Type v CAS proteins and applications thereof

Type V Cas proteins from unclassified bacteria address limitations in CRISPR-Cas9 systems by offering improved genome editing precision and efficiency through specific amino acid sequences and domain compositions, enhancing target recognition and DNA cut profiles.

WO2025210147A1PCT designated stage Publication Date: 2025-10-09ALIA THERAPEUTICS SRL
View PDF 139 Cites 0 Cited by

Patent Information

Application Number
PCT/EP2025/059128
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-04-04
Filing Date
2025-04-03
Publication Date
2025-10-09

AI Technical Summary

Technical Problem

Existing CRISPR-Cas9 systems face challenges such as limited packaging capacity in AAV vectors for large Cas proteins, target sequence specificity, and inconsistent DNA cut types, which affect genome editing efficiency and precision.

Method used

Development of Type V Cas proteins from various unclassified bacteria, including ZWGD, ZJHK, and others, with specific amino acid sequences and domain compositions, enabling efficient genome editing with improved target recognition and DNA cut profiles.

Benefits of technology

The Type V Cas proteins provide enhanced genome editing capabilities, including staggered cuts and mid-sized deletions, facilitating precise gene modifications and multiplexing, while overcoming packaging limitations and sequence specificity issues.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure EP2025059128_09102025_PF_FP_ABST
    Figure EP2025059128_09102025_PF_FP_ABST
Patent Text Reader

Abstract

Type V Cas proteins, for example Type V Cas proteins referred to as ZWGD, ZJHK, ZIKV, ZZFT, YYAN, ZZGY, ZKBG, ZZKD, ZXPB, ZPPX, ZXHQ, ZQKH, ZRGM, ZTAE, ZSQQ, ZSYN, ZRBH, ZWPU, ZZQE, and ZRXE Type V Cas proteins; gRNAs for Type V Cas proteins; systems comprising Type V Cas proteins and gRNAs; nucleic acids encoding the Type V Cas proteins, gRNAs and systems; particles comprising the foregoing; pharmaceutical compositions of the foregoing; and uses of the foregoing, for example to alter the genomic DNA of a cell.
Need to check novelty before this filing date? Find Prior Art

Description

TYPE V CAS PROTEINS AND APPLICATIONS THEREOF1. CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application claims the priority benefit of U.S. provisional application no. 63 / 574,354, filed April 4, 2024, the contents of which are incorporated herein in their entireties by reference thereto.2. SEQUENCE LISTING

[0002] The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety. Said XML Sequence Listing, created on March 25, 2025, is named ALA-013WO_SL.xml and is 679,601 bytes in size.3. BACKGROUND

[0003] CRISPR-Cas systems (Clustered Regularly Interspaced Short Palindromic Repeats-CRISPR associated proteins) are powerful tools with the potential to treat a variety of genetic diseases. The CRISPR-Cas systems are classified into two classes (Class 1 and 2) that are subdivided into six types (Type 1 through VI). Class 1 (Type I, III and IV) systems use multiple Cas proteins in their CRISPR ribonucleoprotein effector nucleases, and Class 2 systems (Type II, V and VI) use a single Cas protein. Cas9, belonging to Class 2 Type II CRISPR-Cas system, is the most extensively used tool for genome editing.

[0004] However, there are some challenges in using CRISPR-Cas9 systems. For example, packaging a large Cas protein such as SpCas9 together with a guide RNA into a single AAV vector (Adeno- associated viral vectors) can be challenging due to the limited packaging capacity of AAVs. Type V Cas proteins such as Cas12a target T-rich sequences, which in principle allow Type V Cas proteins to access different genomic regions as compared to Cas9. Type V Cas proteins typically produce staggered ends when it creates a double stranded DNA cut (while Cas9 creates a blund end), which may be an advantage in certain situations such as during gene insersions and substitutions. Type V Cas proteins also typically produce mid sized deletions at the target site (generally tens of nucleotides) allowing for the removal of target sequences locally (e.g. binding sites for transcription factors, splice sites, etc). In comparason, Cas9 produces relatively small indels (generally insertion or deletion of a few nucleotides). Type V Cas proteins such as Cas12a are typically capable of processing their own crRNA from larger transcripts, which can make multiplexing easier.

[0005] Thus, there is a need for new Cas nucleases, especially Type V Cas nucleases.4. SUMMARY

[0006] This disclosure is based, in part, on the discovery of a Type V Cas protein from an unclassified bacterium from the Candidatus Saccharibacteria phylum (referred to herein as “wildtype ZWGD type V Cas”); a Type V Cas protein from an unclassified bacterium from the Clostridiaceae family (referred to herein as “wildtype ZJHK type V Cas”); a Type V Cas protein from an unclassified bacterium from the Firmucutes phylum (referred to herein as “wildtype ZIKV type V Cas”); a Type V Cas protein from an unclassified bacterium from the Bacteroidota phylum (referred to herein as “wildtype ZZFT type V Cas”); a Type V Cas protein from an unclassified bacterium from the Firmicutes phylum (referred to herein as“wildtype YYAN type V Cas”); a Type V Cas protein from an unclassified bacterium from the Succinivibrionaceae family (referred to herein as “wildtype ZZGY type V Cas”); a Type V Cas protein from an unclassified bacterium from the Muribaculaceae family (referred to herein as “wildtype ZKBG type V Cas”); a Type V Cas protein from Mogibacterium kristiansenii (referred to herein as “wildtype ZZKD type V Cas”); a Type V Cas protein from an unclassified bacterium from the Bacteroidales order (referred to herein as “wildtype ZXPB type V Cas”); a Type V Cas protein from an unclassified bacterium from the Prevotellaceae family (referred to herein as “wildtype ZPPX type V Cas”); a Type V Cas protein from an unclassified bacterium from the phylum Candidatus Roizmanbacteria (referred to herein as “wildtype ZXHQ type V Cas”); a Type V Cas protein from an unclassified bacterium from the phylum Bacteroidota (referred to herein as “wildtype ZQKH type V Cas”); a Type V Cas protein from an unclassified bacterium from the phylum Firmicutes (referred to herein as “wildtype ZRGM type V Cas”); a Type V Cas protein from an unclassified bacterium from the phylum Kiritimatiellaeota (referred to herein as “wildtype ZTAE type V Cas”); a Type V Cas protein from an unclassified bacterium from the phylum Fibrobacteres (referred to herein as “wildtype ZSQQ type V Cas”); a Type V Cas protein from an unclassified bacterium from the phylum Firmicutes (referred to herein as “wildtype ZSYN type V Cas”); a Type V Cas protein from an unclassified bacterium from the phylum Firmicutes (referred to herein as “wildtype ZRBH type V Cas”); a Type V Cas protein from an unclassified bacterium from the phylum Bacteroidota (referred to herein as “wildtype ZWPU type V Cas”); a Type V Cas protein from an unclassified bacterium from the Prevotellaceae family (referred to herein as “wildtype ZZQE type V Cas”); and a Type V Cas protein from an unclassified bacterium from the phylum Bacteroidota (referred to herein as “wildtype ZRXE type V Cas”).

[0007] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:1 (such proteins referred to herein as “ZWGD Type V Cas proteins”). Exemplary ZWGD Type V Cas protein sequences are set forth in SEQ ID NO:1 , SEQ ID NO:2, and SEQ ID NO:3.

[0008] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:7 (such proteins referred to herein as “ZJHK Type V Cas proteins”). Exemplary ZJHK Type V Cas protein sequences are set forth in SEQ ID NOT, SEQ ID NO:8, and SEQ ID NO:9.

[0009] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:13 (such proteins referred to herein as “ZIKV Type V Cas proteins”). Exemplary ZIKV Type V Cas protein sequences are set forth in SEQ ID NO:13, SEQ ID NO:14, and SEQ ID NO:15.

[0010] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:19 (such proteins referred to herein as “ZZFT Type V Cas proteins”). Exemplary ZZFT Type V Cas protein sequences are set forth in SEQ ID NO:19, SEQ ID NQ:20, and SEQ ID NO:21.

[0011] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:25 (such proteins referred to herein as “YYAN Type V Cas proteins”). Exemplary YYAN Type V Cas protein sequences are set forth in SEQ ID NO:25, SEQ ID NO:26, and SEQ ID NO:27.

[0012] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:31 (such proteins referred to herein as “ZZGY Type V Cas proteins”). Exemplary ZZGY Type V Cas protein sequences are set forth in SEQ ID NO:31 , SEQ ID NO:32, and SEQ ID NO:33.

[0013] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:37 (such proteins referred to herein as “ZKBG Type V Cas proteins”). Exemplary ZKBG Type V Cas protein sequences are set forth in SEQ ID NO:37, SEQ ID NO:38, and SEQ ID NO:39.

[0014] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:43 (such proteins referred to herein as “ZZKD Type V Cas proteins”). Exemplary ZZKD Type V Cas protein sequences are set forth in SEQ ID NO:43, SEQ ID NO:44, and SEQ ID NO:45.

[0015] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:49 (such proteins referred to herein as “ZXPB Type V Cas proteins”). Exemplary ZXPB Type V Cas protein sequences are set forth in SEQ ID NO:49, SEQ ID NQ:50, and SEQ ID NO:51.

[0016] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%identical, or 100% identical ) to SEQ ID NO:55 (such proteins referred to herein as “ZPPX Type V Cas proteins”). Exemplary ZPPX Type V Cas protein sequences are set forth in SEQ ID NO:55, SEQ ID NO:56, and SEQ ID NO:57.

[0017] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:61 (such proteins referred to herein as “ZXHQ Type V Cas proteins”). Exemplary ZXHQ Type V Cas protein sequences are set forth in SEQ ID NO:61 , SEQ ID NO:62, and SEQ ID NO:63.

[0018] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:67 (such proteins referred to herein as “ZQKH Type V Cas proteins”). Exemplary ZQKH Type V Cas protein sequences are set forth in SEQ ID NO:67, SEQ ID NO:68, and SEQ ID NO:69.

[0019] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:73 (such proteins referred to herein as “ZRGM Type V Cas proteins”). Exemplary ZRGM Type V Cas protein sequences are set forth in SEQ ID NO:73, SEQ ID NO:74, and SEQ ID NO:75.

[0020] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:79 (such proteins referred to herein as “ZTAE Type V Cas proteins”). Exemplary ZTAE Type V Cas protein sequences are set forth in SEQ ID NO:79, SEQ ID NQ:80, and SEQ ID NO:81.

[0021] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:85 (such proteins referred to herein as “ZSQQ Type V Cas proteins”). Exemplary ZSQQ Type V Cas protein sequences are set forth in SEQ ID NO:85, SEQ ID NO:86, and SEQ ID NO:87.

[0022] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:91 (such proteins referred to herein as “ZSYN Type V Cas proteins”). Exemplary ZSYN Type V Cas protein sequences are set forth in SEQ ID NO:91 , SEQ ID NO:92, and SEQ ID NO:93.

[0023] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:97 (such proteins referred to herein as “ZRBH Type V Cas proteins”). Exemplary ZRBH Type V Cas protein sequences are set forth in SEQ ID NO:97, SEQ ID NO:98, and SEQ ID NO:99.

[0024] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NQ:103 (such proteins referred to herein as “ZWPU Type V Cas proteins”). Exemplary ZWPU Type V Cas protein sequences are set forth in SEQ ID NQ:103, SEQ ID NQ:104, and SEQ ID NQ:105.

[0025] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NQ:109 (such proteins referred to herein as “ZZQE Type V Cas proteins”). Exemplary ZZQE Type V Cas protein sequences are set forth in SEQ ID NQ:109, SEQ ID NQ:110, and SEQ ID NO:111.

[0026] In one aspect, the disclosure provides Type V Cas proteins whose amino acid sequence comprises an amino acid sequence that is at least 50% identical (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical, or 100% identical ) to SEQ ID NO:115 (such proteins referred to herein as “ZRXE Type V Cas proteins”). Exemplary ZRXE Type V Cas protein sequences are set forth in SEQ ID NO:115, SEQ ID NO:116, and SEQ ID NO:117.

[0027] In another aspect, the disclosure provides Type V Cas proteins comprising an amino acid sequence having at least 50% (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%) sequence identity to a WED-1 domain, REC1 domain, REC2 domain, WED-II domain, PI domain, WED-HI domain, RuvC-l domain, BH domain, RuvC-ll domain, NUC domain, or RuvC-lll domain of a ZWGD Type V Cas protein, a ZJHK Type V Cas protein, a ZIKV Type V Cas protein, a ZZFT Type V Cas protein, a YYAN Type V Cas protein, a ZZGY Type V Cas protein, a ZKBG Type V Cas protein, a ZZKD Type V Cas protein, a ZXPB Type V Cas protein, a ZPPX Type V Cas protein, a ZXHQ Type V Cas protein, a ZQKH Type V Cas protein, a ZRGM Type V Cas protein, a ZTAE Type V Cas protein, a ZSQQ Type V Cas protein, a ZSYN Type V Cas protein, a ZRBH Type V Cas protein, a ZWPU Type V Cas protein, a ZZQE Type V Cas protein, or a ZRXE Type V Cas protein.

[0028] In some embodiments, a Type V Cas protein of the disclosure is a chimeric Type V Cas protein, for example, comprising one or more domains from a ZWGD, ZJHK, ZIKV, ZZFT, YYAN, ZZGY, ZKBG, ZZKD, ZXPB, ZPPX, ZXHQ, ZQKH, ZRGM, ZTAE, ZSQQ, ZSYN, ZRBH, ZWPU, ZZQE, and / or ZRXE Type V Cas protein(s) and one or more domains from a different Type V Cas protein such as AsCas12a.

[0029] In some embodiments, the Type V Cas proteins of the disclosure are in the form of a fusion protein, for example, comprising a ZWGD Type V Cas protein, a ZJHK Type V Cas protein, a ZIKV TypeV Cas protein, a ZZFT Type V Cas protein, a YYAN Type V Cas protein, a ZZGY Type V Cas protein, a ZKBG Type V Cas protein, a ZZKD Type V Cas protein, a ZXPB Type V Cas protein, a ZPPX Type V Cas protein, a ZXHQ Type V Cas protein, a ZQKH Type V Cas protein, a ZRGM Type V Cas protein, a ZTAE Type V Cas protein, a ZSQQ Type V Cas protein, a ZSYN Type V Cas protein, a ZRBH Type V Cas protein, a ZWPU Type V Cas protein, a ZZQE Type V Cas protein, or a ZRXE Type V Cas protein sequence fused to one or more additional amino acid sequences, for example, one or more nuclear localization signals and / or one or more tags. Other exemplary fusion partners can enable base editing (e.g., where the fusion partner is nucleoside deaminase) or prime editing (e.g., where the fusion partner is a reverse transcriptase).

[0030] Exemplary features of Type V Cas proteins of the disclosure are described in Section 6.2 and specific embodiments 1 to 329 and 660 to 671 , infra.

[0031] In further aspects, the disclosure provides guide (gRNA) molecules and combinations of two or more gRNA molecules. In various embodiments, the disclosure provides gRNAs that can be used with a ZWGD, ZJHK, ZIKV, ZZFT, YYAN, ZZGY, ZKBG, ZZKD, ZXPB, ZPPX, ZXHQ, ZQKH, ZRGM, ZTAE, ZSQQ, ZSYN, ZRBH, ZWPU, ZZQE, or ZRXE Type V Cas protein of the disclosure. Exemplary features of the gRNAs and combinations of gRNAs of the disclosure of the disclosure are described in Section 6.3 and specific embodiments 330 to 578, infra.

[0032] In further aspects, the disclosure provides systems comprising a Type V Cas protein of the disclosure and one or more gRNAs. For example, a system can comprise a ribonucleoprotein (RNP) comprising a Type V Cas protein complexed with a gRNA. Exemplary features of systems are described in Section 6.4 and specific embodiments 579 to 594, infra.

[0033] In another aspect, the disclosure provides nucleic acids and pluralities of nucleic acids encoding a Type V Cas protein of the disclosure and, optionally, a gRNA. In some embodiments, the nucleic acids comprise a Type V Cas protein of the disclosure operably linked to a heterologous promoter, e.g., a mammalian promoter, for example a human promoter.

[0034] In another aspect, the disclosure provides nucleic acids encoding a gRNA, and, optionally, a Type V Cas protein, for example a ZWGD Type V Cas protein, a ZJHK Type V Cas protein, a ZIKV TypeV Cas protein, a ZZFT Type V Cas protein, a YYAN Type V Cas protein, a ZZGY Type V Cas protein, a ZKBG Type V Cas protein, a ZZKD Type V Cas protein, a ZXPB Type V Cas protein, a ZPPX Type V Cas protein, a ZXHQ Type V Cas protein, a ZQKH Type V Cas protein, a ZRGM Type V Cas protein, a ZTAE Type V Cas protein, a ZSQQ Type V Cas protein, a ZSYN Type V Cas protein, a ZRBH Type V Cas protein, a ZWPU Type V Cas protein, a ZZQE Type V Cas protein, or a ZRXE Type V Cas protein. Exemplary features of nucleic acids and pluralities of nucleic acids are described in Section 6.5 and specific embodiments 595 to 659, infra.

[0035] In further aspects, the disclosure provides particles comprising the Type V Cas proteins, gRNAs, nucleic acids, and systems of the disclosure. Exemplary features of particles of the disclosure are described in Section 6.6 and specific embodiments 672 to 687, infra.

[0036] In another aspect, the disclosure provides cells and populations of cells containing or contacted with a Type V Cas protein, gRNA, nucleic acid, plurality of nucleic acids, system, or particle of the disclosure. Exemplary features of such cells and cell populations are described in Section 6.6 and specific embodiments 689 to 699 and 737, infra.

[0037] In another aspect, the disclosure provides pharmaceutical compositions comprising a Type V Cas protein, gRNA, nucleic acid, plurality of nucleic acids, system, particle, cell, or population of cells together with one or more excipients. Exemplary features of pharmaceutical compositions are described in Section 6.7 and specific embodiment 688, infra.

[0038] In another aspect, the disclosure provides methods of altering cells (e.g., editing the genome of a cell) using the Type V Cas proteins, gRNAs, nucleic acids, systems, particles, and pharmaceutical compositions of the disclosure. Cells altered according to the methods of the disclosure can be used, for example, to treat subjects having a disease or disorder, e.g., genetic disease or disorder. Features of exemplary methods of altering cells are described in Section 6.8 and specific embodiments 700 to 736, infra.

[0039] In another aspect, the disclosure provides methods of detecting a target nucleic acid using the Type V Cas proteins, gRNAs, and systems of the disclosure, and use of the foregoing in such methods. Features of exemplary methods of detecting target nucleic acids, and Type V Cas proteins, gRNAs, and systems for use in methods of detecting a target nucleic acid are described in Section 6.9 and specific embodiments 738 to 740, infra.5. BRIEF DESCRIPTION OF THE FIGURES

[0040] FIGS. 1 A-1 E illustrate exemplary Type V-A Cas protein crRNAs (corresponding DNA sequences shown). Schematic representation of the hairpin structure generated for visualization using RNAplot after in silico folding using RNAalifold v2.4.17 of the crRNA scaffolds (not including the spacer sequence) for ZWGD Type V-A Cas protein (FIG. 1 A), ZJHK Type V-A Cas protein (FIG. 1 B), ZIKV Type V-A Cas protein (FIG. 1C), ZZFT Type V-A Cas protein (FIG. 1 D) and YYAN Type V-A Cas protein (FIG. 1 E) are shown. Figures disclose SEQ ID NOS 390-394, respectively, in order of appearance.

