., AB-2b with or without Fc YTE substitutions) comprises about 30 mg of the antibody. In some embodiments, a dose of an antibody described herein (e.g., AB-2b with or without Fc YTE substitutions) comprises about 100 mg of the antibody. In some embodiments, a dose of an antibody described herein (e.g., AB-2b with or without Fc YTE substitutions) comprises about 300 mg of the antibody. In some embodiments, a dose of an antibody described herein (e.g., AB-2b with or without Fc YTE substitutions) comprises about 600 mg of the antibody. In some embodiments, a dose of an antibody described herein (e.g., AB-2b with or without Fc YTE substitutions) comprises about 1200 mg of the antibody.
[0211] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 doses. In some embodiments, one or more doses of an antibody of the present disclosure, or antigen-binding fragment thereof, is administered to a subject in need thereof on a single occasion or multiple occasions. Intervals between single doses of an antibody of the present disclosure, or antigen-binding fragment thereof, can be weekly, monthly, quarterly, or yearly. Intervals between single doses of an antibody of the presentdisclosure, or antigen-binding fragment thereof, can be about weekly, about monthly, about quarterly, or about yearly. Administration of doses of an antibody of the present disclosure, or antigen-binding fragment thereof, can be repeated various times. In some embodiments, doses of an antibody of the present disclosure, or antigen-binding fragment thereof, are administered at least 2 or more times. In some embodiments, doses of an antibody of the present disclosure, or antigen-binding fragment thereof, are administered at least 2 times, at least 3 times, at least 4 times, at least 5 times, at least 6 times, at least 7 times, at least 8 times, at least 9 times, at least 10 times or more. In some embodiments, doses of an antibody of the present disclosure, or antigen-binding fragment thereof, and dosing frequencies described herein are repeated indefinitely.
[0212] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses once about every 1 to about every 24 months, once about every 2 to about every 24 months, once about every 3 to about every 24 months, once about every 4 to about every 24 months, once about every 5 to about every 24 months, once about every 6 to about every 24 months, once about every 7 to about every 24 months, once about every 8 to about every 24 months, once about every 9 to about every 24 months, once about every 10 to about every 24 months, once about every 11 to about every 24 months, once about every 12 to about every 24 months, once about every 13 to about every 24 months, once about every 14 to about every 24 months, once about every 15 to about every 24 months, once about every 16 to about every 24 months, once about every 17 to about every 24 months, once about every 18 to about every 24 months, once about every 19 to about every 24 months, once about every 20 to about every 24 months, once about every 21 to about every 24 months, once about every 22 to about every 24 months, once about every 23 to about every 24 months, once about every 1 to about every 22 months, once about every 2 to about every 22 months, once about every 3 to about every 22 months, once about every 4 to about every 22 months, once about every 5 to about every 22 months, once about every 6 to about every 22 months, once about every 7 to about every 22 months, once about every 8 to about every 22 months, once about every 9 to about every 22 months, once about every 10 to about every 22 months, once about every 11 to about every 22 months, once about every 12 to about every 22 months, once about every 13 to about every 22 months, once about every 14 to about every 22 months, once about every 15 to about every 22 months, once about every 16 to about every 22 months, once about every 17 to about every22 months, once about every 18 to about every 22 months, once about every 19 to about every 22 months, once about every 20 to about every 22 months, once about every 21 to about every 22 months, once about every 1 to about every 20 months, once about every 2 to about every 20 months, once about every 3 to about every 20 months, once about every 4 to about every 20 months, once about every 5 to about every 20 months, once about every 6 to about every 20 months, once about every 7 to about every 20 months, once about every 8 to about every 20 months, once about every 9 to about every 20 months, once about every 10 to about every 20 months, once about every 11 to about every 20 months, once about every 12 to about every 20 months, once about every 13 to about every 20 months, once about every14 to about every 20 months, once about every 15 to about every 20 months, once about every 16 to about every 20 months, once about every 17 to about every 20 months, once about every 18 to about every 20 months, once about every 19 to about every 20 months, once about every 1 to about every 18 months, once about every 2 to about every 18 months, once about every 3 to about every 18 months, once about every 4 to about every 18 months, once about every 5 to about every 18 months, once about every 6 to about every 18 months, once about every 7 to about every 18 months, once about every 8 to about every 18 months, once about every 9 to about every 18 months, once about every 10 to about every 18 months, once about every 11 to about every 18 months, once about every 12 to about every 18 months, once about every 13 to about every 18 months, once about every 14 to about every 18 months, once about every 15 to about every 18 months, once about every 16 to about every 18 months, once about every 17 to about every 18 months, once about every 1 to about every 16 months, once about every 2 to about every 16 months, once about every 3 to about every 16 months, once about every 4 to about every 16 months, once about every 5 to about every 16 months, once about every 6 to about every 16 months, once about every 7 to about every 16 months, once about every 8 to about every 16 months, once about every 9 to about every 16 months, once about every 10 to about every 16 months, once about every 11 to about every 16 months, once about every 12 to about every 16 months, once about every 13 to about every 16 months, once about every 14 to about every 16 months, once about every15 to about every 16 months, once about every 1 to about every 14 months, once about every2 to about every 14 months, once about every 3 to about every 14 months, once about every 4 to about every 14 months, once about every 5 to about every 14 months, once about every 6 to about every 14 months, once about every 7 to about every 14 months, once about every 8 to about every 14 months, once about every 9 to about every 14 months, once about every 10-to about every 14 months, once about every 11 to about every 14 months, once about every 12 to about every 14 months, once about every 13 to about every 14 months, once about every 1 to about every 12 months, once about every 2 to about every 12 months, once about every 3 to about every 12 months, once about every 4 to about every 12 months, once about every 5 to about every 12 months, once about every 6 to about every 12 months, once about every 7 to about every 12 months, once about every 8 to about every 12 months, once about every 9 to about every 12 months, once about every 10 to about every 12 months, once about every 11 to about every 12 months, once about every 1 to about every 10 months, once about every 2 to about every 10 months, once about every 3 to about every 10 months, once about every 4 to about every 10 months, once about every 5 to about every 10 months, once about every 6 to about every 10 months, once about every 7 to about every 10 months, once about every 8 to about every 10 months, once about every 9 to about every 10 months, once about every 1 to about every 8 months, once about every 2 to about every 8 months, once about every 3 to about every 8 months, once about every 4 to about every 8 months, once about every 5 to about every 8 months, once about every 6 to about every 8 months, once about every 7 to about every 8 months, once about every 1 to about every 6 months, once about every 2 to about every 6 months, once about every 3 to about every 6 months, once about every 4 to about every 6 months, once about every 5 to about every 6 months, once about every 1 to about every 4 months, once about every 2 to about every 4 months, once about every 3 to about every 4 months, or once about every 1 to about every 2 months.
[0213] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses once about every 1 month, once about every 2 months, once about every 3 months, once about every 4 months, once about every 5 months, once about every 6 months, once about every 7 months, once about every 8 months, once about every 9 months, once about every 10 months, once about every 11 months, once about every 12 months, once about every 13 months, once about every 14 months, once about every 15 months, once about every 16 months, once about every 17 months, once about every 18 months, once about every 19 months, once about every 20 months, once about every 21 months, once about every 22 months, once about every 23 months, or once about every 24 months.
[0214] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to asubject in need thereof in one or more doses once about every 3 months. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses once about every 6 months. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigenbinding fragment thereof, is administered to a subject in need thereof in one or more doses once about every 9 months. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses once about every 12 months. In some embodiments, AB-2b (with Fc YTE substitutions) is administered to a subject in need thereof in one or more doses once about every 6 months. In some embodiments, AB-2b without Fc YTE substitutions is administered to a subject in need thereof in one or more doses once about every 6 months.