[0041] FIGS. 2A-2E illustrate exemplary Type V-A Cas protein crRNAs (corresponding DNA sequences shown). Schematic representation of the hairpin structure generated for visualization using RNAplot after in silico folding using RNAalifold v2.4.17 of the crRNA scaffolds (not including the spacer sequence) for ZZGY Type V-A Cas protein (FIG. 2A), ZKBG Type V-A Cas protein (FIG. 2B), ZZKD Type V-A Cas protein (FIG. 2C), ZXPB Type V-A Cas protein (FIG. 2D) or ZPPX Type V-A Cas protein (FIG. 2E). Figures disclose SEQ ID NOS 395-399, respectively, in order of appearance.

[0042] FIGS. 3A-3E illustrate in silico predicted PAM specificities for ZWGD, ZJHK, ZIKV, ZZFT and YYAN Type V-A Cas proteins. PAM sequence logos for ZWGD (FIG. 3A), ZJHK (FIG. 3B), ZIKV (FIG. 3C), ZZFT (FIG. 3D) and YYAN (FIG. 3E) Type V-A Cas proteins are shown.

[0043] FIGS. 4A-4E illustrate in silico predicted PAM specificities for ZZGY, ZKBG, ZZKD, ZXPB and ZPPX Type V-A Cas proteins. PAM sequence logos for ZZGY (FIG. 4A), ZKGB (FIG. 4B), ZZKD (FIG. 4C), ZXPB (FIG. 4D) and ZPPX (FIG. 4E) Type V-A Cas proteins are shown.

[0044] FIG. 5 illustrates activity of Type V-A Cas proteins against an EGFP reporter in mammalian cells. The activity of the selected Type V-A Cas proteins was evaluated after transient electroporation of plasmids encoding each nuclease together with the indicated guide RNAs in U2OS cells stably expressing EGFP. For each Cas protein, 2 different gRNAs targeting the same two positions of the EGFP coding sequence were evaluated. Loss of EGFP fluorescence, expressed as % of EGFP-negative cells, was measured by cytofluorimetry. Data presented as mean ± SEM of n>2 biologically independent runs. Untreated U2OS cells (U2OS sample) are included as a measurement of the background loss of fluorescence.

[0045] FIGS. 6A-6C illustrate activity of ZZKD Type V-A Cas protein against benchmark endogenous genomic loci in mammalian cells. The activity of ZZKD Type V-A Cas protein was evaluated after transient electroporation of plasmids encoding each nuclease together with the indicated guide RNAs in U2OS cells. Several gRNAs targeting the TRAC (FIG. 6A), B2M (FIG. 6B) and PD1 (FIG. 6C) benchmark loci were evaluated. Editing activity was measured by Sanger chromatogram deconvolution 3 days after transfection. Data presented as mean ± SEM of n>2 biologically independent runs.

[0046] FIGS. 7A-7E illustrate exemplary Type V-A Cas protein crRNAs (corresponding DNA sequences shown). Schematic representation of the hairpin structure generated for visualization using RNAplot after in silico folding using RNAalifold v2.4.17 of the crRNA scaffolds (not including the spacer sequence) for ZXHQ Type V-A Cas protein (Fig. 7A), ZQKH Type V-A Cas protein (Fig. 7B), ZRGM Type V-A Cas protein (Fig. 7C), ZTAE Type V-A Cas protein (Fig. 7D) and ZSQQ Type V-A Cas protein (FIG. 7E) are shown. Figures disclose SEQ ID NOS 400-404, respectively, in order of appearance.

[0047] FIGS. 8A-8E illustrate exemplary Type V-A Cas protein crRNAs (corresponding DNA sequences shown). Schematic representation of the hairpin structure generated for visualization using RNAplot after in silico folding using RNAalifold v2.4.17 of the crRNA scaffolds (not including the spacer sequence) for ZSYN Type V-A Cas protein (FIG. 8A), ZRBH Type V-A Cas protein (FIG. 8B), ZWPU Type V-A Cas protein (FIG. 8C), ZZQE Type V-A Cas protein (FIG. 8D) and ZRXE Type V-A Cas protein (FIG. 8E) are shown. Figures disclose SEQ ID NOS 405-409, respectively, in order of appearance.

[0048] FIG. 9 illustrates in silico prediction of ZZQE Type V-A Cas protein PAM specificity. PAM sequence logo for ZZQE Type V-A Cas protein is shown.

[0049] FIG. 10 shows activity of novel Type V-A Cas proteins in human cells. Evaluation of the activity of novel Type V-A Cas protein after transient electroporation in U2OS-EGFP cells. Two different guide RNAs were evaluated (target sequences are common for all proteins) and EGFP downregulation was measured by flow cytometry 5 days post-electroporation. A non-transfected control sample has been included to measure the assay background (NT Ctrl). 23nt spacers were used. Data represented as mean ± SD of n=2 independent biological replicates.

[0050] FIG. 11 shows activity of selected Type V-A Cas proteins towards endogenous genomic loci in human cells. The editing activity of ZZKD, ZRGM and ZZQE Type V-A Cas proteins was evaluated for the benchmark TRAC-g3, B2M-g2 and PD1-g2 genomic loci after transient transfection in HEK293T cells. Given the PAM compatibility among the different proteins the same spacers were used (23nt inlength). For ZZKD activity on the TRAC locus, data represented as mean ± SD of n=3 independent biological replicates.

[0051] FIGS. 12A-12C show in vitro analysis of PAM preferences of ZZKD Type V-A Cas protein. A PAM sequence logo is shown in FIG. 12A and PAM heatmap is shown in FIG. 12B for ZZKD Type V-A Cas protein FIG. 12C shows validation of the PAM preferences by measurement of indel formation after transient transfection of HEK293T cells using crRNAs associated with PAMs shown to be preferentially cut by the PAM assay. The PAM associated with each guide is reported on the graph. Data represented as mean ± SD of n>2 independent biological replicates.

[0052] FIGS. 13A-13D show analysis of PAM preferences of ZRGM and ZZQE Type V-A Cas proteins. A PAM sequence logo is shown in FIG. 13A and a PAM heatmap is shown in FIG. 13B for ZRGM Type V-A Cas protein. A PAM sequence logo is shown in FIG. 13C and a PAM heatmap is shown in FIG. 13D for ZZQE Type V-A Cas protein.

[0053] FIGS. 14A-14B illustrate in vitro determination of the double strand break profile of ZZKD Type V-A Cas protein. In vitro cleavage reactions using a PCR-generated target (TRAC-g3) and recombinant ZZKD Type V-A Cas protein were run on an agarose gel and the separated fragments were independently Sanger sequenced using a forward and a reverse primer to sequence both DNA strands. Based on the drop in the chromatographic signal in the two sequencing reactions (FIG. 14A) it was possible to determine that ZZKD type V-A Cas protein produces a 6 nucleotide staggered cut, as indicated by the solid lines in the scheme shown in FIG. 14B. Figure discloses SEQ ID NOS 410-411 , 410, and 412, respectively, in order of appearance.

[0054] FIG. 15 shows an evaluation of alternative nuclear localization signal (NLS) designs to improve the activity of ZZKD Type V-A Cas protein. FIG. 15 plots indel formation at the TRAC locus (g3) after transient transfection of HEK293T cells with alternative versions of ZZKD Type V-A Cas proteins characterized by different nuclear localization signal sequences positioned either at the N- or the C- terminus of the protein, as indicated on the graph. The amino acid sequence of each evaluated NLS is reported in the figure. Data represented as mean ± SD of n>2 independent biological replicates. Figure discloses SEQ ID NOS 179, 122, 180, and 125, respectively, in order of appearance.

[0055] FIGS. 16A-16C show alternative crRNA scaffolds for selected Type V-A Cas proteins. Schematic representation of the hairpin structure generated for visualization using the RNAfold webserver (www.unafold.org) of the crRNA trimmed scaffolds (not including the spacer sequence) for ZZKD Type V- A Cas protein (FIG. 16A) (SEQ ID NO:211), ZZQE Type V-A Cas protein (FIG. 16B) (SEQ ID NO:212) and ZRGM Type V-A Cas protein (FIG. 16C) (SEQ ID NO:213).

[0056] FIGS. 17A-17B show the activity of alternative crRNA scaffolds for selected Type V-A Cas proteins. FIG. 17A shows indel formation measured after transient transfection of HEK293T cells with alternative versions (full-length or trimmed) of the crRNAs targeting the TRAC-g3 locus for ZZKD, ZZQE and ZRGM Type V-A Cas proteins. FIG. 17B shows indel formation measured after transient transfection of HEK293T cells with alternative versions (full-length or trimmed) of ZZKD Type V-A Cas protein crRNAs targeting the BCL11A, TRAC, AAVS1 and B2M loci, as indicated on the graph. Data represented as mean ± SD of n=2 independent biological replicates.10057] FIGS. 18A-18B illustrate the effect of alternative spacer lengths on ZZKD Type V-A Cas protein editing activity. Indel formation in HEK293T cells after transient transfection of ZZKD Type V-A Cas protein in combination with families of crRNAs characterized by different spacer lengths (from 20nt to 24nt) targeting either the Match6 (FIG. 18A) or the TRAC locus (g3, FIG. 18B). Data represented as mean ± SD of n=2 independent biological replicates.

[0058] FIG. 19 shows a side-by-side comparison of ZZKD Type V-A Cas protein activity with AsCs12a Ultra. The figure shows a violin plot summarizing the editing activity of ZZKD Type V-A Cas protein and AsCas12a Ultra on a panel of endogenous genomic loci (TRAC, PD1 , B2M, EMX1 , AAVS1 , BCL11a, PCSK9, Match6, VEGFA) after transient transfection of HEK292T cells, using crRNAs for the two nucleases that overlap on each locus. Each point on the graph represents the mean of n=2 independent runs except for B2M-g1_21 nt for AsCasI 2a Ultra (n=1).

[0059] FIGS. 20A-20D show activity of ZZKD Type V-A Cas protein in subsaturating conditions. Titration curves obtained by measuring indel formation at the BCL11A-g4 (FIG. 20A), VEGFA-g1 (FIG. 20B), B2M-g1_21 nt (FIG. 20C) and B2M-g2_21 nt (FIG. 20D) target sites after a 2-fold serial dilution of the amount of ZZKD and crRNA plasmids transiently transfected in HEK293T cells. The activity of AsCasI 2a Ultra was measured in the same study conditions as a benchmark and is reported on each graph. Data represented as mean ± SD of n=2 independent biological replicates.

[0060] FIGS. 21A-21C show activity of ZZKD Type V-A Cas after direct ribonucleoprotein delivery in human cell lines. Indel formation after ZZKD Type V-A Cas RNP electroporation in U2OS cells to target either the TRAC-g3 locus (FIG. 21 A) or the B2M-g2 locus (FIG. 21 B). Cells were also transfected with plasmids expressing ZZKD and its crRNA as a positive control. IVT, in vitro transcribed crRNA; syn, unmodified chemically synthesized crRNA; AltR, chemically synthesized crRNA including commercially available AltR modifications from IDT. FIG. 21 C shows the results of a titration study in U2OS cells delivering different amounts of recombinant ZZKD and cognate crRNA targeting the B2M-g2 locus by electroporation. The amount (pmol) of recombinant protein and crRNA used in each condition is indicated below each bar. Data represented as mean ± SD of n>2 independent biological replicates, except for B2M-g2 IVT and panel (FIG. 21 C) where only one replicate is available.

[0061] FIG. 22 shows activity of ZZKD Type V-A Cas after direct ribonucleoprotein delivery in primary human T cells. The figure shows percentage of TRAC-negative cells measured by flow cytometry after ZZKD Type V-A Cas RNP electroporation in commercial human primary T cells to target the TRAC-g3 locus.6. DETAILED DESCRIPTION

[0062] In one aspect, the disclosure provides Type V Cas proteins, e.g., a ZWGD Type V Cas protein, a ZJHK Type V Cas protein, a ZIKV Type V Cas protein, a ZZFT Type V Cas protein, a YYAN Type V Cas protein, a ZZGY Type V Cas protein, a ZKBG Type V Cas protein, a ZZKD Type V Cas protein, a ZXPB Type V Cas protein, a ZPPX Type V Cas protein, a ZXHQ Type V Cas protein, a ZQKH Type V Cas protein, a ZRGM Type V Cas protein, a ZTAE Type V Cas protein, a ZSQQ Type V Cas protein, a ZSYN Type V Cas protein, a ZRBH Type V Cas protein, a ZWPU Type V Cas protein, a ZZQE Type V Cas protein, and a ZRXE Type V Cas protein. Type V Cas proteins of the disclosure can be in the form of-IQ-fusion proteins. Unless required otherwise by context, disclosures relating to Type V Cas proteins encompass Type V Cas proteins which are not fusion proteins and Type V Cas proteins which are in the form of fusion proteins (e.g., Type V Cas protein comprising one or more nuclear localization signals and / or one or more tags).

[0063] In some embodiments, a Type V Cas protein of the disclosure comprises an amino acid sequence having at least 50% (e.g., at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%) sequence identity to a WED-1 domain, REC1 domain, REC2 domain, WED-II domain, PI domain, WED-HI domain, RuvC-l domain, BH domain, RuvC-ll domain, NUC domain, or RuvC-lll domain of a ZWGD Type V Cas protein, a ZJHK Type V Cas protein, a ZIKV Type V Cas protein, a ZZFT Type V Cas protein, a YYAN Type V Cas protein, a ZZGY Type V Cas protein, a ZKBG Type V Cas protein, a ZZKD Type V Cas protein, a ZXPB Type V Cas protein, a ZPPX Type V Cas protein, a ZXHQ Type V Cas protein, a ZQKH Type V Cas protein, a ZRGM Type V Cas protein, a ZTAE Type V Cas protein, a ZSQQ Type V Cas protein, a ZSYN Type V Cas protein, a ZRBH Type V Cas protein, a ZWPU Type V Cas protein, a ZZQE Type V Cas protein, or a ZRXE Type V Cas protein.

[0064] In some embodiments, a Type V Cas protein of the disclosure is a chimeric Type V Cas protein, for example, comprising one or more domains from a ZWGD Type V Cas protein and / or a ZJHK Type V Cas protein and / or a ZIKV Type V Cas protein and / or a ZZFT Type V Cas protein and / or a YYAN Type V Cas protein and / or a ZZGY Type V Cas protein and / or a ZKBG Type V Cas protein and / or a ZZKD Type V Cas protein and / or a ZXPB Type V Cas protein and / or a ZPPX Type V Cas protein and / or a ZXHQ Type V Cas protein and / or a ZQKH Type V Cas protein and / or a ZRGM Type V Cas protein and / or a ZTAE Type V Cas protein and / or a ZSQQ Type V Cas protein and / or a ZSYN Type V Cas protein and / or a ZRBH Type V Cas protein and / or a ZWPU Type V Cas protein and / or a ZZQE Type V Cas protein and / or a ZRXE Type V Cas protein, and one or more domains from a different Type V Cas protein such as AsCas12a.

[0065] Exemplary features of Type V Cas proteins of the disclosure are described in Section 6.2.

[0066] In further aspects, the disclosure provides guide (gRNA) molecules and combinations of guide RNA molecules, for example combinations of two or more gRNAs. Exemplary features of the gRNAs and combinations of gRNAs of the disclosure are further described in Section 6.3.

[0067] In further aspects, the disclosure provides systems comprising a Type V Cas protein of the disclosure and one or more gRNAs. Exemplary features of systems are described in Section 6.4.

[0068] In further aspects, the disclosure provides nucleic acids and pluralities of nucleic acids encoding a Type V Cas protein of the disclosure and, optionally, a gRNA , and provides nucleic acids encoding a gRNA, of the disclosure and, optionally, a Type V Cas protein. Exemplary features of nucleic and pluralities of nucleic acids of the disclosure are described in Section 6.5.

[0069] In further aspects, the disclosure provides particles comprising the Type V Cas proteins, gRNAs, nucleic acids, and systems of the disclosure. Exemplary features of particles of the disclosure are described in Section 6.6.

[0070] In another aspect, the disclosure provides cells and populations of cells containing or contacted with a Type V Cas protein, gRNA, nucleic acid, plurality of nucleic acids, system, or particle of the disclosure. Exemplary features of such cells and cell populations are described in Section 6.6.

[0071] In another aspect, the disclosure provides pharmaceutical compositions comprising a Type V Cas protein, gRNA, nucleic acid, plurality of nucleic acids, system, particle, cell, or population of cells together with one or more excipients. Exemplary features of pharmaceutical compositions are described in Section 6.7.

[0072] In another aspect, the disclosure provides methods of altering cells (e.g., editing the genome of a cell) using the Type V Cas proteins, gRNAs, nucleic acids, systems, particles, and pharmaceutical compositions of the disclosure. Features of exemplary methods of altering cells are described in Section 6.8.6.1. Definitions

[0073] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention belongs. The following definitions are provided for the full understanding of terms used in this specification.

[0074] As used in the specification and claims, the singular form “a,” “an,” and “the” include plural references unless the context clearly dictates otherwise. For example, the term “an agent” includes a plurality of agents, including mixtures thereof.

[0075] Unless indicated otherwise, an “or” conjunction is intended to be used in its correct sense as a Boolean logical operator, encompassing both the selection of features in the alternative (A or B, where the selection of A is mutually exclusive from B) and the selection of features in conjunction (A or B, where both A and B are selected). In some places in the text, the term “and / or” is used for the same purpose, which shall not be construed to imply that “or” is used with reference to mutually exclusive alternatives.