[0215] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses once about every 1 to about every 28 weeks, once about every 2 to about every 28 weeks, once about every 3 to about every 28 weeks, once about every 4 to about every 28 weeks, once about every 5 to about every 28 weeks, once about every 6 to about every 28 weeks, once about every 7 to about every 28 weeks, once about every 8 to about every 28 weeks, once about every 9 to about every 28 weeks, once about every 10 to about every 28 weeks, once about every 11 to about every 28 weeks, once about every 12 to about every 28 weeks, once about every 13 to about every 28 weeks, once about every 14 to about every 28 weeks, once about every 15 to about every 28 weeks, once about every 16 to about every 28 weeks, once about every 17 to about every 28 weeks, once about every 18 to about every 28 weeks, once about every 19 to about every 28 weeks, once about every 20 to about every 28 weeks, once about every 21 to about every 28 weeks, once about every 22 to about every 28 weeks, once about every 23 to about every 28 weeks, once about every 24 to about every 28 weeks, once about every 25 to about every 28 weeks, once about every 26 to about every 28 weeks, once about every 27 to about every 28 weeks, once about every 1 to about every 26 weeks, once about every 2 to about every 26 weeks, once about every 3 to about every 26 weeks, once about every 4 to about every 26 weeks, once about every 5 to about every 26 weeks, once about every 6 to about every 26 weeks, once about every 7 to about every 26 weeks, once about every 8 to about every 26 weeks,once about every 9 to about every 26 weeks, once about every 10 to about every 26 weeks, once about every 11 to about every 26 weeks, once about every 12 to about every 26 weeks, once about every 13 to about every 26 weeks, once about every 14 to about every 26 weeks, once about every 15 to about every 26 weeks, once about every 16 to about every 26 weeks, once about every 17 to about every 26 weeks, once about every 18 to about every 26 weeks, once about every 19 to about every 26 weeks, once about every 20 to about every 26 weeks, once about every 21 to about every 26 weeks, once about every 22 to about every 26 weeks, once about every 23 to about every 26 weeks, once about every 24 to about every 26 weeks, once about every 25 to about every 26 weeks, once about every 1 to about every 24 weeks, once about every 2 to about every 24 weeks, once about every 3 to about every 24 weeks, once about every 4 to about every 24 weeks, once about every 5 to about every 24 weeks, once about every 6 to about every 24 weeks, once about every 7 to about every 24 weeks, once about every 8 to about every 24 weeks, once about every 9 to about every 24 weeks, once about every 10 to about every 24 weeks, once about every 11 to about every 24 weeks, once about every 12 to about every 24 weeks, once about every 13 to about every 24 weeks, once about every 14 to about every 24 weeks, once about every 15 to about every 24 weeks, once about every 16 to about every 24 weeks, once about every 17 to about every 24 weeks, once about every 18 to about every 24 weeks, once about every 19 to about every 24 weeks, once about every 20 to about every 24 weeks, once about every 21 to about every 24 weeks, once about every 22 to about every 24 weeks, once about every 23 to about every 24 weeks, once about every 1 to about every 22 weeks, once about every 2 to about every 22 weeks, once about every 3 to about every 22 weeks, once about every 4 to about every 22 weeks, once about every 5 to about every 22 weeks, once about every 6 to about every 22 weeks, once about every 7 to about every 22 weeks, once about every 8 to about every 22 weeks, once about every 9 to about every 22 weeks, once about every 10 to about every 22 weeks, once about every 11 to about every 22 weeks, once about every 12 to about every 22 weeks, once about every 13 to about every 22 weeks, once about every 14 to about every 22 weeks, once about every 15 to about every 22 weeks, once about every 16 to about every 22 weeks, once about every 17 to about every 22 weeks, once about every 18 to about every 22 weeks, once about every 19 to about every 22 weeks, once about every 20 to about every 22 weeks, once about every 21 to about every 22 weeks, once about every 1 to about every 20 weeks, once about every 2 to about every 20 weeks, once about every 3 to about every 20 weeks, once about every 4 to about every 20 weeks, once about every 5 to about every 20 weeks,once about every 6 to about every 20 weeks, once about every 7 to about every 20 weeks, once about every 8 to about every 20 weeks, once about every 9 to about every 20 weeks, once about every 10 to about every 20 weeks, once about every 11 to about every 20 weeks, once about every 12 to about every 20 weeks, once about every 13 to about every 20 weeks, once about every 14 to about every 20 weeks, once about every 15 to about every 20 weeks, once about every 16 to about every 20 weeks, once about every 17 to about every 20 weeks, once about every 18 to about every 20 weeks, once about every 19 to about every 20 weeks, once about every 1 to about every 18 weeks, once about every 2 to about every 18 weeks, once about every 3 to about every 18 weeks, once about every 4 to about every 18 weeks, once about every 5 to about every 18 weeks, once about every 6 to about every 18 weeks, once about every 7 to about every 18 weeks, once about every 8 to about every 