[0076] AsCas12a refers to a Cas12a protein havin the following amino acid sequence:MTQFEGFTNLYQVSKTLRFELIPQGKTLKHIQEQGFIEEDKARNDHYKELKPIIDRIYKTYADQCLQLVQLD WENLSAAIDSYRKEKTEETRNALIEEQATYRNAIHDYFIGRTDNLTDAINKRHAEIYKGLFKAELFNGKVLK QLGTVTTTEHENALLRSFDKFTTYFSGFYENRKNVFSAEDISTAIPHRIVQDNFPKFKENCHIFTRLITAVP SLREHFENVKKAIGIFVSTSIEEVFSFPFYNQLLTQTQIDLYNQLLGGISREAGTEKIKGLNEVLNLAIQKND ETAHIIASLPHRFIPLFKQILSDRNTLSFILEEFKSDEEVIQSFCKYKTLLRNENVLETAEALFNELNSIDLTHI FISHKKLETISSALCDHWDTLRNALYERRISELTGKITKSAKEKVQRSLKHEDINLQEIISAAGKELSEAFKQ KTSEILSHAHAALDQPLPTTLKKQEEKEILKSQLDSLLGLYHLLDWFAVDESNEVDPEFSARLTGIKLEME PSLSFYNKARNYATKKPYSVEKFKLNFQMPTLASGWDVNKEKNNGAILFVKNGLYYLGIMPKQKGRYKA LSFEPTEKTSEGFDKMYYDYFPDAAKMIPKCSTQLKAVTAHFQTHTTPILLSNNFIEPLEITKEIYDLNNPE KEPKKFQTAYAKKTGDQKGYREALCKWIDFTRDFLSKYTKTTSIDLSSLRPSSQYKDLGEYYAELNPLLY HISFQRIAEKEIMDAVETGKLYLFQIYNKDFAKGHHGKPNLHTLYWTGLFSPENLAKTSIKLNGQAELFYR PKSRMKRMAHRLGEKMLNKKLKDQKTPIPDTLYQELYDYVNHRLSHDLSDEARALLPNVITKEVSHEIIKD RRFTSDKFFFHVPITLNYQAANSPSKFNQRVNAYLKEHPETPIIGIDRGERNLIYITVIDSTGKILEQRSLNTI QQFDYQKKLDNREKERVAARQAWSWGTIKDLKQGYLSQVIHEIVDLMIHYQAVWLENLNFGFKSKRTG IAEKAVYQQFEKMLIDKLNCLVLKDYPAEKVGGVLNPYQLTDQFTSFAKMGTQSGFLFYVPAPYTSKIDPLTGFVDPFVWKTIKNHESRKHFLEGFDFLHYDVKTGDFILHFKMNRNLSFQRGLPGFMPAWDIVFEKNET QFDAKGTPFIAGKRIVPVIENHRFTGRYRDLYPANELIALLEEKGIVFRDGSNILPKLLENDDSHAIDTMVAL IRSVLQMRNSNAATGEDYINSPVRDLNGVCFDSRFQNPEWPMDADANGAYHIALKGQLLLNHLKESKDL KLQNGISNQDWLAYIQELRN (SEQ ID N0:121)

[0077] A Type V Cas protein refers to a wild-type or engineered Type V Cas protein. Engineered Type V Cas proteins can also be referred to as Type V Cas variants. For the avoidance of doubt, any disclosure pertaining to a “Type V Cas” or “Type V Cas protein” pertains to wild-type Type V Cas proteins and Type V Cas variants, unless the context dictates otherwise. A Type V Cas protein can have nuclease activity or be catalytically inactive (e.g., as in a dCas).

[0078] As used herein, the percentage identity between two nucleotide sequences or between two amino acid sequences is calculated by multiplying the number of matches between a pair of aligned sequences by 100, and dividing by the length of the aligned region. Identity scoring only counts perfect matches and does not consider the degree of similarity of amino acids to one another, nor does it consider substitutions or deletions as matches. For calculation of the percent sequence identity (% sequence identity), two sequences are aligned using the EMBOSS Needle Pairwise Sequence Alignment software tool based on the Needleman and Wunsch algorithm (available at www.ebi.ac.uk / jdispatcher / psa / emboss_needle) with the following parameters: Matrix: BLOSUM62 (for protein sequences) or DNAfull (for DNA sequences); Gap Open: 10; Gap Extend: 0.5; End Gap Penalty: false; End Gap Open: 10; and End Gap Extend: 0.5.

[0079] Guide RNA molecule (gRNA) refers to an RNA capable of forming a complex with a Type V Cas protein and which can direct the Type V Cas protein to a target DNA. gRNAs typically comprise a spacer of 15 to 30 nucleotides in length. gRNAs of the disclosure typically comprise a crRNA scaffold region at the 5’ end of the molecule and a spacer at the 3’ end of the molecule. Various non-limiting examples of crRNA scaffolds are described in Section 6.3.

[0080] An gRNA can in some embodiments comprise no uracil base at the 3’ end of the gRNA sequence. Alternatively, a gRNA can comprise one or more uracil bases at the 3’ end of the sgRNA sequence. For example, a gRNA can comprise 1 uracil (U) at the 3’ end of the gRNA sequence, 2 uracil (UU) at the 3’ end of the gRNA sequence, 3 uracil (UUU) at the 3’ end of the gRNA sequence, 4 uracil (UUUU) at the 3’ end of the gRNA sequence, 5 uracil (UUUUU) at the 3’ end of the gRNA sequence, 6 uracil (UUUUUU) at the 3’ end of the gRNA sequence, 7 uracil (UUUUUUU) at the 3’ end of the gRNA sequence, or 8 uracil (UUUUUUUU) at the 3’ end of the gRNA sequence. Different length stretches of uracil can be appended at the 3’ end of a gRNA as terminators.

[0081] A gRNA can in some embodiments comprise a 5’ guanine (G) at it’s 5’ end. A 5’-G can promote efficient transcription from a U6 promoter.

[0082] Peptide, protein, and polypeptide are used interchangeably to refer to a natural or synthetic molecule comprising two or more amino acids linked by the carboxyl group of one amino acid to the alpha amino group of another. The amino acids may be natural or synthetic, and can contain chemical modifications such as disulfide bridges, substitution of radioisotopes, phosphorylation, substrate chelation (e.g., chelation of iron or copper atoms), glycosylation, acetylation, formylation, amidation, biotinylation,and a wide range of other modifications. A polypeptide may be attached to other molecules, for instance molecules required for function. Examples of molecules which may be attached to a polypeptide include, without limitation, cofactors, polynucleotides, lipids, metal ions, phosphate, etc. Non-limiting examples of polypeptides include peptide fragments, denatured / unstructured polypeptides, polypeptides having quaternary or aggregated structures, etc. There is expressly no requirement that a polypeptide must contain an intended function; a polypeptide can be functional, non-functional, function for unexpected / unintended purposes, or have unknown function. A polypeptide is comprised of approximately twenty, standard naturally occurring amino acids, although natural and synthetic amino acids which are not members of the standard twenty amino acids may also be used. The standard twenty amino acids include alanine (Ala, A), arginine (Arg, R), asparagine (Asn, N), aspartic acid (Asp, D), cysteine (Cys, C), glutamine (Gin, Q), glutamic acid (Glu, E), glycine (Gly, G), histidine, (His, H), isoleucine (lie, I), leucine (Leu, L), lysine (Lys, K), methionine (Met, M), phenylalanine (Phe, F), proline (Pro, P), serine (Ser, S), threonine (Thr, T), tryptophan (Trp, W), tyrosine (Tyr, Y), and valine (Vai, V). The terms “polypeptide sequence” or “amino acid sequence” are an alphabetical representation of a polypeptide molecule.

[0083] Polynucleotide and oligonucleotide are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: a gene or gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, primers and gRNAs. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component. A polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (U) for thymine (T) when the polynucleotide is RNA. Thus, the term “nucleotide sequence” is the alphabetical representation of a polynucleotide molecule. The letters used in polynucleotide sequences described herein correspond to IUPAC notation. For example, the letter “N” in a nucleotide sequence represents a nucleotide which can be A, T, C, or G in a DNA sequence, or A, U, C, or G in a RNA sequence; the letter “R” in a nucleotide sequence represents a nucleotide which can be A or G; the letter “V” in a nucleotide sequence represents a nucleotide which can be A, C, or G; and the letter “Y” in a nucleotide sequence represents a nucleotide which can be C or T.

[0084] Protospacer adjacent motif (PAM) refers to a DNA sequence upstream (e.g. , immediately upstream) of a target sequence on the non-target strand recognized by a Type V Cas protein. A PAM sequence is located 5’ of the target sequence on the non-target strand.

[0085] Spacer refers to a region of a gRNA molecule which is partially or fully complementary to a target sequence found in the + or - strand of genomic DNA. When complexed with a Type V Cas protein, the gRNA directs the Type V Cas to the target sequence in the genomic DNA. A spacer of a Type V CasgRNA is typically 15 to 30 nucleotides in length (e.g., 20-25 nucleotides). The nucleotide sequence of a spacer can be, but is not necessarily, fully complementary to the target sequence. For example, a spacer can contain one or more mismatches with a target sequence, e.g., the spacer can comprise one, two, or three mismatches with the target sequence.6.2. Type V Cas Proteins6.2.1. ZWGD Type V Cas Proteins

[0086] In one aspect, the disclosure provides ZWGD Type V Cas proteins. ZWGD Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZWGD Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:1 . In some embodiments, the ZWGD Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:1 . In some embodiments, a ZWGD Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:1 .

[0087] Exemplary ZWGD Type V Cas protein sequences and nucleotide sequences encoding exemplary ZWGD Type V Cas proteins are set forth in Table 1 A.

[0088] In some embodiments a ZWGD Type V Cas protein comprises an amino acid sequence of SEQ ID NO:1 , SEQ ID NO:2, or SEQ ID NO:3. In some embodiments, a ZWGD Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:1 , SEQ ID NO:2, or SEQ ID NO:3. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D891 substitution, wherein the position of the D891 substitution is defined with respect to the amino acid numbering of SEQ ID NO:2 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E990 substitution, wherein the position of the E990 substitution is definedwith respect to the amino acid numbering of SEQ ID NO:2 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1200 substitution, wherein the position of the R1200 substitution is defined with respect to the amino acid numbering of SEQ ID NO:2 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1248 substitution, wherein the position of the D1248 substitution is defined with respect to the amino acid numbering of SEQ ID NO:2 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZWGD Type V Cas protein is catalytically inactive, for example due to a R1200 substitution in combination with a D891 substitution, a E990 substitution, and / or D1248 substitution.6.2.2. ZJHK Type V Cas Proteins

[0089] In one aspect, the disclosure provides ZJHK Type V Cas proteins. ZJHK Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZJHK Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:7. In some embodiments, the ZJHK Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NOT. In some embodiments, a ZJHK Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NOT.

[0090] Exemplary ZJHK Type V Cas protein sequences and nucleotide sequences encoding exemplary ZJHK Type V Cas proteins are set forth in Table 1 B.

[0091] In some embodiments a ZJHK Type V Cas protein comprises an amino acid sequence of SEQ ID NO:7, SEQ ID NO:8, or SEQ ID NO:9. In some embodiments, a ZJHK Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:7, SEQ ID NO:8, or SEQ ID NO:9. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D900 substitution, wherein the position of the D900 substitution is defined with respect to the amino acid numbering of SEQ ID NO:8 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E987 substitution, wherein the position of the E987 substitution is defined with respect to the amino acid numbering of SEQ ID NO:8 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1203 substitution, wherein the position of the R1203 substitution is defined with respect to the amino acid numbering of SEQ ID NO:8 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1244 substitution, wherein the position of the D1244 substitution is defined with respect to the amino acid numbering of SEQ ID NO:121 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZJHK Type V Cas protein is catalytically inactive, for example due to a R1203 substitution in combination with a D900 substitution, a E987 substitution, and / or D1244 substitution.6.2.3. ZIKV Type V Cas Proteins

[0092] In one aspect, the disclosure provides ZIKV Type V Cas proteins. ZIKV Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZIKV Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:13. In some embodiments, the ZIKV Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:13. In some embodiments, a ZIKV Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:13.

[0093] Exemplary ZIKV Type V Cas protein sequences and nucleotide sequences encoding exemplary ACEE Type V Cas proteins are set forth in Table 1C.

[0094] In some embodiments a ZIKV Type V Cas protein comprises an amino acid sequence of SEQ ID NO:13, SEQ ID NO:14, or SEQ ID NO:15. In some embodiments, a ZIKV Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:13, SEQ ID NO:14, or SEQ ID NO:15. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D814 substitution, wherein the position of the D814 substitution is defined with respect to the amino acid numbering of SEQ ID NO:14 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E899 substitution, wherein the position of the E899 substitution is defined with respect to the amino acid numbering of SEQ ID NO:14 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1111 substitution, wherein the position of the R1111 substitution is defined with respect to the amino acid numbering of SEQ ID NO:14 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1148 substitution, wherein the position of the D1148 substitution is defined with respect to the amino acid numbering of SEQ ID NO:14 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZIKV Type V Cas protein is catalytically inactive, for example due to a R1111 substitution in combination with a D814 substitution, a E899 substitution, and / or D1148 substitution.6.2.4. ZZFT Type V Cas Proteins

[0095] In one aspect, the disclosure provides ZZFT Type V Cas proteins. ZZFT Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZZFT Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:19. In some embodiments, the ZZFT Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least97%, at least 98%, or at least 99% identical to SEQ ID NO:19. In some embodiments, a ZZFT Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:19.

[0096] Exemplary ZZFT Type V Cas protein sequences and nucleotide sequences encoding exemplary ZZFT Type V Cas proteins are set forth in Table 1 D.

[0097] In some embodiments a ZZFT Type V Cas protein comprises an amino acid sequence of SEQ ID NO:19, SEQ ID NO:20, or SEQ ID NO:21 . In some embodiments, a ZZFT Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:19, SEQ ID NQ:20, or SEQ ID NO:21 . In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D856 substitution, wherein the position of the D856 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:20 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E949 substitution, wherein the position of the E949 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:20 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1166 substitution, wherein the position of the R1166 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:20 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1203 substitution, wherein the position of the D1203 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:20 (corresponding to amino acid 1263 of SEQ ID NO:121). Insome embodiments, a ZZFT Type V Cas protein is catalytically inactive, for example due to a R1166 substitution in combination with a D856 substitution, a E949 substitution, and / or D1203 substitution.6.2.5. YYAN Type V Cas Proteins

[0098] In one aspect, the disclosure provides YYAN Type V Cas proteins. YYAN Type V Cas proteins can be further classified as Type V-A Cas proteins. The YYAN Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:25. In some embodiments, the YYAN Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:25. In some embodiments, a YYAN Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:25.

[0099] Exemplary YYAN Type V Cas protein sequences and nucleotide sequences encoding exemplary YYAN Type V Cas proteins are set forth in Table 1 E.

[0100] In some embodiments a YYAN Type V Cas protein comprises an amino acid sequence of SEQ ID NO:25, SEQ ID NO:26, or SEQ ID NO:27. In some embodiments, a YYAN Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:25, SEQ ID NO:26, or SEQ ID NO:27. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D838 substitution, wherein the position of the D838 substitution is defined with respect to the amino acid numbering of SEQ ID NO:26 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E928 substitution, wherein the position of the E928 substitution is defined with respect to the amino acid numbering of SEQ ID NO:26 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1135 substitution, wherein the position of the R1135 substitution is defined with respect to the amino acid numbering of SEQ ID NO:26 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1170 substitution, wherein the position of the D1170 substitution is defined with respect tothe amino acid numbering of SEQ ID NO:26 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a YYAN Type V Cas protein is catalytically inactive, for example due to a R1135 substitution in combination with a D838 substitution, a E928 substitution, and / or D1170 substitution.6.2.6. ZZGY Type V Cas Proteins

[0101] In one aspect, the disclosure provides ZZGY Type V Cas proteins. ZZGY Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZZGY Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:31 . In some embodiments, the ZZGY Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:31 . In some embodiments, a ZZGY Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:31 .

[0102] Exemplary ZZGY Type V Cas protein sequences and nucleotide sequences encoding exemplary ZZGY Type V Cas proteins are set forth in Table 1 F.

[0103] In some embodiments a ZZGY Type V Cas protein comprises an amino acid sequence of SEQID NO:31 , SEQ ID NO:32, or SEQ ID NO:33. In some embodiments, a ZZGY Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:31 , SEQ ID NO:32, or SEQ ID NO:33. In some embodiments, the one or more amino acidsubstitutions providing nickase activity comprise a D905 substitution, wherein the position of the D905 substitution is defined with respect to the amino acid numbering of SEQ ID NO:32 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E998 substitution, wherein the position of the E998 substitution is defined with respect to the amino acid numbering of SEQ ID NO:32 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1214 substitution, wherein the position of the R1214 substitution is defined with respect to the amino acid numbering of SEQ ID NO:32 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1254 substitution, wherein the position of the D1254 substitution is defined with respect to the amino acid numbering of SEQ ID NO:32 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZZGY Type V Cas protein is catalytically inactive, for example due to a R1214 substitution in combination with a D905 substitution, a E998 substitution, and / or D1254 substitution.6.2.7. ZKBG Type V Cas Proteins

[0104] In one aspect, the disclosure provides ZKBG Type V Cas proteins. ZKBG Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZKBG Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:37. In some embodiments, the ZKBG Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:37. In some embodiments, a ZKBG Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:37.

[0105] Exemplary ZKBG Type V Cas protein sequences and nucleotide sequences encoding exemplary ZKBG Type V Cas proteins are set forth in Table 1G.

[0106] In some embodiments a ZKBG Type V Cas protein comprises an amino acid sequence of SEQ ID NO:37, SEQ ID NO:38, or SEQ ID NO:39. In some embodiments, a ZKBG Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:37, SEQ ID NO:38, or SEQ ID NO:39. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D885 substitution, wherein the position of the D885 substitution is defined with respect to the amino acid numbering of SEQ ID NO:38 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutionsproviding nickase activity comprise an E978 substitution, wherein the position of the E978 substitution is defined with respect to the amino acid numbering of SEQ ID NO:38 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1194 substitution, wherein the position of the R1194 substitution is defined with respect to the amino acid numbering of SEQ ID NO:38 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1234 substitution, wherein the position of the D1234 substitution is defined with respect to the amino acid numbering of SEQ ID NO:38 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZKBG Type V Cas protein is catalytically inactive, for example due to a R1194 substitution in combination with a D885 substitution, a E978 substitution, and / or D1234 substitution.6.2.8. ZZKD Type V Cas Proteins

[0107] In one aspect, the disclosure provides ZZKD Type V Cas proteins. ZZKD Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZZKD Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:43. In some embodiments, the ZZKD Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:43. In some embodiments, a ZZKD Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:43.

[0108] Exemplary ZZKD Type V Cas protein sequences and nucleotide sequences encoding exemplary ZZKD Type V Cas proteins are set forth in Table 1 H.

[0109] In some embodiments a ZZKD Type V Cas protein comprises an amino acid sequence of SEQ ID NO:43, SEQ ID NO:44, or SEQ ID NO:45. In some embodiments, a ZZKD Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:43, SEQ ID NO:44, or SEQ ID NO:45. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D828 substitution, wherein the position of the D828 substitution is defined with respect to the amino acid numbering of SEQ ID NO:44 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E925 substitution, wherein the position of the E925 substitution is defined with respect to the amino acid numbering of SEQ ID NO:44 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1138 substitution, wherein the position of the R1138 substitution is defined with respect to the amino acid numbering of SEQ ID NO:44 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1176 substitution, wherein the position of the D1176 substitution is defined with respect to the amino acid numbering of SEQ ID NO:44 (corresponding to amino acid 1263 of SEQ ID NO:121). Insome embodiments, a ZZKD Type V Cas protein is catalytically inactive, for example due to a R1138 substitution in combination with a D828 substitution, a E925 substitution, and / or D1176 substitution.6.2.9. ZXPB Type V Cas Proteins

[0110] In one aspect, the disclosure provides ZXPB Type V Cas proteins. ZXPB Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZXPB Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:49. In some embodiments, the ZXPB Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:49. In some embodiments, a ZXPB Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:49.

[0111] Exemplary ZXPB Type V Cas protein sequences and nucleotide sequences encoding exemplary ZXPB Type V Cas proteins are set forth in Table 11.

[0112] In some embodiments a ZXPB Type V Cas protein comprises an amino acid sequence of SEQ ID NO:49, SEQ ID NO:50, or SEQ ID NO:51 . In some embodiments, a ZXPB Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:49, SEQ ID NQ:50, or SEQ ID NO:51 . In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D821 substitution, wherein the position of the D821 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:50 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E906 substitution, wherein the position of the E906 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:50 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1116 substitution, wherein the position of the R1116 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:50 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1153 substitution, wherein the position of the D1153 substitution is defined with respect tothe amino acid numbering of SEQ ID NQ:50 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZXPB Type V Cas protein is catalytically inactive, for example due to a R1116 substitution in combination with a D821 substitution, a E906 substitution, and / or D1153 substitution.6.2.10. ZPPX Type V Cas Proteins

[0113] In one aspect, the disclosure provides ZPPX Type V Cas proteins. ZPPX Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZPPX Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:55. In some embodiments, the ZPPX Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:55. In some embodiments, a ZPPX Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:55.

[0114] Exemplary ZPPX Type V Cas protein sequences and nucleotide sequences encoding exemplary ZPPX Type V Cas proteins are set forth in Table 1 J.

[0115] In some embodiments a ZPPX Type V Cas protein comprises an amino acid sequence of SEQ ID NO:55, SEQ ID NO:56, or SEQ ID NO:57. In some embodiments, a ZPPX Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:55, SEQ ID NO:56, or SEQ ID NO:57. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D877 substitution, wherein the position of the D877 substitution is defined with respect to the amino acid numbering of SEQ ID NO:56 (corresponding toamino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E969 substitution, wherein the position of the E969 substitution is defined with respect to the amino acid numbering of SEQ ID NO:56 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1181 substitution, wherein the position of the R1181 substitution is defined with respect to the amino acid numbering of SEQ ID NO:56 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1217 substitution, wherein the position of the D1217 substitution is defined with respect to the amino acid numbering of SEQ ID NO:56 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZPPX Type V Cas protein is catalytically inactive, for example due to a R1181 substitution in combination with a D877 substitution, a E969 substitution, and / or D1217 substitution.6.2.11. ZXHQ Type V Cas Proteins

[0116] In one aspect, the disclosure provides ZXHQ Type V Cas proteins. ZXHQ Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZXHQ Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:61 . In some embodiments, the ZXHQ Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:61 . In some embodiments, a ZXHQ Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:61 .

[0117] Exemplary ZXHQ Type V Cas protein sequences and nucleotide sequences encoding exemplary ZXHQ Type V Cas proteins are set forth in Table 1 K.

[0118] In some embodiments a ZXHQ Type V Cas protein comprises an amino acid sequence of SEQ ID NO:61 , SEQ ID NO:62, or SEQ ID NO:63. In some embodiments, a ZXHQ Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:61 , SEQ ID NO:62, or SEQ ID NO:63. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D836 substitution, wherein the position of the D836 substitution is defined with respect to the amino acid numbering of SEQ ID NO:62 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E963 substitution, wherein the position of the E963 substitution is defined with respect to the amino acid numbering of SEQ ID NO:62 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1172 substitution, wherein the position of the R1172 substitution is defined with respect to the amino acid numbering of SEQ ID NO:62 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1211 substitution, wherein the position of the D1211 substitution is defined with respect to the amino acid numbering of SEQ ID NO:62 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZXHQ Type V Cas protein is catalytically inactive, for example due to a R1172 substitution in combination with a D836 substitution, a E963 substitution, and / or D1211 substitution.6.2.12. ZQKH Type V Cas Proteins

[0119] In one aspect, the disclosure provides ZQKH Type V Cas proteins. ZQKH Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZQKH Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:67. In some embodiments, the ZQKH Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:67. In some embodiments, a ZQKH Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:67.

[0120] Exemplary ZQKH Type V Cas protein sequences and nucleotide sequences encoding exemplary ZQKH Type V Cas proteins are set forth in Table 1 L.

[0121] In some embodiments a ZQKH Type V Cas protein comprises an amino acid sequence of SEQ ID NO:67, SEQ ID NO:68, or SEQ ID NO:69. In some embodiments, a ZQKH Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:67, SEQ ID NO:68, or SEQ ID NO:69. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D744 substitution, wherein the position of the D744 substitution is defined with respect to the amino acid numbering of SEQ ID NO:68 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E831 substitution, wherein the position of the E831 substitution is defined with respect to the amino acid numbering of SEQ ID NO:68 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1048 substitution, wherein the position of the R1048 substitution is defined with respect to the amino acid numbering of SEQ ID NO:68 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1091 substitution, wherein the position of the D1091 substitution is defined with respect to the amino acid numbering of SEQ ID NO:68 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZQKH Type V Cas protein is catalytically inactive, for example due to a R1048 substitution in combination with a D744 substitution, a E831 substitution, and / or D1091 substitution.6.2.13. ZRGM Type V Cas Protein

[0122] In one aspect, the disclosure provides ZRGM Type V Cas proteins. ZRGM Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZRGM Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:73. In some embodiments, the ZRGM Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:73. In some embodiments, a ZRGM Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:73.

[0123] Exemplary ZRGM Type V Cas protein sequences and nucleotide sequences encoding exemplary ZRGM Type V Cas proteins are set forth in Table 1M.

[0124] In some embodiments a ZRGM Type V Cas protein comprises an amino acid sequence of SEQ ID NO:73, SEQ ID NO:74, or SEQ ID NO:75. In some embodiments, a ZRGM Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:73, SEQ ID NO:74, or SEQ ID NO:75. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D890 substitution, wherein the position of the D890 substitution is defined with respect to the amino acid numbering of SEQ ID NO:74 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E980 substitution, wherein the position of the E980 substitution is defined with respect to the amino acid numbering of SEQ ID NO:74 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1194 substitution, wherein the position of the R1194 substitution is defined with respect to the amino acid numbering of SEQ ID NO:74 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1237 substitution, wherein the position of the D1237 substitution is defined with respect to the amino acid numbering of SEQ ID NO:74 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZRGM Type V Cas protein is catalytically inactive, for example due to a R1194 substitution in combination with a D890 substitution, a E980 substitution, and / or D1237 substitution.6.2.14. ZTAE Type V Cas Protein

[0125] In one aspect, the disclosure provides ZTAE Type V Cas proteins. ZTAE Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZTAE Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:79. In some embodiments, the ZTAE Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:79. In some embodiments, a ZTAE Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:79.

[0126] Exemplary ZTAE Type V Cas protein sequences and nucleotide sequences encoding exemplary ZTAE Type V Cas proteins are set forth in Table 1 N.

[0127] In some embodiments a ZTAE Type V Cas protein comprises an amino acid sequence of SEQ ID NO:79, SEQ ID NO:80, or SEQ ID NO:81 . In some embodiments, a ZTAE Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:79, SEQ ID NQ:80, or SEQ ID NO:81 . In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D905 substitution, wherein the position of the D905 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:80 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E990 substitution, wherein the position of the E990 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:80 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1206 substitution, wherein the position of the R1206 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:80 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1243 substitution, wherein the position of the D1243 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:80 (corresponding to amino acid 1263 of SEQ ID NO:121). Insome embodiments, a ZTAE Type V Cas protein is catalytically inactive, for example due to a R1206 substitution in combination with a D905 substitution, a E990 substitution, and / or D1243 substitution.6.2.15. ZSQQ Type V Cas Protein

[0128] In one aspect, the disclosure provides ZSQQ Type V Cas proteins. ZSQQ Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZSQQ Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:85. In some embodiments, the ZSQQ Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:85. In some embodiments, a ZSQQ Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:85.

[0129] Exemplary ZSQQ Type V Cas protein sequences and nucleotide sequences encoding exemplary ZSQQ Type V Cas proteins are set forth in Table 10.

[0130] In some embodiments a ZSQQ Type V Cas protein comprises an amino acid sequence of SEQ ID NO:85, SEQ ID NO:86, or SEQ ID NO:87. In some embodiments, a ZSQQ Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequenceof SEQ ID NO:85, SEQ ID NO:86, or SEQ ID NO:87. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D913 substitution, wherein the position of the D913 substitution is defined with respect to the amino acid numbering of SEQ ID NO:86 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E1006 substitution, wherein the position of the E1006 substitution is defined with respect to the amino acid numbering of SEQ ID NO:86 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1219 substitution, wherein the position of the R1219 substitution is defined with respect to the amino acid numbering of SEQ ID NO:86 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1264 substitution, wherein the position of the D1264 substitution is defined with respect to the amino acid numbering of SEQ ID NO:86 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZSQQ Type V Cas protein is catalytically inactive, for example due to a R1219 substitution in combination with a D913 substitution, a E1006 substitution, and / or D1264 substitution.6.2.16. ZSYN Type V Cas Protein

[0131] In one aspect, the disclosure provides ZSYN Type V Cas proteins. ZSYN Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZSYN Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:91 . In some embodiments, the ZSYN Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:91 . In some embodiments, a ZSYN Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:91 .

[0132] Exemplary ZSYN Type V Cas protein sequences and nucleotide sequences encoding exemplary ZSYN Type V Cas proteins are set forth in Table 1 P.

[0133] In some embodiments a ZSYN Type V Cas protein comprises an amino acid sequence of SEQ ID NO:91 , SEQ ID NO:92, or SEQ ID NO:93. In some embodiments, a ZSYN Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:91 , SEQ ID NO:92, or SEQ ID NO:93. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D902 substitution, wherein the position of the D902 substitution is defined with respect to the amino acid numbering of SEQ ID NO:92 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E991 substitution, wherein the position of the E991 substitution is defined with respect to the amino acid numbering of SEQ ID NO:92 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1200 substitution, wherein the position of the R1200 substitution is defined with respect to the amino acid numbering of SEQ ID NO:92 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1239 substitution, wherein the position of the D1239 substitution is defined with respect to the amino acid numbering of SEQ ID NO:92 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZSYN Type V Cas protein is catalytically inactive, for example due to a R1200 substitution in combination with a D902 substitution, a E991 substitution, and / or D1239 substitution.6.2.17. ZRBH Type V Cas Protein

[0134] In one aspect, the disclosure provides ZRBH Type V Cas proteins. ZRBH Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZRBH Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:97. In some embodiments, the ZRBH Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:97. In some embodiments, a ZRBH Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:97.

[0135] Exemplary ZRBH Type V Cas protein sequences and nucleotide sequences encoding exemplary ZRBH Type V Cas proteins are set forth in Table 1Q.

[0136] In some embodiments a ZRBH Type V Cas protein comprises an amino acid sequence of SEQ ID NO:97, SEQ ID NO:98, or SEQ ID NO:99. In some embodiments, a ZRBH Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:97, SEQ ID NO:98, or SEQ ID NO:99. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D851 substitution, wherein the position of the D851 substitution is defined with respect to the amino acid numbering of SEQ ID NO:98 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E940 substitution, wherein the position of the E940 substitution is defined with respect to the amino acid numbering of SEQ ID NO:98 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1152 substitution, wherein the position of the R1152 substitution is defined with respect to the amino acid numbering of SEQ ID NO:98 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1189 substitution, wherein the position of the D1189 substitution is defined with respect to the amino acid numbering of SEQ ID NO:98 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZRBH Type V Cas protein is catalytically inactive, for example due to a R1152 substitution in combination with a D851 substitution, a E940 substitution, and / or D1152 substitution.6.2.18. ZWPU Type V Cas Protein

[0137] In one aspect, the disclosure provides ZWPU Type V Cas proteins. ZWPU Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZWPU Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NQ:103. In some embodiments, the ZWPU Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NQ:103. In some embodiments, a ZWPU Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NQ:103.

[0138] Exemplary ZWPU Type V Cas protein sequences and nucleotide sequences encoding exemplary ZWPU Type V Cas proteins are set forth in Table 1 R.

[0139] In some embodiments a ZWPU Type V Cas protein comprises an amino acid sequence of SEQ ID NO:103, SEQ ID NO:104, or SEQ ID NQ:105. In some embodiments, a ZWPU Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NQ:103, SEQ ID NQ:104, or SEQ ID NQ:105. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D845 substitution, wherein the position of the D845 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:104 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E938 substitution, wherein the position of the E938 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:104 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1153 substitution, wherein the position of the R1153 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:104 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1195 substitution, wherein the position of the D1195 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:104 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZWPU Type V Cas protein is catalytically inactive, for example due to a R1153 substitution in combination with a D845 substitution, a E938 substitution, and / or D1195 substitution.6.2.19. ZZQE Type V Cas Protein

[0140] In one aspect, the disclosure provides ZZQE Type V Cas proteins. ZZQE Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZZQE Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:109. In some embodiments, the ZZQE Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:109. In some embodiments, a ZZQE Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NQ:109.

[0141] Exemplary ZZQE Type V Cas protein sequences and nucleotide sequences encoding exemplary ZZQE Type V Cas proteins are set forth in Table 1 S.

[0142] In some embodiments a ZZQE Type V Cas protein comprises an amino acid sequence of SEQ ID NO:109, SEQ ID NO:110, or SEQ ID NO:111 . In some embodiments, a ZZQE Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NQ:109, SEQ ID NQ:110, or SEQ ID NO:111. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D859 substitution, wherein the position of the D859 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:110 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise an E952 substitution, wherein the position of the E952 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:110 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1164 substitution, wherein the position of the R1164 substitution is defined with respect to the amino acid numbering of SEQ ID NQ:110 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1201 substitution, wherein the position of the D1201 substitution is defined withrespect to the amino acid numbering of SEQ ID NO:110 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZZQE Type V Cas protein is catalytically inactive, for example due to a R1164 substitution in combination with a D859 substitution, a E952 substitution, and / or D1201 substitution.6.2.20. ZRXE Type V Cas Protein

[0143] In one aspect, the disclosure provides ZRXE Type V Cas proteins. ZRXE Type V Cas proteins can be further classified as Type V-A Cas proteins. The ZRXE Type V Cas proteins typically comprise an amino acid sequence that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO:115. In some embodiments, the ZRXE Type V Cas proteins comprise an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:115. In some embodiments, a ZRXE Type V Cas protein comprises an amino acid sequence that is identical to SEQ ID NO:115.

[0144] Exemplary ZRXE Type V Cas protein sequences and nucleotide sequences encoding exemplary ZRXE Type V Cas proteins are set forth in Table 1T.

[0145] In some embodiments a ZRXE Type V Cas protein comprises an amino acid sequence of SEQ ID NO:115, SEQ ID NO:116, or SEQ ID NO:117. In some embodiments, a ZRXE Type V Cas protein has nickase activity, for example resulting from one or more amino acid substitutions relative to the sequence of SEQ ID NO:115, SEQ ID NO:116, or SEQ ID NO:117. In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D862 substitution, wherein the position of the D862 substitution is defined with respect to the amino acid numbering of SEQ ID NO:116 (corresponding to amino acid 908 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutionsproviding nickase activity comprise an E955 substitution, wherein the position of the E955 substitution is defined with respect to the amino acid numbering of SEQ ID NO:116 (corresponding to amino acid 993 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a R1167 substitution, wherein the position of the R1167 substitution is defined with respect to the amino acid numbering of SEQ ID NO:116 (corresponding to amino acid 1226 of SEQ ID NO:121). In some embodiments, the one or more amino acid substitutions providing nickase activity comprise a D1204 substitution, wherein the position of the D1204 substitution is defined with respect to the amino acid numbering of SEQ ID NO:116 (corresponding to amino acid 1263 of SEQ ID NO:121). In some embodiments, a ZRXE Type V Cas protein is catalytically inactive, for example due to a R1167 substitution in combination with a D862 substitution, a E955 substitution, and / or D1204 substitution.6.2.21. Fusion and Chimeric Proteins

[0146] The disclosure provides Type V Cas proteins, e.g., a ZWGD Type V Cas protein, a ZJHK Type V Cas protein, a ZIKV Type V Cas protein, a ZZFT Type V Cas protein, a YYAN Type V Cas protein, a ZZGY Type V Cas protein, a ZKBG Type V Cas protein, a ZZKD Type V Cas protein, a ZXPB Type V Cas protein, a ZPPX Type V Cas protein, a ZXHQ Type V Cas protein, a ZQKH Type V Cas protein, a ZRGM Type V Cas protein, a ZTAE Type V Cas protein, a ZSQQ Type V Cas protein, a ZSYN Type V Cas protein, a ZRBH Type V Cas protein, a ZWPU Type V Cas protein, a ZZQE Type V Cas protein, and a ZRXE Type V Cas protein, which are in the form of fusion proteins comprising a Type V Cas protein sequence fused with one or more additional amino acid sequences, such as one or more nuclear localization signals and / or one or more non-native tags. Fusion proteins can also comprise an amino acid sequence of, for example, a nucleoside deaminase, a reverse transcriptase, a transcriptional activator (e.g., VP64), a transcriptional repressor (e.g., Kruppel associated box (KRAB)), a histone-modifying protein, an integrase, or a recombinase. Fusion proteins can include linker sequences joining different portions of the fusion protein. For example, glycine-serine linkers such as GS, SG, or GS or SG repeats, (e.g., GSGS (SEQ ID NO:259)). In some embodiments, one or more fusion partners (e.g., an adenosine deaminase or cytidine deaminase) is / are positioned N-terminal to a Type V Cas protein sequence. In some embodiments, one or more fusion partners (e.g., an adenosine deaminase or cytidine deaminase) is / are positioned C-terminal to a Type V Cas protein sequence.

[0147] In some embodiments, a fusion protein of the disclosure comprises a means for localizing the Type V Cas protein to the nucleus, for example a nuclear localization signal.

[0148] Non-limiting examples of nuclear localization signals include KRTADGSEFESPKKKRKV (SEQ ID NO:122), PKKKRKV (SEQ ID NO:123), PKKKRRV (SEQ ID NO:124), KRPAATKKAGQAKKKK (SEQ ID NO:125), YGRKKRRQRRR (SEQ ID NO:126), RKKRRQRRR (SEQ ID NO:127), PAAKRVKLD (SEQ ID NO:128), RQRRNELKRSP (SEQ ID NO:129), VSRKRPRP (SEQ ID NQ:130), PPKKARED (SEQ ID NO:131), PQPKKKPL (SEQ ID NO:132), SALIKKKKKMAP (SEQ ID NO:133), PKQKKRK (SEQ ID NO:134), RKLKKKIKKL (SEQ ID NO:135), REKKKFLKRR (SEQ ID NO:136), KRKGDEVDGVDEVAKKKSKK (SEQ ID NO:137), RKCLQAGMNLEARKTKK (SEQ ID NO:138), NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO:139), RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NQ:140), and SSDDEATADSQHAAPPKKKRKV (SEQ ID NO:178). Additional non-limiting examples of nuclearlocalization signals include PKKKRKVG (SEQ ID NO:179) and GRSSDDEATADSQHAAPPKKKRKV (SEQ ID NO:180).

[0149] Exemplary fusion partners include protein tags (e.g., V5-tag e.g., having the sequence GKPIPNPLLGLDST (SEQ ID NO:141) or IPNPLLGLD (SEQ ID NO:142)), FLAG-tag, myc-tag, HA-tag, GST-tag, polyHis-tag, MBP-tag), protein domains, transcription modulators, enzymes acting on small molecule substrates, DNA, RNA and protein modification enzymes (e.g., adenosine deaminase, cytidine deaminase, guanosyl transferase, DNA methyltransferase, RNA methyltransferases, DNA demethylases, RNA demethylases, dioxygenases, polyadenylate polymerases, pseudouridine synthases, acetyltransferases, deacetylase, ubiquitin-ligases, deubiquitinases, kinases, phosphatases, NEDD8- ligases, de-NEDDylases, SUMO-ligases, deSUMOylases, histone deacetylases, reverse transcriptases, histone acetyltransferases histone methyltransferases, histone demethylases), protein DNA binding domains, RNA binding proteins, polypeptide sequences with specific biological functions (e.g., nuclear localization signals, mitochondrial localization signals, plastid localization signals, subcellular localization signals, destabilizing signals, Geminin destruction box motifs), and biological tethering domains (e.g., MS2, Csy4 and lambda N protein). Various Type V Cas fusion proteins are described in Ribeiro et al.,2018, In. J. Genomics, Article ID:1652567; Jayavaradhan, et al., 2019, Nat Commun 10:2866; Xiao et al.,2019, The CRISPR Journal, 2(1):51-63; Mali et al., 2013, Nat Methods. 10(10):957-63; US patent nos. 9,322,037, and 9,388,430. In some embodiments, a fusion partner is an adenosine deaminase. An exemplary adenosine deaminase is the tRNA adenosine deaminase (TadA) moiety contained in the adenine base editor ABE8e (Richter, 2020, Nature Biotechnology 38:883-891). The TadA moiety of ABE8e comprises the following amino acid sequence:SEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGLHDPTAHAEIMALRQGGLV MQNYRLIDATLYVTFEPCVMCAGAMIHSRIGRVVFGVRNSKRGAAGSLMNVLNYPGMNHRVEITEGILAD ECAALLCDFYRMPRQVFNAQKKAQSSIN (SEQ ID NO:143)

[0150] In some embodiments, an adenosine deaminase fusion partner comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99% amino acid sequence identity with SEQ ID NO:143.