18 weeks, once about every 9 to about every 18 weeks, once about every 10 to about every 18 weeks, once about every 11 to about every 18 weeks, once about every 12 to about every 18 weeks, once about every 13 to about every 18 weeks, once about every 14 to about every 18 weeks, once about every 15 to about every 18 weeks, once about every 16 to about every 18 weeks, once about every 17 to about every 18 weeks, once about every 1 to about every 16 weeks, once about every 2 to about every 16 weeks, once about every 3 to about every 16 weeks, once about every 4 to about every 16 weeks, once about every 5 to about every 16 weeks, once about every 6 to about every 16 weeks, once about every 7 to about every 16 weeks, once about every 8 to about every 16 weeks, once about every 9 to about every 16 weeks, once about every 10 to about every 16 weeks, once about every 11 to about every 16 weeks, once about every 12 to about every 16 weeks, once about every 13 to about every 16 weeks, once about every 14 to about every 16 weeks, once about every 15 to about every 16 weeks, once about every 1 to about every 14 weeks, once about every 2 to about every 14 weeks, once about every 3 to about every 14 weeks, once about every 4 to about every 14 weeks, once about every 5 to about every 14 weeks, once about every 6 to about every 14 weeks, once about every 7 to about every 14 weeks, once about every 8 to about every 14 weeks, once about every 9 to about every 14 weeks, once about every 10 to about every 14 weeks, once about every 11 to about every 14 weeks, once about every 12 to about every 14 weeks, once about every 13 to about every 14 weeks, once about every 1 to about every 12 weeks, once about every 2 to about every 12 weeks, once about every 3 to about every 12 weeks, once about every 4 to about every 12 weeks, once about every 5 to about every 12 weeks, once about every 6 to about every 12 weeks, once about every 7 to about every 12 weeks,once about every 8 to about every 12 weeks, once about every 9 to about every 12 weeks, once about every 10 to about every 12 weeks, once about every 11 to about every 12 weeks, once about every 1 to about every 10 weeks, once about every 2 to about every 10 weeks, once about every 3 to about every 10 weeks, once about every 4 to about every 10 weeks, once about every 5 to about every 10 weeks, once about every 6 to about every 10 weeks, once about every 7 to about every 10 weeks, once about every 8 to about every 10 weeks, once about every 9 to about every 10 weeks, once about every 1 to about every 8 weeks, once about every 2 to about every 8 weeks, once about every 3 to about every 8 weeks, once about every 4 to about every 8 weeks, once about every 5 to about every 8 weeks, once about every 6 to about every 8 weeks, once about every 7 to about every 8 weeks, once about every 1 to about every 6 weeks, once about every 2 to about every 6 weeks, once about every 3 to about every 6 weeks, once about every 4 to about every 6 weeks, once about every 5 to about every 6 weeks, once about every 1 to about every 4 weeks, once about every 2 to about every 4 weeks, once about every 3 to about every 4 weeks, or once about every 1 to about every 2 weeks.
[0216] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses once about every 28 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses once about every 26 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigenbinding fragment thereof, is administered to a subject in need thereof in one or more doses once about every 24 weeks.
[0217] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg, about 30 mg, about 100 mg, about 300 mg, about 600 mg, or about 1200 mg, once about every 28 weeks, about every 26 weeks, or about every 24 weeks.
[0218] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg, about30 mg, about 100 mg, about 300 mg, about 600 mg, or about 1200 mg, once about every 6 months.
[0219] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg, about 30 mg, about 100 mg, about 300 mg, about 600 mg, or about 1200 mg, once about every 28 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg, about 30 mg, about 100 mg, about 300 mg, about 600 mg, or about 1200 mg, once about every 26 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg, about 30 mg, about 100 mg, about 300 mg, about 600 mg, or about 1200 mg, once about every 24 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg, about 30 mg, about 100 mg, about 300 mg, about 600 mg, or about 1200 mg, once about every 6 months.
[0220] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg once about every 28 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg once about every 26 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg once about every 24 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 10 mg once about every 6 months.
[0221] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 30 mg once about every 28 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 30 mg once about every 26 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 30 mg once about every 24 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 30 mg once about every 6 months.
[0222] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 100 mg once about every 28 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 100 mg once about every 26 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 100 mg once about every 24 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 100 mg once about every 6 months.
[0223] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 300 mg once about every 28 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 300 mg once about every 26 weeks. In some embodiments, an antibody of the presentdisclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 300 mg once about every 24 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 300 mg once about every 6 months.
[0224] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 600 mg once about every 28 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 600 mg once about every 26 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 600 mg once about every 24 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 600 mg once about every 6 months.
[0225] In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 1200 mg once about every 28 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 1200 mg once about every 26 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 1200 mg once about every 24 weeks. In some embodiments, an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, is administered to a subject in need thereof in one or more doses (e.g., subcutaneous dose) of about 1200 mg once about every 6 months.
[0226] In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 10 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 20 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 30 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 40 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 50 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 60 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 70 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 80 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 90 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 100 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 200 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 300 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 400 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 500 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 600 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 700 mg. In some embodiments, an antibody described herein, or antigen-binding fragmentthereof, is administered to a subject in need thereof as a single subcutaneous dose of about 800 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 900 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 1000 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 1100 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 1200 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 1300 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 1400 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as a single subcutaneous dose of about 1500 mg.
[0227] In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 10 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 20 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 30 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 40 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 50 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 60 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 70 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 80 mg. In some embodiments, an antibody described herein, or antigen-binding fragmentthereof, is administered to a subject in need thereof as two subcutaneous doses of about 90 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 100 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 200 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 300 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 400 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 500 mg. In some embodiments, an antibody described herein, or antigen-binding fragment thereof, is administered to a subject in need thereof as two subcutaneous doses of about 600 mg.
[0228] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 26 weeks. In some embodiments, thepresent disclosure provides administration of an antibody of the present disclosure (e.g., AB- 25 with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 10 mg once every about 6 months.
[0229] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a singlesubcutaneous dose of about 30 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 30 mg once every about 6 months.
[0230] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once everyabout 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 100 mg once every about 6 months.
[0231] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a singlesubcutaneous dose of about 300 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 300 mg once every about 6 months.
[0232] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once everyabout 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 600 mg once every about 6 months.
[0233] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single subcutaneous dose of about 1200 mg once every about 6 months.
[0234] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two subcutaneous doses of about 10 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 16 weeks. In someembodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 10 mg once every about 6 months.
[0235] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 4 weeks. In some embodiments, the presentdisclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two subcutaneous doses of about 30 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mgonce every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 30 mg once every about 6 months.
[0236] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two subcutaneous doses of about 100 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 40 weeks. In someembodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 100 mg once every about 6 months.
[0237] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two subcutaneous doses of about 300 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 28 weeks. In some embodiments, the present disclosure providesadministration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 300 mg once every about 6 months.
[0238] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two subcutaneous doses of about 600 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 600mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 600 mg once every about 6 months.
[0239] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 12 weeks. In some embodiments, the present disclosureprovides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two subcutaneous doses of about 1200 mg once every about 6 months.
[0240] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, orantigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 10 mg once every about 6 months.
[0241] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a singleintravenous dose of about 30 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 30 mg once every about 6 months.
[0242] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 26 weeks. In some embodiments, thepresent disclosure provides administration of an antibody of the present disclosure (e.g., AB- 25 with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 100 mg once every about 6 months.
[0243] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a singleintravenous dose of about 300 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 300 mg once every about 6 months.
[0244] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once everyabout 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 600 mg once every about 6 months.
[0245] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a singleintravenous dose of about 1200 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB- 2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as a single intravenous dose of about 1200 mg once every about 6 months.
[0246] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two intravenous doses of about 10 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 32 weeks. In some embodiments,the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two intravenous doses of about 10 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 10 mg once every about 6 months.
[0247] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two intravenous doses of about 30 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 30 mg- I l l -once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two intravenous doses of about 30 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 30 mg once every about 6 months.
[0248] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two intravenous doses of about 100 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 100 mgonce every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two intravenous doses of about 100 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 100 mg once every about 6 months.
[0249] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two intravenous doses of about 300 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibodyof the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 36 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 40 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two intravenous doses of about 300 mg once every about 44 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 48 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 52 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 300 mg once every about 6 months.