[0151] Type V Cas proteins of the disclosure in the form of a fusion protein comprising an adenosine deaminase can be used, for example, as an adenine base editor (ABE) to change an “A” to a “G” in DNA. Type V Cas proteins of the disclosure in the form of a fusion protein comprising a cytidine deaminase can be used, for example, as a cytosine base editor (CBE) to change a “C” to a “T” in DNA.

[0152] In some embodiments, a fusion protein of the disclosure comprises a means for deaminating adenosine, for example an adenosine deaminase, e.g., a TadA variant. In some embodiments, a fusion protein of the disclosure comprises a means for deaminating cytidine, for example a cytidine deaminase, e.g., cytidine deaminase 1 (CDA1) or an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase (see, e.g., Cheng et al., 2019, Nat Commun. 10(1):3612; Gehrke et al., 2018, Nat Biotechnol. 36(10):977-982; Komor et al., 2016, Nature 533(7603):420-424, Porto and Komor, 2023, PLoS Biol 21 (4):e3002071 , the contents of each of which are incorporated herein by reference in their entireties).

[0153] Exemplary deaminases that can be used in fusion proteins of the disclosure are set forth in Table 2.

[0154] In some embodiments, a deaminase fusion partner comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% amino acid sequence identity to an amino acid sequence set forth in Table 2. The amino acid sequences shown in Table 2 are shown without an N-terminal methionine; an N-terminal methionine can be added, for example when the deaminase amino acid sequence is at the N-terminal end of the molecule.

[0155] In some embodiments, a fusion protein of the disclosure comprises a deaminase, e.g., as described in Table 2 and a uracil glycosylase inhibitor (UGI) domain (e.g., as described in Wu et al., 2022, Mol. Cell 82(23):4487-4502, the contents of which are incorporated herein by reference in their entireties.) An exemplary UGI domain comprises the amino acid sequenceTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQD SNGENKIKML (SEQ ID NO:250)

[0156] Type V Cas proteins of the disclosure in the form of a fusion protein comprising a transcriptional repressor or an effector domain thereof can be used, for example, to silence genes via epigenome editing (see, e.g., Cappelluti et al., 2024 Nature 627:416-423, the contents of which are incorporated herein by reference in their entireties). Exemplary effector domains are described in Table 3.

[0157] In some embodiments, an effector domain fusion partner comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% amino acid sequence identity to an amino acid sequence set forth in Table 3. The amino acid sequences shown in Table 3 are shown without an N-terminal methionine; an N- terminal methionine can be added, for example when the effector domain amino acid sequence is at the N-terminal end of the molecule.

[0158] In some embodiments, a fusion protein of the disclosure comprises a means for synthesizing DNA from a single-stranded template, for example a reverse transcriptase, e.g., a MMLV reverse transcriptase (see, WO 2021 / 226558, the contents of which are incorporated herein by reference in their entireties). An exemplary reverse transcriptase comprises the amino acid sequenceTLNIEDEYRLHETSKEPDVSLGSTWLSDFPQAWAETGGMGLAVRQAPLIIPLKATSTPVSIKQYPMSQEA RLGIKPHIQRLLDQGILVPCQSPWNTPLLPVKKPGTNDYRPVQDLREVNKRVEDIHPTVPNPYNLLSGLPP SHQWYTVLDLKDAFFCLRLHPTSQPLFAFEWRDPEMGISGQLTWTRLPQGFKNSPTLFNEALHRDLADF RIQHPDLILLQYVDDLLLAATSELDCQQGTRALLQTLGNLGYRASAKKAQICQKQVKYLGYLLKEGQRWLTEARKETVMGQPTPKTPRQLREFLGKAGFCRLFIPGFAEMAAPLYPLTKPGTLFNWGPDQQKAYQEIKQ ALLTAPALGLPDLTKPFELFVDEKQGYAKGVLTQKLGPWRRPVAYLSKKLDPVAAGWPPCLRMVAAIAVLT KDAGKLTMGQPLVILAPHAVEALVKQPPDRWLSNARMTHYQALLLDTDRVQFGPWALNPATLLPLPEEG LQHNCLDILAEAHGTRPDLTDQPLPDADHTWYTDGSSLLQEGQRKAGAAVTTETEVIWAKALPAGTSAQ RAELIALTQALKMAEGKKLNVYTDSRYAFATAHIHGEIYRRRGWLTSEGKEIKNKDEILALLKALFLPKRLSII HCPGHQKGHSAEARGNRMADQAARKAAITETPDTSTLLIENSSP (SEQ ID NO:256) (see, Chen et al., 2021 , Cell 184(22):5635-5652, the contents of which are incorporated herein by reference in their entireties).

[0159] Another exemplary reverse transcriptase comprises the amino acid sequenceISSSKHTLSQMNKVSNIVKEPELPDIYKEFKDITADTNTEKLPKPIKGLEFEVELTQENYRLPIRNYPLTPVK MQAMNDEINQGLKGGIIRESKAINACPVIFVPRKEGTLRMWDYRPLNKYVKPNVYPLPLIEQLLAKIQGST IFTKLDLKSAYHQIRVRKGDEHKLAFRCPRGVFEYLVMPYGIKTAPAHFQYFINTILGEAKESHWCYMDDI LIHSKSESEHVKHVKDVLQKLKNANLIINQAKCEFHQSQVKFLGYHISEKGLTPCQENIDKVLQWKQPKNQ KELRQFLGQVNYLRKFIPKTSQLTHPLNKLLKKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLE TDVSDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSDKEMLAIIKSLEHWRHYLESTIEPFKILTD HRNLIGRITNESEPENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIVDETEPIPKDNEDNSINFVNQI SIS (SEQ ID NO:257) (see, Doman et al., 2023, Cell 186(18):3983-4002, the contents of which are incorporated herein by reference in their entireties).

[0160] In some embodiments, a reverse transcriptase fusion partner comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% amino acid sequence identity to SEQ ID NO:256 or SEQ ID NO:257.

[0161] Type V Cas proteins of the disclosure in the form of a fusion protein comprising a reverse transcriptase (RT) can be used as a prime editor to carry out precise DNA editing without doublestranded DNA breaks.

[0162] In some embodiments, a Type V Cas protein described herein can be used for prime editing, e.g., with different Circular RNA-mediated Prime Editors (CPEs) for various editing scenarios: for example a nickase-dependent CPE (niCPE), a nuclease-dependent CPE (nuCPE), a split nickasedependent CPE (sniCPE), or a split nuclease-dependent CPE (snuCPE) (Liang et al., 2004, Nature Biotechnology doi.org / 10.1038 / s41587-023-02095-x).

[0163] In some embodiments, a fusion protein of the disclosure comprises one or more nuclear localization signals positioned N-terminal and / or C-terminal to a Type V Cas protein sequence (e.g., a Type V Cas protein comprising an amino acid sequence set forth in Section 6.2). In some embodiments, a fusion protein of the disclosure comprises a C-terminal nuclear localization signal, for example having the sequence KRTADGSEFESPKKKRKV (SEQ ID NO:122). In some embodiments, a fusion protein of the disclosure comprises a N-terminal nuclear localization signal, for example having the sequence KRTADGSEFESPKKKRKV (SEQ ID NO:122). In some embodiments, a fusion protein of the disclosure comprises a N-terminal and a C-terminal nuclear localization signal, for example each having the sequence KRTADGSEFESPKKKRKV (SEQ ID NO:122).

[0164] The disclosure provides chimeric Type V Cas proteins comprising one or more domains of an ZWGD Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZJHK Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZIKV Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZZFT Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an YYAN Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZZGY Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZKBG Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZZKD Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZXPB Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZPPX Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZXHQ Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZQKH Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZRGM Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZTAE Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZSQQ Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZSYN Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZRBH Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZWPU Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZZQE Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins); a chimeric Type V Cas proteins comprising one or more domains of an ZRXE Type V Cas protein and one or more domains of one or more different proteins (e.g., one or more different Type V Cas proteins).

[0165] The domain structures of the Type V Cas proteins described herein were inferred by multiple alignment with the amino acid sequences of Type V Cas proteins for which the crystal structure is known and for which it is thus possible to define the boundaries of each functional domain. The domains identified in Type V Cas proteins are: wedge (WED) domain (WED-1 domain, WED-II domain, WED-III domain), the RuvC catalytic domain (discontinuous, represented by RuvC-l domain, RuvC-ll domain, RuvCIII domain), recognition (REC) domain (REC1 domain, REC2 domain), , PAM-interacting domain (PI domain), bridge helix (BH domain), and nuclease (NUC) domain,

[0166] Table 4 below report the amino acid positions corresponding to the boundaries between different functional domains in full-length wild-type ZWGD (SEQ ID NO:2), ZJHK (SEQ ID NO:8), ZIKV (SEQ ID NO:14), ZZFT (SEQ ID NO:20), YYAN (SEQ ID NO:26), ZZGY (SEQ ID NO:32), ZKBG (SEQ ID NO:38), ZZKD (SEQ ID NO:44), ZXPB (SEQ ID NQ:50), ZPPX (SEQ ID NO:56), ZXHQ (SEQ ID NO:62), ZQKH (SEQ ID NO:68), ZRGM (SEQ ID NO:74), ZTAE (SEQ ID NQ:80), ZSQQ (SEQ ID NO:86), ZSYN (SEQ ID NO:92), ZRBH (SEQ ID NO:98), ZWPU (SEQ ID NQ:104), ZZQE (SEQ ID NQ:110), and ZRXE (SEQ ID NO:116) Type V Cas proteins.

[0167] A chimeric Type V Cas protein can comprise one of more of the following domains (e.g., one or more, two or more, three or more, four or more, five or more, six or more, seven or more) from a ZWGD Type V Cas protein, a ZJHK Type V Cas protein, a ZIKV Type V Cas protein, a ZZFT Type V Cas protein, a YYAN Type V Cas protein, a ZZGY Type V Cas protein, a ZKBG Type V Cas protein, a ZZKD Type V Cas protein, a ZXPB Type V Cas protein, a ZPPX Type V Cas protein, a ZXHQ Type V Cas protein, a ZQKH Type V Cas protein, a ZRGM Type V Cas protein, a ZTAE Type V Cas protein, a ZSQQ Type V Cas protein, a ZSYN Type V Cas protein, a ZRBH Type V Cas protein, a ZWPU Type V Cas protein, a ZZQE Type V Cas protein, and / or a ZRXE Type V Cas protein, and one or more domains from one or more other proteins, for example Cas12a: WED-1 domain, REC1 domain, REC2 domain, WED-II domain, PI domain, WED-III domain, RuvC-l domain, BH domain, RuvC-ll domain, NUC domain, or RuvC-lll domain. For example, the PID domain can be swapped between different Type V Cas proteins to change the PAM specificity of the resulting chimeric protein (which is given by the donor PID domain). Swapping of other domains or portions of them is also within the scope of the disclosure (e.g. , through protein shuffling).

[0168] In some embodiments, a Type V Cas protein of the disclosure comprises one, two, three, four, five, six, seven, or eight of a a WED-1 domain, REC1 domain, REC2 domain, WED-II domain, PI domain, WED-III domain, RuvC-l domain, BH domain, RuvC-ll domain, NUC domain, or RuvC-lll domain arranged in the N-terminal to C-terminal direction. In some embodiments, all domains are from one TypeV Cas protein as described herein, e.g., ZWGD, ZJHK, ZIKV), ZZFT, YYAN, ZZGY, ZKBG, ZZKD, ZXPB, ZPPX, ZXHQ, ZQKH, ZRGM, ZTAE, ZSQQ, ZSYN, ZRBH, ZWPU, ZZQE, or ZRXE. In other embodiments, one or more domains {e.g., one domain), e.g., a PID domain, is from another Type V Cas protein, for example a Cas12a protein from Alicyclobacillus acidoterrestris , Bacillus thermoamylovorans , Lachnospiraceae bacterium e.g., LbCas12a, NCBI Reference Sequence WP_051666128.1), Acidaminococcus sp. BV3L6 {e.g., AsCas12a, NCBI Reference Sequence WP_021736722.1), Arcobacter butzleri L348 {e.g., AbCas12a, GeneBank ID: JAIQ01000039.1), Agathobacter rectalisstrain 2789STDY5834884 {e.g., ArCas12a, GeneBank ID: CZAJ01000001 .1), Bacteroidetes oraltaxon 274 str. F0058 {e.g., BoCas12a, GeneBank ID: NZ_GG774890.1), Butyrivibrio sp. NC3005 {e.g., BsCas12a, GeneBank ID: NZ_AUKC01000013.1), Candidate division WS6 bacterium GW2011_GWA2_37_6 US52_C0007 {e.g., C6Cas12a, GeneBank ID: LBTH01000007.1), Helcococcus kunzii ATCC 51366 {e.g., HkCas12a, GeneBank ID: JH601088.1 / AGEI01000022.1), Lachnospira pectinoschiza strain 2789STDY5834836 {e.g., LpCas12a, GeneBank ID: CZAK01000004.), Oribacterium sp. NK2B42 {e.g., OsCas12a, GeneBank ID: NZ_KE384190.1), Pseudobutyrivibrio ruminis CF1 b {e.g., PrCas12a, GeneBank ID: NZ_KE384121.1), Proteocatella sphenisci DSM 23131 {e.g., PsCas12a, GeneBank ID: NZ_KE384028.1), Pseudobutyrivibrio xylanivoransstrain DSM 10317 {e.g., PxCas12a, GeneBank ID: FMWK01000002.1), Sneathia amniistrain SN35 {e.g., SaCas12a, GeneBank ID: CP011280.1), Francisella novicida, or Leptotrichia shahii.\n addition, one or more amino acid substitutions can be introduced in one or more domains to modify the properties of the resulting nuclease in terms of editing activity, targeting specificity or PAM recognition specificity. For example, one or more amino acid substitutions can be introduced to provide nickase activity. Exemplary amino acid substitutions in Cas12a providing nickase activity are the D908, E993, R1226 and D1263. Corresponding substitutions can be introduced into the Type V Cas nucleases of the disclosure to provide nickases and catalytically inactive Cas proteins. Positions corresponding to such Cas12a positions for Type V Cas proteins of the disclosure as shown in Table 5. Nickases and catalytically inactive Type V Cas proteins of the disclosure can be used, for example, in base editors comprising a cytosine or adenosine deaminase fusion partner. Catalytically inactive Type V Cas proteins can also be used, for example, as fusion partners for transcriptional activators or repressors.6.3. Guide RNAs

[0169] The disclosure provides crRNA scaffolds and gRNA molecules that can be used with Type V Cas proteins of the disclosure to edit genomic DNA, for example mammalian DNA, e.g., human DNA. gRNAs of the disclosure typically comprise a spacer of 15 to 30 nucleotides in length. The spacer can be positioned 3’ of a crRNA scaffold to form a full gRNA.

[0170] An exemplary crRNA scaffold sequence that can be used for ZWGD Type V Cas gRNAs comprises ACGAUUAGAAAUAAUUUCUACUGUUGUAGAU (SEQ ID NO:144).

[0171] An exemplary crRNA scaffold sequence that can be used for ZJHK Type V Cas gRNAs comprises CUUUGAAAGAAUAUAAUUUCUACUGAAAGUGUAGAU (SEQ ID NO:145).

[0172] An exemplary crRNA scaffold sequence that can be used for ZIKV Type V Cas gRNAs comprises GUUUAAUAAUAAUACAUAAUUUCUACUAUUGUAGAU (SEQ ID NO:146).

[0173] An exemplary crRNA scaffold sequence that can be used for ZZFT Type V Cas gRNAs comprises GUCUAUAAGACUAAUUUAAUUUCUACUAUUGUAGAU (SEQ ID NO:147).

[0174] An exemplary crRNA scaffold sequence that can be used for YYAN Type V Cas gRNAs comprises GUUUAUAAACCUUAUCUAAUUUCUACUGUUGUAGAU (SEQ ID NO:148).

[0175] An exemplary crRNA scaffold sequence that can be used for ZZGY Type V Cas gRNAs comprises UCUAAAGCUCUUUAAGAAUUUCUACUUUCGUAGAU (SEQ ID NO: 149).

[0176] An exemplary crRNA scaffold sequence that can be used for ZKBG Type V Cas gRNAs comprises CUAAGAGGCUCAAAUAAUUUCUACUAUUGUAGAU (SEQ ID NO:150).

[0177] An exemplary crRNA scaffold sequence that can be used for ZZKD Type V Cas gRNAs comprises CCUUUGGAAGUACUAAGAAUUUCUACUGUUGUAGAU (SEQ ID NO:151).

[0178] An exemplary crRNA scaffold sequence that can be used for ZZKD Type V Cas gRNAs comprises GAAUUUCUACUGUUGUAGAU (SEQ ID NO:211).

[0179] An exemplary crRNA scaffold sequence that can be used for ZXPB Type V Cas gRNAs comprises GGCUAUAAAAGCCAUAUAAUUUCUACUAUUGUAGAU (SEQ ID NO:152).

[0180] An exemplary crRNA scaffold sequence that can be used for ZPPX Type V Cas gRNAs comprises GACUAUUAAGUCUUUUGAAUUUCUACUGUUGUAGAU (SEQ ID NO:153).

[0181] An exemplary crRNA scaffold sequence that can be used for ZXHQ Type V Cas gRNAs comprises UCUAGAAUAUAUAGGUAAUUUCUACUUAUGUAGAU (SEQ ID NO:154).

[0182] An exemplary crRNA scaffold sequence that can be used for ZQKH Type V Cas gRNAs comprises GGCAAUAAGCCAUAUACAAUUUCUACUGUAUGUAGAU (SEQ ID NO:155).

[0183] An exemplary crRNA scaffold sequence that can be used for ZRGM Type V Cas gRNAs comprises GUCUGAAAGACUAUAUAAUUUCUACUUCGUGUAGAU (SEQ ID NO:156).

[0184] An exemplary crRNA scaffold sequence that can be used for ZRGM Type V Cas gRNAs comprises AAUUUCUACUUCGUGUAGAU (SEQ ID NO:213).

[0185] An exemplary crRNA scaffold sequence that can be used for ZTAE Type V Cas gRNAs comprises GUCUACGGAACGUCUGUAAUUUCUACUGUUGUAGAU (SEQ ID NO:157).