[0250] In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 600 mg once every about 4 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigenbinding fragment thereof, as two intravenous doses of about 600 mg once every about 8 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 600 mg once every about 12 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 600 mg once every about 16 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 600 mg once every about 20 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 600 mg once every about 24 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 600 mg once every about 26 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure (e.g., AB-2b with or without Fc YTE substitutions), or antigen-binding fragment thereof, as two intravenous doses of about 600 mg once every about 28 weeks. In some embodiments, the present disclosure provides administration of an antibody of the present disclosure, or antigen-binding fragment thereof, as two intravenous doses of about 600 mg once every about 32 weeks. In some embodiments, the present disclosure provides administration of an antibody of ...
Claims
CLAIMSWhat is claimed is:
1. A method of treating an inflammatory pulmonary disease in a subject, comprising: administering to the subject a therapeutically effective dose of about 10 mg to about 1500 mg of an antibody, or antigen-binding fragment thereof, that binds to thymic stromal lymphopoietin (TSLP) at an interval of about every 3 months to about every 12 months, wherein the antibody, or antigen-binding fragment thereof, comprises, a) a heavy chain complementarity determining region (HCDR)1 comprising the amino acid sequence of SEQ ID NO:31, a HCDR2 comprising the amino acid sequence of SEQ ID NO:35, and a HCDR3 comprising the amino acid sequence of SEQ ID NO:50, b) a light chain complementarity determining region (LCDR)l comprising the amino acid sequence of SEQ ID NO:60, a LCDR2 comprising the amino acid sequence of DDS, and a LCDR3 comprising the amino acid sequence of SEQ ID N0:71.
2. The method of claim 1, wherein the effective dose is about 150 mg to about 1500 mg.
3. The method of claim 1 or 2, wherein the effective dose is about 200 mg to about 1400 mg.
4. The method of any one of claims 1 to 3, wherein the effective dose is about 250 mg to about 1300 mg.
5. The method of any one of claims 1 to 4, wherein the effective dose is about 300 mg to about 1200 mg.
6. The method of any one of claims 1 to 5, wherein the effective dose is about 300 mg.
7. The method of any one of claims 1 to 5, wherein the effective dose is about 600 mg.
8. The method of any one of claims 1 to 5, wherein the effective dose is about 1200 mg.
9. The method of any one of claims 1 to 8, wherein the effective dose is administered about every 3 months.
10. The method of any one of claims 1 to 8, wherein the effective dose is administered about every 4 months.
11. The method of any one of claims 1 to 8, wherein the effective dose is administered about every 6 months.
12. The method of any one of claims 1 to 8, wherein the effective dose is administered about every 9 months.
13. The method of any one of claims 1 to 8, wherein the effective dose is administered about every 12 months.
14. The method of any one of claims 1 to 8, wherein the effective dose is administered about every 24 weeks.
15. The method of any one of claims 1 to 8, wherein the effective dose is administered about every 26 weeks.
16. The method of any one of claims 1 to 8, wherein the effective dose is administered about every 28 weeks.
17. The method of any one of claims 1 to 16, wherein the effective dose is administered subcutaneously, intravenously, intramuscularly, or intraperitoneally.
18. The method of claim 17, wherein the effective dose is administered subcutaneously.
19. The method of any one of claims 1-18, wherein the effective dose is administered as a single 10 mg dose subcutaneously.
20. The method of any one of claims 1-18, wherein the effective dose is administered as a single 30 mg dose subcutaneously.
21. The method of any one of claims 1-18, wherein the effective dose is administered as a single 100 mg dose subcutaneously.
22. The method of any one of claims 1-18, wherein the effective dose is administered as a single 300 mg dose subcutaneously.
23. The method of any one of claims 1-18, wherein the effective dose is administered as a single 600 mg dose subcutaneously.
24. The method of any one of claims 1-18, wherein the effective dose is administered as a single 1200 mg dose subcutaneously.
25. The method of any one of claims 1-18, wherein the effective dose is administered as two 100 mg doses subcutaneously.
26. The method of any one of claims 1-18, wherein the effective dose is administered as two 300 mg doses subcutaneously.
27. The method of any one of claims 1-18, wherein the effective dose is administered as two 600 mg doses subcutaneously.
28. The method of any one of claims 1-18, wherein the effective dose is administered as two 1200 mg doses subcutaneously.