[0186] An exemplary crRNA scaffold sequence that can be used for ZSQQ Type V Cas gRNAs comprises UUUAAACGAACUAUUAAAUUUCUACUGUUGUAGAU (SEQ ID NO:158).

[0187] An exemplary crRNA scaffold sequence that can be used for ZSYN Type V Cas gRNAs comprises GUUUAAUACUUAUAUAUAAUUUCUACUAUUGUAGAU (SEQ ID NO:159).

[0188] An exemplary crRNA scaffold sequence that can be used for ZRBH Type V Cas gRNAs comprises AAUAAUAAUCCCUUAUAAUUUCUACUUUUGUAGAU (SEQ ID NQ:160).

[0189] An exemplary crRNA scaffold sequence that can be used for ZWPU Type V Cas gRNAs comprises GUCUAUAAGACGAACUAAAUUUCUACUAUUGUAGAU (SEQ ID NO:161).

[0190] An exemplary crRNA scaffold sequence that can be used for ZZQE Type V Cas gRNAs comprises GGCUACUAAGCCUUUAUAAUUUCUACUAUUGUAGAU (SEQ ID NO:162).

[0191] An exemplary crRNA scaffold sequence that can be used for ZZQE Type V Cas gRNAs comprises UAAUUUCUACUAUUGUAGAU (SEQ ID NO:212).

[0192] An exemplary crRNA scaffold sequence that can be used for ZRXE Type V Cas gRNAs comprises GUCUAUAAAGACGAAUGAAUUUCUACUAUUGUAGAU (SEQ ID NO:163).

[0193] Type V Cas gRNAs of the disclosure are generally 40-70 nucleotides long (e.g., 50 to 60 nucleotides long, 55 to 65 nucleotides long, or 55 to 60 nucleotides long), but gRNAs of other lengths are also contemplated. For example, a crRNA scaffold described herein can be trimmed to a shorter length or extended at the 5’ end (e.g., as described in Park et al., 2018, Nature Communications, 9:3313), which can be helpful for enhancing gene editing efficacy. Additionally, gRNAs of the disclosure can optionally be chemically modified, which can be useful, for example, to enhance serum stability of a gRNA (see,e.g., Park et al., 2018, Nature Communications, 9:3313). Chemical modifications are further discussed inSection 6.3.2.

[0194] Further optimization of the structure can be obtained by introducing targeted base changes into the stems of the gRNA to increase their stability and folding. Such base changes will preferably correspond to the introduction of G:C couples, which are known to generate the strongest Watson-Crick pairing. For the sake of clarity, these substitutions can consist in the introduction of a G or a C in a specific position of a stem together with a complementary substitution in another position of the gRNA sequence which is predicted to base pair with the former, for example according to available bioinformatic tools for RNA folding such as UNAfold or RNAfold.

[0195] Stem-loop trimming can also be exploited to stabilize desired secondary structures by removing portions of the guide RNA producing unwanted secondary structures through annealing with other regions of the RNA molecule6.3.1. Spacers

[0196] The spacer sequence is partially or fully complementary to a target sequence found in a genomic DNA sequence, for example a human genomic DNA sequence. For example, a spacer sequence can be partially or fully complementary to a nucleotide sequence in a gene having a disease causing mutation. A spacer that is partially complementary to a target sequence can have, for example, one, two, or three mismatches with the target sequence.

[0197] gRNAs of the disclosure can comprise a spacer that is 15 to 30 nucleotides in length (e.g., 15 to 25, 16 to 24, 17 to 23, 18 to 22, 19 to 21 , 18 to 30, 20 to 28, 22 to 26, or 23 to 25 nucleotides in length). In some embodiments, a spacer is 15 nucleotides in length. In other embodiments, a spacer is 16 nucleotides in length. In other embodiments, a spacer is 17 nucleotides in length. In other embodiments, a spacer is 18 nucleotides in length. In other embodiments, a spacer is 19 nucleotides in length. In other embodiments, a spacer is 20 nucleotides in length. In other embodiments, a spacer is 21 nucleotides in length. In other embodiments, a spacer is 22 nucleotides in length. In other embodiments, a spacer is 23 nucleotides in length. In other embodiments, a spacer is 24 nucleotides in length. In other embodiments, a spacer is 25 nucleotides in length. In other embodiments, a spacer is 26 nucleotides in length. In other embodiments, a spacer is 27 nucleotides in length. In other embodiments, a spacer is 28 nucleotides in length. In other embodiments, a spacer is 29 nucleotides in length. In other embodiments, a spacer is 30 nucleotides in length.

[0198] Type V Cas endonucleases require a specific sequence, called a protospacer adjacent motif (PAM) that is upstream (e.g., directly upstream) of the target sequence on the non-target strand. Thus, spacer sequences for targeting a gene of interest can be identified by scanning the gene for PAM sequences recognized by the Type V Cas protein. Exemplary PAM sequences for Type V Cas proteins of the disclosure are shown in Table 6A-4B. In addition, TTTV is a canonical PAM sequence for Type V-A Cas proteins, and it expected that Type V Cas proteins of the disclosure can recognize the TTTV PAM.

[0199] Section 7 describes exemplary sequences that can be used to target B2M, TRAC and PD1 genes. Section 7 further describes exemplary sequences that can be used to target AAVS1, BCL11A, EMX1, PCSK9, VEGFA, and Match6 genomic sequences. Exemplary spacer sequences that can be used in gRNAs of the disclosure are set forth in Table 7. In some embodiments, a gRNA of the disclosure comprises a spacer sequence targeting TRAC. In some embodiments, a gRNA of the disclosure comprises a spacer sequence targeting B2M. In some embodiments, a gRNA of the disclosure comprises a spacer sequence targeting PD1. In some embodiments, a gRNA of the disclosure comprises a spacer sequence targeting AAVS1. In some embodiments, a gRNA of the disclosure comprises a spacer sequence targeting BCL11A. In some embodiments, a gRNA of the disclosure comprises a spacer sequence targeting EMX1. In some embodiments, a gRNA of the disclosure comprises a spacer sequence targeting PCSK9. In some embodiments, a gRNA of the disclosure comprises a spacer sequence targeting VEGFA. In some embodiments, a gRNA of the disclosure comprises a spacer sequence targeting Match6.

[0200] In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides from a sequence shown in Table 7. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 16 or more consecutive nucleotides from a sequence shown in Table 7. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 17 or more consecutive nucleotides from a sequence shown in Table 7. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 18 or more consecutive nucleotides from a sequence shown in Table 7. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 19 or more consecutive nucleotides from a sequence shown in Table 7. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 20 or more consecutive nucleotides from a sequence shown in Table 7. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 21 or more consecutive nucleotides from a sequence shown in Table 7. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 22 or more consecutive nucleotides from a sequence shown in Table 7. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 23 or more consecutive nucleotides from a sequence shown in Table 5. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises a sequence shown in Table 7.6.3.2. Modified gRNA Molecules

[0201] Guide RNAs can be readily synthesized by chemical means, enabling a number of modifications to be readily incorporated, as described in the art. The disclosed gRNA e.g., sgRNA) molecules can be unmodified or can contain any one or more of an array of chemical modifications.

[0202] While chemical synthetic procedures are continually expanding, purifications of such RNAs by procedures such as high-performance liquid chromatography (HPLC, which avoids the use of gels such as PAGE) tends to become more challenging as polynucleotide lengths increase significantly beyond a hundred or so nucleotides. One approach that can be used for generating chemically modified RNAs of greater length is to produce two or more molecules that are ligated together. Much longer RNAs, such as those encoding a Type V Cas endonuclease, are more readily generated enzymatically. While fewer types of modifications are available for use in enzymatically produced RNAs, there are still modifications that can be used to, for instance, enhance stability, reduce the likelihood or degree of innate immune response, and / or enhance other attributes, as described herein and in the art.

[0203] By way of illustration of various types of modifications, especially those used frequently with smaller chemically synthesized RNAs, modifications can comprise one or more nucleotides modified at the 2' position of the sugar, for instance a 2'-O-alkyl, 2'-O-alkyl-O-alkyl, or 2'-fluoro-modified nucleotide. In some examples, RNA modifications can comprise 2'-fluoro, 2'-amino or 2'-O-methyl modifications on the ribose of pyrimidines, abasic residues, or an inverted base at the 3' end of the RNA. Such modificationscan be routinely incorporated into oligonucleotides and these oligonucleotides have been shown to have a higher Tm (thus, higher target binding affinity) than 2'-deoxyoligonucleotides against a given target.

[0204] A number of nucleotide and nucleoside modifications have been shown to make the oligonucleotide into which they are incorporated more resistant to nuclease digestion than the native oligonucleotide; these modified oligos survive intact for a longer time than unmodified oligonucleotides. Specific examples of modified oligonucleotides include those comprising modified backbones, for example, phosphorothioates, phosphotriesters, methyl phosphonates, short chain alkyl or cycloalkyl intersugar linkages or short chain heteroatomic or heterocyclic intersugar linkages. Some oligonucleotides are oligonucleotides with phosphorothioate backbones and those with heteroatom backbones, particularly CH2-NH-O-CH2, CH,~N(CH3)-O-CH2 (known as a methylene(methylimino) or MMI backbone), CH2-O-N (CH3)-CH2, CH2-N (CH3)-N (CH3)-CH2and O-N (CH3)- CH2-CH2backbones, wherein the native phosphodiester backbone is represented as O- P- O- CH,); amide backbones (see De Mesmaeker et al. 1995, Ace. Chem. Res., 28:366-374); morpholino backbone structures (see U.S. Patent No. 5,034,506); peptide nucleic acid (PNA) backbone (wherein the phosphodiester backbone of the oligonucleotide is replaced with a polyamide backbone, the nucleotides being bound directly or indirectly to the aza nitrogen atoms of the polyamide backbone, see Nielsen et al., 1991 , Science 254:1497). Phosphorus-containing linkages include, but are not limited to, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates comprising 3'alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates comprising 3'-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3'-5' to 5'-3' or 2'-5' to 5'-2'; see U.S. Patent Nos. 3,687,808; 4,469,863; 4,476,301 ; 5,023,243; 5,177,196; 5,188,897; 5,264,423; 5,276,019; 5,278,302; 5,286,717; 5,321 ,131 ; 5,399,676; 5,405,939; 5,453,496; 5,455,233; 5,466,677; 5,476,925; 5,519,126; 5,536,821 ; 5,541 ,306; 5,550,111 ; 5,563,253; 5,571 ,799; 5,587,361 ; and 5,625,050.

[0205] Morpholino-based oligomeric compounds are described in Braasch and David Corey, 2002, Biochemistry, 41 (14):4503-4510; Genesis, Volume 30, Issue 3, (2001); Heasman, 2002, Dev. Biol., 243: 209-214; Nasevicius et al., 2000, Nat. Genet., 26:216-220; Lacerra et al., 2000, Proc. Natl. Acad. Sci., 97: 9591-9596; and U.S. Patent No. 5,034,506.

[0206] Cyclohexenyl nucleic acid oligonucleotide mimetics are described in Wang et al., 2000, J. Am. Chem. Soc., 122: 8595-8602.

[0207] Modified oligonucleotide backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic intemucleoside linkages. These comprise those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S, and CH2 component parts;see U.S. Patent Nos. 5,034,506; 5,166,315; 5,185,444; 5,214,134; 5,216,141 ; 5,235,033; 5,264,562; 5,264,564; 5,405,938; 5,434,257; 5,466,677; 5,470,967; 5,489,677; 5,541 ,307; 5,561 ,225; 5,596,086; 5,602,240; 5,610,289; 5,602,240; 5,608,046; 5,610,289; 5,618,704; 5,623,070; 5,663,312; 5,633,360; 5,677,437; and 5,677,439.

[0208] One or more substituted sugar moieties can also be included, e.g., one of the following at the 2' position: OH, SH, SCH3, F, OCN, OCH3, OCH3O(CH2)n CH3, O(CH2)n NH2, or O(CH2)n CH3, where n is from 1 to about 10; Ci to C10 lower alkyl, alkoxyalkoxy, substituted lower alkyl, alkaryl or aralkyl; Cl; Br; ON; CF3; OCF3; O-, S-, or bi- alkyl; O-, S-, or N-alkenyl; SOCH3; SO2CH3; ONO2; NO2; N3; NH2; heterocycloalkyl; heterocycloalkaryl; aminoalkylamino; polyalkylamino; substituted silyl; an RNA cleaving group; a reporter group; an intercalator; a group for improving the pharmacokinetic properties of an oligonucleotide; or a group for improving the pharmacodynamic properties of an oligonucleotide and other substituents having similar properties. In some aspects, a modification includes 2'-methoxyethoxy (2'-O-CH2CH2OCH3, also known as 2'-O-(2-methoxyethyl)) (Martin et al., 1995, Helv. Chim. Acta, 78, 486). Other modifications include 2'-methoxy (2'-O-CH3), 2'-propoxy (2'- OCH2CH2CH3) and 2'-fluoro (2 - F). Similar modifications can also be made at other positions on the oligonucleotide, particularly the 3' position of the sugar on the 3' terminal nucleotide and the 5' position of 5' terminal nucleotide.Oligonucleotides can also have sugar mimetics, such as cyclobutyls in place of the pentofuranosyl group.

[0209] In some examples, both a sugar and an internucleoside linkage (in the backbone) of the nucleotide units can be replaced with novel groups. The base units can be maintained for hybridization with an appropriate nucleic acid target compound. One such oligomeric compound, an oligonucleotide mimetic that has been shown to have excellent hybridization properties, is referred to as a peptide nucleic acid (PNA). In PNA compounds, the sugar- backbone of an oligonucleotide can be replaced with an amide containing backbone, for example, an aminoethylglycine backbone. The nucleobases can be retained and bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone. Representative U.S. patents that teach the preparation of PNA compounds include, but are not limited to, U.S. Patent Nos. 5,539,082; 5,714,331 ; and 5,719,262. Further teaching of PNA compounds can be found in Nielsen et al. , 1991 , Science, 254: 1497-1500.

[0210] RNAs such as guide RNAs can also include, additionally or alternatively, nucleobase (often referred to in the art simply as "base") modifications or substitutions. As used herein, "unmodified" or "natural" nucleobases include adenine (A), guanine (G), thymine (T), cytosine (C), and uracil (U).Modified nucleobases include nucleobases found only infrequently or transiently in natural nucleic acids, e.g., hypoxanthine, 6-methyladenine, 5-Me pyrimidines, particularly 5- methylcytosine (also referred to as 5-methyl-2' deoxy cytosine and often referred to in the art as 5-Me-C), 5-hydroxymethylcytosine (HMC), glycosyl HMC and gentobiosyl HMC, as well as synthetic nucleobases, e.g., 2-aminoadenine, 2- (methylamino) adenine, 2- (imidazolylalkyl)adenine, 2-(aminoalklyamino) adenine or other heterosub stituted alkyladenines, 2-thiouracil, 2-thiothymine, 5-bromouracil, 5-hydroxymethyluracil, 8-azaguanine, 7- deazaguanine, N6 (6-aminohexyl) adenine, and 2,6-diaminopurine. Kornberg, A., DNA Replication, W. H. Freeman & Co., San Francisco, pp. 75-77 (1980); Gebeyehu et al., Nucl. Acids Res. 15:4513 (1997). A "universal" base known in the art, e.g., inosine, can also be included. 5-Me-C substitutions have been shown to increase nucleic acid duplex stability by about 0.6-1 .2 °C. (Sanghvi, Y. S., in Crooke, S. T. andLebleu, B., eds., Antisense Research and Applications, CRC Press, Boca Raton, 1993, pp. 276-278) and are aspects of base substitutions.

[0211] Modified nucleobases can comprise other synthetic and natural nucleobases, such as 5- methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouraci I, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudo-uracil), 4-thiouraci I, 8-halo, 8-amino, 8- thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5-substituted uracils and cytosines, 7-methylquanine and 7-methyladenine, 8- azaguanine and 8-azaadenine, 7-deazaguanine and 7-deazaadenine, and 3-deazaguanine and 3- deazaadenine.

[0212] Further, nucleobases can comprise those disclosed in U.S. Patent No. 3,687,808, those disclosed in 'The Concise Encyclopedia of Polymer Science and Engineering', 858-859, Kroschwitz, J.I., ed. John Wiley & Sons, 1990, those disclosed by Englisch et al., Angewandle Chemie, International Edition', 1991 , 30, p. 613, and those disclosed by Sanghvi, Y. S., Chapter 15, Antisense Research and Applications', 289-302, Crooke, S.T. and Lebleu, B. ea., CRC Press, 1993. Certain of these nucleobases can be useful for increasing the binding affinity of the oligomeric compounds of the invention. These include 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and O-6 substituted purines, comprising 2-aminopropyladenine, 5-propynyluracil and 5-propynylcytosine. 5-methylcytosine substitutions have been shown to increase nucleic acid duplex stability by about 0.6-1 .2°C (Sanghvi, Y.S., Crooke, S.T. and Lebleu, B., eds, 'Antisense Research and Applications', CRC Press, Boca Raton, 1993, 276-278) and are aspects of base substitutions, even more particularly when combined with 2'-O-methoxyethyl sugar modifications. Modified nucleobases are described in U.S. Patent No. 3,687,808, as well as 4,845,205; 5,130,302; 5,134,066; 5,175,273; 5,367,066; 5,432,272; 5,457,187; 5,459,255; 5,484,908; 5,502,177; 5,525,711 ; 5,552,540; 5,587,469; 5,596,091 ; 5,614,617; 5,681 ,941 ; 5,750,692; 5,763,588; 5,830,653;6,005,096; and U.S. Patent Application Publication 2003 / 0158403.

[0213] Thus, a modified gRNA can include, for example, one or more non-natural sugars, internucleotide linkages and / or bases. It is not necessary for all positions in a given gRNA to be uniformly modified, and in fact more than one of the aforementioned modifications can be incorporated in a single oligonucleotide, or even in a single nucleoside within an oligonucleotide.

[0214] The guide RNAs and / or mRNA (or DNA) encoding an endonuclease can be chemically linked to one or more moieties or conjugates that enhance the activity, cellular distribution, or cellular uptake of the oligonucleotide. Such moieties comprise, but are not limited to, lipid moieties such as a cholesterol moiety (Letsinger et al. 1989, Proc. Natl. Acad. Sci. USA, 86: 6553-6556); cholic acid (Manoharan et al, 1994, Bioorg. Med. Chem. Let., 4: 1053- 1060); a thioether, e.g., hexyl-S- tritylthiol (Manoharan et al, 1992, Ann. N. Y. Acad. Sci., 660: 306-309; Manoharan et al., 1993, Bioorg. Med. Chem. Let., 3: 2765- 2770); a thiocholesterol (Oberhauser et al., 1992, Nucl. Acids Res., 20: 533-538); an aliphatic chain, e.g., dodecandiol or undecyl residues (Kabanov et al, 1990, FEBS Lett., 259: 327-330; Svinarchuk et al, 1993, Biochimie, 75: 49- 54); a phospholipid, e.g., di-hexadecyl-rac-glycerol or triethylammonium 1 ,2-di-O- hexadecyl-rac-glycero-3-H-phosphonate (Manoharan et al., 1995, Tetrahedron Lett., 36: 3651-3654; andShea et al, 1990, Nucl. Acids Res., 18: 3777-3783); a polyamine or a polyethylene glycol chain (Mancharan et al, 1995, Nucleosides & Nucleotides, 14: 969-973); adamantane acetic acid (Manoharan et al, 1995, Tetrahedron Lett., 36: 3651-3654); a palmityl moiety (Mishra et al., 1995, Biochim. Biophys. Acta, 1264: 229- 237); or an octadecylamine or hexylamino-carbonyl-t oxycholesterol moiety (Crooke et al, 1996, J. Pharmacol. Exp. Ther., 277: 923-937). See also U.S. Patent Nos. 4,828,979; 4,948,882; 5,218,105; 5,525,465; 5,541 ,313; 5,545,730; 5,552,538; 5,578,717; 5,580,731 ; 5,580,731 ; 5,591 ,584; 5,109,124; 5,118,802; 5,138,045; 5,414,077; 5,486,603; 5,512,439; 5,578,718; 5,608,046; 4,587,044; 4,605,735; 4,667,025; 4,762,779; 4,789,737; 4,824,941 ; 4,835,263; 4,876,335; 4,904,582; 4,958,013; 5,082,830; 5,112,963; 5,214,136; 5,082,830; 5,112,963; 5,214,136; 5,245,022; 5,254,469; 5,258,506; 5,262,536; 5,272,250; 5,292,873; 5,317,098; 5,371 ,241 ; 5,391 ,723; 5,416,203; 5,451 ,463; 5,510,475; 5,512,667; 5,514,785; 5,565,552; 5,567,810; 5,574,142; 5,585,481 ; 5,587,371 ; 5,595,726; 5,597,696; 5,599,923; 5,599, 928 and 5,688,941.

[0215] Sugars and other moieties can be used to target proteins and complexes comprising nucleotides, such as cationic polysomes and liposomes, to particular sites. For example, hepatic cell directed transfer can be mediated via asialoglycoprotein receptors (ASGPRs); see, e.g., Hu, et al., 2014, Protein Pept Lett. 21 (10):1025-30. Other systems known in the art and regularly developed can be used to target biomolecules of use in the present case and / or complexes thereof to particular target cells of interest.

[0216] Targeting moieties or conjugates can include conjugate groups covalently bound to functional groups, such as primary or secondary hydroxyl groups. Conjugate groups of the present disclosure include intercalators, reporter molecules, polyamines, polyamides, polyethylene glycols, polyethers, groups that enhance the pharmacodynamic properties of oligomers, and groups that enhance the pharmacokinetic properties of oligomers. Typical conjugate groups include cholesterols, lipids, phospholipids, biotin, phenazine, folate, phenanthridine, anthraquinone, acridine, fluoresceins, rhodamines, coumarins, and dyes. Groups that enhance the pharmacodynamic properties, in the context of this present disclosure, include groups that improve uptake, enhance resistance to degradation, and / or strengthen sequence-specific hybridization with the target nucleic acid. Groups that enhance the pharmacokinetic properties, in the context of this disclosure, include groups that improve uptake, distribution, metabolism or excretion of the compounds of the present disclosure. Representative conjugate groups are disclosed in International Patent Application Publication WO1993007883, and U.S. Patent No. 6,287,860. Conjugate moieties include, but are not limited to, lipid moieties such as a cholesterol moiety, cholic acid, a thioether, e.g., hexyl-5 -trityl thiol, a thiocholesterol, an aliphatic chain, e.g., dodecandiol or undecyl residues, a phospholipid, e.g., di-hexadecyl-rac- glycerol or triethylammonium 1 ,2-di-O-hexadecyl-rac-glycero-3-H-phosphonate, a polyamine or a polyethylene glycol chain, or adamantane acetic acid, a palmityl moiety, or an octadecylamine or hexylamino-carbonyl- oxy cholesterol moiety. See, e.g., U.S. Pat. Nos. 4,828,979; 4,948,882; 5,218,105; 5,525,465; 5,541 ,313; 5,545,730; 5,552,538; 5,578,717, 5,580,731 ; 5,580,731 ; 5,591 ,584; 5,109,124; 5,118,802; 5,138,045; 5,414,077; 5,486,603; 5,512,439; 5,578,718; 5,608,046; 4,587,044; 4,605,735; 4,667,025; 4,762,779; 4,789,737; 4,824,941 ; 4,835,263; 4,876,335; 4,904,582; 4,958,013; 5,082,830; 5,112,963; 5,214,136; 5,082,830; 5,112,963; 5,214,136; 5,245,022; 5,254,469; 5,258,506; 5,262,536; 5,272,250; 5,292,873;5,317,098; 5,371 ,241 ; 5,391 ,723; 5,416,203, 5,451 ,463; 5,510,475; 5,512,667; 5,514,785; 5,565,552; 5,567,810; 5,574,142; 5,585,481 ; 5,587,371 ; 5,595,726; 5,597,696; 5,599,923; 5,599,928 and 5,688,941.

[0217] A large variety of modifications have been developed and applied to enhance RNA stability, reduce innate immune responses, and / or achieve other benefits that can be useful in connection with the introduction of polynucleotides into human cells, as described herein; see, e.g., the reviews by Whitehead KA et al., 2011 , Annual Review of Chemical and Biomolecular Engineering, 2: 77-96;Gaglione and Messere, 2010, Mini Rev Med Chem, 10(7):578-95; Chernolovskaya et al, 2010, Curr Opin Mol Ther., 12(2): 158-67; Deleavey et al., 2009, Curr Protoc Nucleic Acid Chem Chapter 16:Unit 16.3; Behlke, 2008, Oligonucleotides 18(4):305-19; Fucini et al, 2012, Nucleic Acid Ther 22(3): 205-210; Bremsen et al, 2012, Front Genet 3: 154.6.4. Systems

[0218] The disclosure provides systems comprising a Type V Cas protein of the disclosure (e.g., as described in Section 6.2) and a means for targeting the Type V Cas protein to a target genomic sequence. The means for targeting the Type V Cas protein to a target genomic sequence can be a guide RNA (gRNA) (e.g., as described in Section 6.3).

[0219] The disclosure also provides systems comprising a Type V Cas protein of the disclosure (e.g., as described in Section 6.2) and a gRNA (e.g., as described in Section 6.3). The systems can comprise a ribonucleoprotein particle (RNP) in which a Type V Cas protein is complexed with a gRNA. Systems of the disclosure can in some embodiments further comprise genomic DNA complexed with the Type V Cas protein and the gRNA. Accordingly, the disclosure provides systems comprising a Type V Cas protein, a genomic DNA, and gRNA, all complexed with one another.

[0220] The systems of the disclosure can exist within a cell (whether the cell is in vivo, ex vivo, or in vitro) or outside a cell (e.g., in a particle our outside of a particle).6.5. Nucleic Acids

[0221] The disclosure provides nucleic acids (e.g., DNA or RNA) encoding Type V Cas proteins (e.g., a ZWGD Type V Cas protein, a ZJHK Type V Cas protein, a ZIKV Type V Cas protein, a ZZFT Type V Cas protein, a YYAN Type V Cas protein, a ZZGY Type V Cas protein, a ZKBG Type V Cas protein, a ZZKD Type V Cas protein, a ZXPB Type V Cas protein, a ZPPX Type V Cas protein, a ZXHQ Type V Cas protein, a ZQKH Type V Cas protein, a ZRGM Type V Cas protein, a ZTAE Type V Cas protein, a ZSQQ Type V Cas protein, a ZSYN Type V Cas protein, a ZRBH Type V Cas protein, a ZWPU Type V Cas protein, a ZZQE Type V Cas protein, or a ZRXE Type V Cas protein), nucleic acids encoding gRNAs of the disclosure (e.g., a single gRNA or combination of gRNAs), nucleic acids encoding both Type V Cas proteins and gRNAs, and pluralities of nucleic acids, for example comprising a nucleic acid encoding a Type V Cas protein and a gRNA.

[0222] A nucleic acid encoding a Type V Cas protein and / or gRNA can be, for example, a plasmid or a viral genome (e.g., a lentivirus, retrovirus, adenovirus, or adeno-associated virus genome). Plasmids can be, for example, plasmids for producing virus particles, e.g., lentivirus particles, or plasmids for propagating the Type V Cas and gRNA coding sequences in bacterial (e.g., E. coli) or eukaryotic (e.g., yeast) cells.

[0223] A nucleic acid encoding a Type V Cas protein can, in some embodiments, further encode a gRNA. Alternatively, a gRNA can be encoded by a separate nucleic acid (e.g., DNA or mRNA).

[0224] Nucleic acids encoding a Type V Cas protein can be codon optimized, e.g., where at least one non-common codon or less-common codon has been replaced by a codon that is common in a host cell. For example, a codon optimized nucleic acid can direct the synthesis of an optimized messenger mRNA, e.g., optimized for expression in a mammalian expression system. As an example, if the intended target nucleic acid is within a human cell, a human codon-optimized polynucleotide encoding Type V Cas can be used for producing a Type V Cas polypeptide. Exemplary codon-optimized sequences are shown in Tables 1A to 1T.

[0225] Nucleic acids of the disclosure, e.g., plasmids and viral vectors, can comprise one or more regulatory elements such as promoters, enhancers, and other expression control elements (e.g., transcription termination signals, such as polyadenylation signals and poly-U sequences). Such regulatory elements are described, for example, in Goeddel, 1990, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissuespecific regulatory sequences). A tissue-specific promoter may direct expression primarily in a desired tissue of interest or in particular cell types. Regulatory elements may also direct expression in a temporaldependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. In some embodiments, a nucleic acid of the disclosure comprises one or more pol III promoter (e.g., 1 , 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g., 1 , 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g., 1 , 2, 3, 4, 5, or more pol I promoters), or combinations thereof, e.g., to express a Type V Cas protein and a gRNA separately. Examples of pol III promoters include, but are not limited to, U6 and H1 promoters. Examples of pol II promoters include, but are not limited to, the retroviral Rous Sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) (see, e.g., Boshart et al, 1985, Cell 41 :521-530), the SV40 promoter, the dihydrofolate reductase promoter, the p-actin promoter, the phosphoglycerol kinase (PGK) promoter, and EF1a promoters (for example, full length EF1a promoter and the EFS promoter, which is a short, intron-less form of the full EF1a promoter). Exemplary enhancer elements include WPRE; CMV enhancers; the R- U5' segment in LTR of HTLV-I; SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit p-globin. It will be appreciated by those skilled in the art that the design of an expression vector can depend on such factors as the choice of the host cell, the level of expression desired, etc.

[0226] The term "vector" refers to a polynucleotide molecule capable of transporting another nucleic acid to which it has been linked. One type of polynucleotide vector includes a "plasmid", which refers to a circular double-stranded DNA loop into which additional nucleic acid segments are or can be ligated. Another type of polynucleotide vector is a viral vector; wherein additional nucleic acid segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into thegenome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.

[0227] In some examples, vectors can be capable of directing the expression of nucleic acids to which they are operably linked. Such vectors can be referred to herein as "recombinant expression vectors", or more simply "expression vectors", which serve equivalent functions.

[0228] The term "operably linked" means that the nucleotide sequence of interest is linked to regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence. The term "regulatory sequence" is intended to include, for example, promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are well known in the art and are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells, and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the target cell, the level of expression desired, and the like.

[0229] Vectors can include, but are not limited to, viral vectors based on vaccinia virus, poliovirus, adenovirus, adeno-associated virus (e.g., AAV2, AAV5, AAV7m8, AAV8, AAV9, AAVrh8r, AAVrhIO), SV40, herpes simplex virus, human immunodeficiency virus, retrovirus (e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, and mammary tumor virus) and other recombinant vectors. Other vectors contemplated for eukaryotic target cells include, but are not limited to, the vectors pXTI, pSG5, pSVK3, pBPV, pMSG, and pSVLSV40 (Pharmacia). Additional vectors contemplated for eukaryotic target cells include, but are not limited to, the vectors pCTx-l, pCTx-2, and pCTx-3. Other vectors can be used so long as they are compatible with the host cell.

[0230] In some examples, a vector can comprise one or more transcription and / or translation control elements. Depending on the host / vector system utilized, any of a number of suitable transcription and translation control elements, including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc. can be used in the expression vector. The vector can be a selfinactivating vector that either inactivates the viral sequences or the components of the CRISPR machinery or other elements.

[0231] Non-limiting examples of suitable eukaryotic promoters (promoters functional in a eukaryotic cell) include those from cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, early and late SV40, long terminal repeats (LTRs) from retrovirus, human elongation factor-l promoters (for example, the full EF1a promoter and the EFS promoter), a hybrid construct comprising the cytomegalovirus (CMV) enhancer fused to the chicken beta-actin promoter (CAG), murine stem cell virus promoter (MSCV), phosphoglycerate kinase-1 locus promoter (PGK), and mouse metallothionein-l.

[0232] An expression vector can also contain a ribosome binding site for translation initiation and a transcription terminator. The expression vector can also comprise appropriate sequences for amplifyingexpression. The expression vector can also include nucleotide sequences encoding non-native tags (e.g., histidine tag, hemagglutinin tag, green fluorescent protein, etc.) that are fused to the site-directed polypeptide, thus resulting in a fusion protein.

[0233] A promoter can be an inducible promoter (e.g., a heat shock promoter, tetracycline- regulated promoter, steroid-regulated promoter, metal-regulated promoter, estrogen receptor-regulated promoter, etc.). The promoter can be a constitutive promoter (e.g., CMV promoter, UBC promoter). In some cases, the promoter can be a spatially restricted and / or temporally restricted promoter (e.g., a tissue specific promoter, for example a human RHO promoter or human rhodopsin kinase promoter (hGRK), a cell type specific promoter, etc.).6.6. Particles and Cells

[0234] The disclosure further provides particles comprising a Type V Cas protein of the disclosure (e.g., a ZWGD Type V Cas protein, a ZJHK Type V Cas protein, a ZIKV Type V Cas protein, a ZZFT Type V Cas protein, a YYAN Type V Cas protein, a ZZGY Type V Cas protein, a ZKBG Type V Cas protein, a ZZKD Type V Cas protein, a ZXPB Type V Cas protein, a ZPPX Type V Cas protein, a ZXHQ Type V Cas protein, a ZQKH Type V Cas protein, a ZRGM Type V Cas protein, a ZTAE Type V Cas protein, a ZSQQ Type V Cas protein, a ZSYN Type V Cas protein, a ZRBH Type V Cas protein, a ZWPU Type V Cas protein, a ZZQE Type V Cas protein, or a ZRXE Type V Cas protein), particles comprising a gRNA of the disclosure, particles comprising a system of the disclosure, and particles comprising a nucleic acid or plurality of nucleic acids of the disclosure. The particles can in some embodiments comprise or further comprise a gRNA, or a nucleic acid encoding the gRNA (e.g., DNA or mRNA). For example, the particles can comprise a RNP of the disclosure. Exemplary particles include lipid nanoparticles, vesicles, viral-like particles (VLPs) and gold nanoparticles. See, e.g., WO 2020 / 012335, the contents of which are incorporated herein by reference in their entireties, which describes vesicles that can be used to deliver gRNA molecules and Type V Cas proteins to cells (e.g., complexed together as a RNP).

[0235] The disclosure provides particles (e.g., virus particles) comprising a nucleic acid encoding a Type V Cas protein of the disclosure. The particles can further comprise a nucleic acid encoding a gRNA. Alternatively, a nucleic acid encoding a Type V Cas protein can further encode a gRNA.

[0236] The disclosure further provides pluralities of particles (e.g., pluralities of virus particles). Such pluralities can include a particle encoding a Type V Cas protein and a different particle encoding a gRNA. For example, a plurality of particles can comprise a virus particle (e.g., an AAV2, AAV5, AAV7m8, AAV8, AAV9, AAVrh8r, or AAVrhl 0 virus particle) encoding a Type V Cas protein and a second virus particle (e.g., an AAV2, AAV5, AAV7m8, AAV8, AAV9, AAVrh8r, or AAVrhl 0 virus particle) encoding a gRNA. Alternatively, a plurality of particles can comprise a plurality of virus particles where each particle encodes a Type V Cas protein and a gRNA.

[0237] The disclosure further provides cells and populations of cells (e.g., ex vivo cells and populations of cells) that can comprise a Type V Cas protein (e.g., introduced to the cell as a RNP) or a nucleic acid encoding the Type V Cas protein (e.g., DNA or mRNA) (optionally also encoding a gRNA). The disclosure further provides cells and populations of cells comprising a gRNA of the disclosure (optionally complexed with a Type V Cas protein) or a nucleic acid encoding the gRNA (e.g., DNA or mRNA)(optionally also encoding a Type V Cas protein). The cells and populations of cells can be, for example, human cells such as a stem cell, e.g., a hematopoietic stem cell (HSC), a pluripotent stem cell, an induced pluripotent stem cell (iPS), or an embryonic stem cell. In some embodiments, the cells and populations of cells are T cells. Methods for introducing proteins and nucleic acids to cells are known in the art. For example, a RNP can be produced by mixing a Type V Cas protein and one or more guide RNAs in an appropriate buffer. An RNP can be introduced to a cell, for example, via electroporation and other methods known in the art.

[0238] The cell populations of the disclosure can be cells in which gene editing by the systems of the disclosure has taken place, or cells in which the components of a system of the disclosure have been introduced or expressed but gene editing has not taken place, or a combination thereof. A cell population can comprise, for example, a population in which at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, or at least 70% of the cells have undergone gene editing by a system of the disclosure.6.7. Pharmaceutical Compositions

[0239] Also disclosed herein are pharmaceutical formulations and medicaments comprising a Type V Cas protein, gRNA, nucleic acid or plurality of nucleic acids, system, particle, or plurality of particles of the disclosure together with a pharmaceutically acceptable excipient.

[0240] Suitable excipients include, but are not limited to, salts, diluents, (e.g., Tris-HCI, acetate, phosphate), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), binders, fillers, solubilizers, disintegrants, sorbents, solvents, pH modifying agents, antioxidants, antinfective agents, suspending agents, wetting agents, viscosity modifiers, tonicity agents, stabilizing agents, and other components and combinations thereof. Suitable pharmaceutically acceptable excipients can be selected from materials which are generally recognized as safe (GRAS), and may be administered to an individual without causing undesirable biological side effects or unwanted interactions. Suitable excipients and their formulations are described in Remington's Pharmaceutical Sciences, 16th ed. 1980, Mack Publishing Co. In addition, such compositions can be complexed with polyethylene glycol (PEG), metal ions, or incorporated into polymeric compounds such as polyacetic acid, polyglycolic acid, hydrogels, etc., or incorporated into liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts or spheroblasts. Suitable dosage forms for administration, e.g., parenteral administration, include solutions, suspensions, and emulsions.

[0241] The components of the pharmaceutical formulation can be dissolved or suspended in a suitable solvent such as, for example, water, Ringer's solution, phosphate buffered saline (PBS), or isotonic sodium chloride. The formulation may also be a sterile solution, suspension, or emulsion in a nontoxic, parenterally acceptable diluent or solvent such as 1 ,3-butanediol.

[0242] In some cases, formulations can include one or more tonicity agents to adjust the isotonic range of the formulation. Suitable tonicity agents are well known in the art and include glycerin, mannitol, sorbitol, sodium chloride, and other electrolytes. In some cases, the formulations can be buffered with an effective amount of buffer necessary to maintain a pH suitable for parenteral administration. Suitablebuffers are well known by those skilled in the art and some examples of useful buffers are acetate, borate, carbonate, citrate, and phosphate buffers.