29. The method of any one of claims 1 to 28, wherein the inflammatory pulmonary disease is chronic.
30. The method of any one of claims 1 to 29, wherein the inflammatory pulmonary disease comprises asthma.
31. The method of any one of claims 1 to 30, wherein the inflammatory pulmonary disease comprises severe asthma.
32. The method of any one of claims 1 to 30, wherein the inflammatory pulmonary disease comprises eosinophilic or non-eosinophilic asthma.
33. The method of any one of claims 1 to 30, wherein the inflammatory pulmonary disease comprises low eosinophil asthma.
34. The method of any one of claims 1 to 33, wherein the subject is human.
35. The method of any one of claims 1 to 34, wherein the subject is an adult.
36. The method of any one of claims 1 to 35, wherein administering the effective dose decreases the level of eosinophils in a blood, sputum, and / or bronchoalveolar fluid sample from the subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering.
37. The method of any one of claims 1 to 36, wherein administering the effective dose decreases the level of leukocytes in a blood, sputum, and / or bronchoalveolar fluid sample from the subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering.
38. The method of any one of claims 1 to 37, wherein administering the effective dose increases the ratio of TH21OWT cells to Tn2hlghT cells in a blood, sputum, and / or bronchoalveolar fluid sample from the subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering.
39. The method of any one of claims 1 to 38, wherein administering the effective dose decreases the level of one or more TH2 cytokines in a blood, sputum, and / or bronchoalveolar fluid sample from the subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering.
40. The method of claim 39, wherein the one or more TH2 cytokines comprise IL-4, IL- 13, IL-5, or a combination thereof.
41. The method of any one of claims 1 to 40, wherein administering the effective dose decreases the level of IgE in a blood and / or bronchoalveolar fluid sample from the subject as compared to a blood and / or bronchoalveolar fluid sample collected from the subject prior to administering.
42. The method of any one of claims 1 to 41, wherein administering the effective dose decreases the level of one or more chemokines in a blood, sputum, and / or bronchoalveolar fluid sample from the subject as compared to a blood, sputum, and / or bronchoalveolar fluid sample collected from the subject prior to administering.
43. The method of claim 42, wherein the one or more chemokines comprise CCL17, CCL22, CXCL8, CCL1, CCL24, or a combination thereof.
44. The method of any one of claims 1 to 43, wherein administering the effective dose to the subject achieves a serum half-life of the antibody, or antigen-binding fragment thereof, in the subject of about 50 to about 150 days.
45. The method of claim 44, wherein the serum half-life of the antibody, or antigenbinding fragment thereof, in the subject is about 100 days.
46. The method of any one of claims 1 to 45, wherein administering the effective dose to the subject achieves a maximum serum concentration (Cmax) of the antibody, or antigen-binding fragment thereof, in the subject of about 1 qg / ml to about 250 pg / ml.
47. The method of any one of claims 1 to 46, wherein administering the effective dose to the subject achieves a serum AUCo-7d value of the antibody, or antigen-binding fragment thereof, in the subject of about 10 pg-day / ml to about 1500 pg-day / ml.
48. The method of any one of claims 1 to 47, wherein administering the effective dose improves forced expiratory volume (FEV), FEVi reversibility, forced vital capacity (FVC), FeNO, Asthma Control Questionnaire-6 score, AQLQ(S)+12 score, or combination thereof.
49. The method of any one of claims 1 to 48, wherein the antibody, or antigen-binding fragment thereof comprises: a) a VH comprising an amino acid sequence of SEQ ID NO:5; and b) a VL comprising an amino acid sequence of SEQ ID NO:21.
50. The method of any one of claims 1 to 49, wherein the antibody is a human IgGl isotype antibody.
51. The method any one of claims 1 to 50, wherein the antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO: 92; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
52. The method any one of claims 1 to 50, wherein the antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO: 106; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
53. A method of treating an inflammatory pulmonary disease in a human patient, comprising administering to the patient a therapeutically effective dose of about 10 mg to about 1200 mg of an antibody at an interval of about every 24 weeks to about every 28 weeks, wherein the antibody comprises: a) a HC comprising an amino acid sequence of SEQ ID NO: 92; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
54. The method of claim 53, comprising administering to the human patient: a) about 10 mg of the antibody at an interval of about every 24 weeks; b) about 10 mg of the antibody at an interval of about every 26 weeks; c) about 10 mg of the antibody at an interval of about every 6 months; d) about 10 mg of the antibody at an interval of about every 28 weeks; e) about 30 mg of the antibody at an interval of about every 24 weeks; f) about 30 mg of the antibody at an interval of about every 26 weeks; g) about 30 mg of the antibody at an interval of about every 6 months; h) about 30 mg of the antibody at an interval of about every 28 weeks; i) about 100 mg of the antibody at an interval of about every 24 weeks; j) about 100 mg of the antibody at an interval of about every 26 weeks; k) about 100 mg of the antibody at an interval of about every 6 months; l) about 100 mg of the antibody at an interval of about every 28 weeks; m) about 300 mg of the antibody at an interval of about every 24 weeks; n) about 300 mg of the antibody at an interval of about every 26 weeks; o) about 300 mg of the antibody at an interval of about every 6 months; p) about 300 mg of the antibody at an interval of about every 28 weeks; q) about 600 mg of the antibody at an interval of about every 24 weeks; r) about 600 mg of the antibody at an interval of about every 26 weeks; s) about 600 mg of the antibody at an interval of about every 6 months; t) about 600 mg of the antibody at an interval of about every 28 weeks; u) about 1200 mg of the antibody at an interval of about every 24 weeks; v) about 1200 mg of the antibody at an interval of about every 26 weeks; w) about 1200 mg of the antibody at an interval of about every 6 months; orx) about 1200 mg of the antibody at an interval of about every 28 weeks.
55. The method of claim 53 or 54, wherein the antibody is administered subcutaneously.
56. A method of treating an inflammatory pulmonary disease in a human patient, comprising: administering to the patient a therapeutically effective dose of about 10 mg to about 1200 mg of an antibody at an interval of about every 24 weeks to about every 28 weeks, wherein the antibody comprises, a) a HC comprising an amino acid sequence of SEQ ID NO: 106; and b) a LC comprising an amino acid sequence of SEQ ID NO: 120.
57. The method of claim 56, comprising administering to the human patient: a) about 10 mg of the antibody at an interval of about every 24 weeks; b) about 10 mg of the antibody at an interval of about every 26 weeks; c) about 10 mg of the antibody at an interval of about every 6 months; d) about 10 mg of the antibody at an interval of about every 28 weeks; e) about 30 mg of the antibody at an interval of about every 24 weeks; f) about 30 mg of the antibody at an interval of about every 26 weeks; g) about 30 mg of the antibody at an interval of about every 6 months; h) about 30 mg of the antibody at an interval of about every 28 weeks; i) about 100 mg of the antibody at an interval of about every 24 weeks; j) about 100 mg of the antibody at an interval of about every 26 weeks; k) about 100 mg of the antibody at an interval of about every 6 months; l) about 100 mg of the antibody at an interval of about every 28 weeks; m) about 300 mg of the antibody at an interval of about every 24 weeks; n) about 300 mg of the antibody at an interval of about every 26 weeks; o) about 300 mg of the antibody at an interval of about every 6 months; p) about 300 mg of the antibody at an interval of about every 28 weeks; q) about 600 mg of the antibody at an interval of about every 24 weeks; r) about 600 mg of the antibody at an interval of about every 26 weeks; s) about 600 mg of the antibody at an interval of about every 6 months; t) about 600 mg of the antibody at an interval of about every 28 weeks;u) about 1200 mg of the antibody at an interval of about every 24 weeks; v) about 1200 mg of the antibody at an interval of about every 26 weeks; w) about 1200 mg of the antibody at an interval of about every 6 months; or x) about 1200 mg of the antibody at an interval of about every 28 weeks.
58. The method of claim 56 or 57, wherein the antibody is administered subcutaneously.
59. The method of any one of claims 1-58, wherein the inflammatory pulmonary disease comprises chronic obstructive pulmonary disease (COPD).
60. The method of any one of claims 1-58, wherein the inflammatory pulmonary disease comprises moderate to severe COPD.
Citation Information
Patent Citations
Antigen Binding Molecules Targeting Thymic Stromal Lymphopoietin (TSLP)
US20240034780A1
Treatment of asthma with Anti-TSLP antibody
WO2018191479A1
Antigen binding molecules targeting thymic stromal lymphopoietin (TSLP)
WO2024020590A2
Antigen binding molecules targeting thymic stromal lymphopoietin (TSLP)
WO2024020591A2