[0243] In some embodiments, the formulation can be distributed or packaged in a liquid form, or alternatively, as a solid, obtained, for example by lyophilization of a suitable liquid formulation, which can be reconstituted with an appropriate carrier or diluent prior to administration. In some embodiments, the formulations can comprise a guide RNA and a Type V Cas protein in a pharmaceutically effective amount sufficient to edit a gene in a cell. The pharmaceutical compositions can be formulated for medical and / or veterinary use.6.8. Methods of Altering a Cell

[0244] The disclosure further provides methods of using the Type V Cas proteins, gRNAs, nucleic acids (including pluralities of nucleic acids), systems, and particles (including pluralities of particles) of the disclosure for altering cells.

[0245] In one aspect, a method of altering a cell comprises contacting a eukaryotic cell (e.g., a human cell) with a nucleic acid, particle, system or pharmaceutical composition described herein.

[0246] Contacting a cell with a disclosed nucleic acid, particle, system or pharmaceutical composition can be achieved by any method known in the art and can be performed in vivo, ex vivo, or in vitro. In some embodiments, the methods can include obtaining one or more cells from a subject prior to contacting the cell(s) with a herein disclosed nucleic acid, particle, system or pharmaceutical composition. In some embodiments, the methods can further comprise returning or implanting the contacted cell or a progeny thereof to the subject.

[0247] Type V Cas and gRNA, as well as nucleic acids encoding Type V Cas and gRNAs can be delivered to a cell by any means known in the art, for example, by viral or non-viral delivery vehicles, electroporation or lipid nanoparticles.

[0248] A polynucleotide encoding Type V Cas and a gRNA, can be delivered to a cell (ex vivo or in vivo) by a lipid nanoparticle (LNP). LNPs can have, for example, a diameter of less than 1000 nm, 500 nm, 250 nm, 200 nm, 150 nm, 100 nm, 75 nm, 50 nm, or 25 nm. Alternatively, a nanoparticle can range in size from 1-1000 nm, 1-500 nm, 1-250 nm, 25-200 nm, 25-100 nm, 35-75 nm, or 25-60 nm. LNPs can be made from cationic, anionic, neutral lipids, and combinations thereof. Neutral lipids, such as the fusogenic phospholipid DOPE or the membrane component cholesterol, can be included in LNPs as 'helper lipids' to enhance transfection activity and nanoparticle stability.

[0249] LNPs can also be comprised of hydrophobic lipids, hydrophilic lipids, or both hydrophobic and hydrophilic lipids. Lipids and combinations of lipids that are known in the art can be used to produce a LNP. Examples of lipids used to produce LNPs are: DOTMA, DOSPA, DOTAP, DMRIE, DC- cholesterol, DOTAP-cholesterol, GAP-DMORIE-DPyPE, and GL67A-DOPE-DMPE- polyethylene glycol (PEG). Examples of cationic lipids are: 98N12-5, C12-200, DLin-KC2- DMA (KC2), DLin-MC3-DMA (MC3), XTC, MD1 , and 7C1 . Examples of neutral lipids are: DPSC, DPPC, POPC, DOPE, and SM. Examples of PEG- modified lipids are: PEG-DMG, PEG- CerCI4, and PEG-CerC20. Lipids can be combined in any number of molar ratios to produce a LNP. In addition, the polynucleotide(s) can be combined with lipid(s) in a wide range of molar ratios to produce a LNP.

[0250] Type V Cas and / or gRNAs can be delivered to a cell via an adeno-associated viral vector (e.g., of an AAV2, AAV5, AAV7m8, AAV8, AAV9, AAVrh8r, or AAVrhIO serotype), or by another viral vector. Other viral vectors include, but are not limited to lentivirus, adenovirus, alphavirus, enterovirus, pestivirus, baculovirus, herpesvirus, Epstein Barr virus, papovavirus, poxvirus, vaccinia virus, and herpes simplex virus. In some embodiments, a Type V Cas mRNA is formulated in a lipid nanoparticle, while a sgRNA is delivered to a cell in an AAV or other viral vector. In some embodiments, one or more AAV vectors (e.g., one or more AAV2, AAV5, AAV7m8, AAV8, AAV9, AAVrh8r, or AAVrhIO serotype) are used to deliver both a sgRNA and a Type V Cas. In some embodiments, a Type V Cas and a sgRNA are delivered using separate vectors. In other embodiments, a Type V Cas and a sgRNA are delivered using a single vector. BNK Type V Cas and AIK Type V Cas, with their relatively small size, can be delivered with a gRNA (e.g., sgRNA) using a single AAV vector.

[0251] Compositions and methods for delivering Type V Cas and gRNAs to a cell and / or subject are further described in PCT Patent Application Publications WO 2019 / 102381 , WO 2020 / 012335, and WO 2020 / 053224, each of which is incorporated by reference herein in its entirety.

[0252] DNA cleavage can result in a single-strand break (SSB) or double-strand break (DSB) at particular locations within the DNA molecule. Such breaks can be and regularly are repaired by natural, endogenous cellular processes, such as homology-dependent repair (HDR) and non-homologous endjoining (NHEJ). These repair processes can edit the targeted polynucleotide by introducing a mutation, thereby resulting in a polynucleotide having a sequence which differs from the polynucleotide’s sequence prior to cleavage by a Type V Cas.

[0253] NHEJ and HDR DNA repair processes consist of a family of alternative pathways. Non- homologous end-joining (NHEJ) refers to the natural, cellular process in which a double-stranded DNA- break is repaired by the direct joining of two non-homologous DNA segments. See, e.g. Cahill et al., 2006, Front. Biosci. 11 :1958-1976. DNA repair by non-homologous end-joining is error-prone and frequently results in the untemplated addition or deletion of DNA sequences at the site of repair. Thus, NHEJ repair mechanisms can introduce mutations into the coding sequence which can disrupt gene function. NHEJ directly joins the DNA ends resulting from a double-strand break, sometimes with a modification of the polynucleotide sequence such as a loss of or addition of nucleotides in the polynucleotide sequence. The modification of the polynucleotide sequence can disrupt (or perhaps enhance) gene expression.

[0254] Homology-dependent repair (HDR) utilizes a homologous sequence, or donor sequence, as a template for inserting a defined DNA sequence at the break point. The homologous sequence can be in the endogenous genome, such as a sister chromatid. Alternatively, the donor can be an exogenous nucleic acid, such as a plasmid, a single-strand oligonucleotide, a double- stranded oligonucleotide, a duplex oligonucleotide or a virus, that has regions of high homology with the nuclease-cleaved locus, but which can also contain additional sequence or sequence changes including deletions that can be incorporated into the cleaved target locus.

[0255] A third repair mechanism includes microhomology-mediated end joining (MMEJ), also referred to as “Alternative NHEJ (ANHEJ)”, in which the genetic outcome is similar to NHEJ in that small deletionsand insertions can occur at the cleavage site. MMEJ can make use of homologous sequences of a few base pairs flanking the DNA break site to drive a more favored DNA end joining repair outcome. In some instances, it may be possible to predict likely repair outcomes based on analysis of potential microhomologies at the site of the DNA break.

[0256] Modifications of a cleaved polynucleotide by HDR, NHEJ, and / or ANHEJ can result in, for example, mutations, deletions, alterations, integrations, gene correction, gene replacement, gene tagging, transgene insertion, nucleotide deletion, gene disruption, translocations and / or gene mutation. The aforementioned process outcomes are examples of editing a polynucleotide.

[0257] When performing prime editing, e.g., with a prime editor comprising a Type V Cas protein of the disclosure that comprises a reverse transcriptase, a DNA mismatch repair (MMR) inhibitor can be used in conjunction with the prime editor. Use of MMR inhibitors have been reported to enhance efficiency of prime editing (see, e.g., Chen et al., 2021 Cell 184(22):5635-5652, the contents of which are incorporated herein by reference in their entireties). An exemplary MMR inhibitor is MLHIdn, having the amino acid sequenceSFVAGVIRRLDETWNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDI VCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQ GTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRS IFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFL YLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGI-AGPSGEMVKS TTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEML ELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRII NLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFG VLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLID NYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWT VEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVF (SEQ ID NO:258).

[0258] In some embodiments, an MMR inhibitor is provided in trans with a prime editor.

[0259] Advantages of ex vivo cell therapy approaches include the ability to conduct a comprehensive analysis of the therapeutic prior to administration. Nuclease-based therapeutics can have some level of off-target effects. Performing gene correction ex vivo allows a method user to characterize the corrected cell population prior to implantation, including identifying any undesirable off-target effects. Where undesirable effects are observed, a method user may opt not to implant the cells or cell progeny, may further edit the cells, or may select new cells for editing and analysis. Other advantages include ease of genetic correction in iPSCs compared to other primary cell sources. iPSCs are prolific, making it easy to obtain the large number of cells that will be required for a cell-based therapy. Furthermore, iPSCs are an ideal cell type for performing clonal isolations. This allows screening for the correct genomic correction, without risking a decrease in viability.

[0260] Although certain cells present an attractive target for ex vivo treatment and therapy, increased efficacy in delivery may permit direct in vivo delivery to such cells. Ideally the targeting and editing isdirected to the relevant cells. Cleavage in other cells can also be prevented by the use of promoters only active in certain cell types and / or developmental stages.

[0261] Additional promoters are inducible, and therefore can be temporally controlled if the nuclease is delivered as a plasmid. The amount of time that delivered protein and RNA remain in the cell can also be adjusted using treatments or domains added to change the half-life. In vivo treatment would eliminate a number of treatment steps, but a lower rate of delivery can require higher rates of editing. In vivo treatment can eliminate problems and losses from ex vivo treatment and engraftment.

[0262] An advantage of in vivo gene therapy can be the ease of therapeutic production and administration. The same therapeutic approach and therapy has the potential to be used to treat more than one patient, for example a number of patients who share the same or similar genotype or allele. In contrast, ex vivo cell therapy typically requires using a subject’s own cells, which are isolated, manipulated and returned to the same patient.

[0263] Progenitor cells (also referred to as stem cells herein) are capable of both proliferation and giving rise to more progenitor cells, which in turn have the ability to generate a large number of cells that can in turn give rise to differentiated or differentiable daughter cells. The daughter cells themselves can be induced to proliferate and produce progeny that subsequently differentiate into one or more mature cell types, while also retaining one or more cells with parental developmental potential. The term "stem cell" refers then to a cell with the capacity or potential, under particular circumstances, to differentiate to a more specialized or differentiated phenotype, and which retains the capacity, under certain circumstances, to proliferate without substantially differentiating. In one aspect, the term progenitor or stem cell refers to a generalized mother cell whose descendants (progeny) specialize, often in different directions, by differentiation, e.g., by acquiring completely individual characters, as occurs in progressive diversification of embryonic cells and tissues. Cellular differentiation is a complex process typically occurring through many cell divisions. A differentiated cell can derive from a multipotent cell that itself is derived from a multipotent cell, and so on. While each of these multipotent cells can be considered stem cells, the range of cell types that each can give rise to can vary considerably. Some differentiated cells also have the capacity to give rise to cells of greater developmental potential. Such capacity can be natural or can be induced artificially upon treatment with various factors. In many biological instances, stem cells can also be "multipotent" because they can produce progeny of more than one distinct cell type, but this is not required.

[0264] Human cells described herein can be induced pluripotent stem cells (iPSCs). An advantage of using iPSCs in the methods of the disclosure is that the cells can be derived from the same subject to which the progenitor cells are to be administered. That is, a somatic cell can be obtained from a subject, reprogrammed to an induced pluripotent stem cell, and then differentiated into a progenitor cell to be administered to the subject (e.g., an autologous cell). Because progenitors are essentially derived from an autologous source, the risk of engraftment rejection or allergic response can be reduced compared to the use of cells from another subject or group of subjects. In addition, the use of iPSCs negates the need for cells obtained from an embryonic source. Thus, in one aspect, the stem cells used in the disclosed methods are not embryonic stem cells.

[0265] Methods are known in the art that can be used to generate pluripotent stem cells from somatic cells. Pluripotent stem cells generated by such methods can be used in the method of the disclosure.

[0266] Reprogramming methodologies for generating pluripotent cells using defined combinations of transcription factors have been described. Mouse somatic cells can be converted to ES cell-like cells with expanded developmental potential by the direct transduction of Oct4, Sox2, Klf4, and c-Myc; see, e.g., Takahashi and Yamanaka, 2006, Cell 126(4): 663-76. iPSCs resemble ES cells, as they restore the pluripotency-associated transcriptional circuitry and much of the epigenetic landscape. In addition, mouse iPSCs satisfy all the standard assays for pluripotency: specifically, in vitro differentiation into cell types of the three germ layers, teratoma formation, contribution to chimeras, germline transmission (see, e.g., Maherali and Hochedlinger, 2008, Cell Stem Cell. 3(6):595-605), and tetrapioid complementation.

[0267] Human iPSCs can be obtained using similar transduction methods, and the transcription factor trio, OCT4, SOX2, and NANOG, has been established as the core set of transcription factors that govern pluripotency; see, e.g., 2014, Budniatzky and Gepstein, Stem Cells Transl Med. 3(4):448-57; Barrett et al, 2014, Stem Cells Trans Med 3: 1-6 sctm.2014-0121 ; Focosi et al, 2014, Blood Cancer Journal 4: e211 . The production of iPSCs can be achieved by the introduction of nucleic acid sequences encoding stem cell-associated genes into an adult, somatic cell, historically using viral vectors.

[0268] iPSCs can be generated or derived from terminally differentiated somatic cells, as well as from adult stem cells, or somatic stem cells. That is, a non-pluripotent progenitor cell can be rendered pluripotent or multipotent by reprogramming. In such instances, it may not be necessary to include as many reprogramming factors as required to reprogram a terminally differentiated cell. Further, reprogramming can be induced by the non-viral introduction of reprogramming factors, e.g., by introducing the proteins themselves, or by introducing nucleic acids that encode the reprogramming factors, or by introducing messenger RNAs that upon translation produce the reprogramming factors (see e.g., Warren et al., 2010, Cell Stem Cell, 7(5):6I8- 30. Reprogramming can be achieved by introducing a combination of nucleic acids encoding stem cell-associated genes, including, for example, Oct-4 (also known as Oct-3 / 4 or Pouf5l), Soxl, Sox2, Sox3, Sox 15, Sox 18, NANOG, Klfl, Klf2, Klf4, Klf5, NR5A2, c- Myc, 1- Myc, n-Myc, Rem2, Tert, and LIN28. Reprogramming using the methods and compositions described herein can further comprise introducing one or more of Oct-3 / 4, a member of the Sox family, a member of the Klf family, and a member of the Myc family to a somatic cell. The methods and compositions described herein can further comprise introducing one or more of each of Oct-4, Sox2, Nanog, c-MYC and Klf4 for reprogramming. As noted above, the exact method used for reprogramming is not necessarily critical to the methods and compositions described herein. However, where cells differentiated from the reprogrammed cells are to be used in, e.g., human therapy, in one aspect the reprogramming is not affected by a method that alters the genome. Thus, in such examples, reprogramming can be achieved, e.g., without the use of viral or plasmid vectors.

[0269] Efficiency of reprogramming (the number of reprogrammed cells) derived from a population of starting cells can be enhanced by the addition of various agents, e.g., small molecules, as shown by Shi et al., 2008, Cell-Stem Cell 2:525-528; Huangfu et al., 2008, Nature Biotechnology 26(7):795-797; and Marson et al., 2008, Cell-Stem Cell 3: 132-135. Thus, an agent or combination of agents that enhance the efficiency or rate of induced pluripotent stem cell production can be used in the production of patient-specific or disease-specific iPSCs. Some non-limiting examples of agents that enhance reprogramming efficiency include soluble Wnt, Wnt conditioned media, BIX-01294 (a G9a histone methyltransferase), PD0325901 (a MEK inhibitor), DNA methyltransferase inhibitors, histone deacetylase (HD AC) inhibitors, valproic acid, 5'-azacytidine, dexamethasone, suberoylanilide, hydroxamic acid (SAHA), vitamin C, and trichostatin (TSA), among others. Other non-limiting examples of reprogramming enhancing agents include: Suberoylanilide Hydroxamic Acid (SAHA ( e.g ., MK0683, vorinostat) and other hydroxamic acids), BML-210, Depudecin (e.g., (-)-Depudecin), HC Toxin, Nullscript (4-(l,3-Dioxo-IH,3H- benzo[de]isoquinolin-2-yl)-N-hydroxybutanamide), Phenylbutyrate (e.g., sodium phenylbutyrate) and Valproic Acid ((VP A) and other short chain fatty acids), Scriptaid, Suramin Sodium, Trichostatin A (TSA), APHA Compound 8, Apicidin, Sodium Butyrate, pi valoyloxy methyl butyrate (Pivanex, AN-9), Trapoxin B, Chlamydocin, Depsipeptide (also known as FR901228 or FK228), benzamides (e.g., CI-994 (e.g., N- acetyl dinaline) and MS-27- 275), MGCD0103, NVP-LAQ-824, CBHA (m-carboxycinnaminic acid bishydroxamic acid), JNJ16241199, Tubacin, A-161906, proxamide, oxamflatin, 3-C1-UCHA (e.g., 6-(3- chlorophenylureido)caproic hydroxamic acid), AOE (2-amino-8-oxo-9, 10-epoxy decanoic acid), CHAP31 and CHAP 50. Other reprogramming enhancing agents include, for example, dominant negative forms of the HDACs (e.g, catalytically inactive forms), siRNA inhibitors of the HDACs, and antibodies that specifically bind to the HDACs. Such inhibitors are available, e.g., from BIOMOL International, Fukasawa, Merck Biosciences, Novartis, Gloucester Pharmaceuticals, Titan Pharmaceuticals, MethylGene, and Sigma Aldrich.

[0270] To confirm the induction of pluripotent stem cells, isolated clones can be tested for the expression of a stem cell marker. Such expression in a cell derived from a somatic cell identifies the cells as induced pluripotent stem cells. Stem cell markers can be selected from the non-limiting group including SSEA3, SSEA4, CD9, Nanog, Fbxl5, Ecatl, Esgl, Eras, Gdfi, Fgf4, Cripto, Daxl, Zpf296, Slc2a3, Rexl, Utfl, and Natl. In one case, for example, a cell that expresses Oct4 or Nanog is identified as pluripotent. Methods for detecting the expression of such markers can include, for example, RT-PCR and immunological methods that detect the presence of the encoded polypeptides, such as Western blots or flow cytometric analyses. Detection can involve not only RT-PCR, but also detection of protein markers. Intracellular markers can be best identified via RT-PCR, or protein detection methods such as immunocytochemistry, while cell surface markers are readily identified, e.g., by immunocytochemistry.

[0271] Pluripotency of isolated cells can be confirmed by tests evaluating the ability of the iPSCs to differentiate into cells of each of the three germ layers. As one example, teratoma formation in nude mice can be used to evaluate the pluripotent character of the isolated clones. The cells can be introduced into nude mice and histology and / or immunohistochemistry can be performed on a tumor arising from the cells. The growth of a tumor comprising cells from all three germ layers, for example, further indicates that the cells are pluripotent stem cells.

[0272] Patient-specific iPS cells or cell line can be created. There are many established methods in the art for creating patient specific iPS cells, e.g., as described in Takahashi and Yamanaka 2006;Takahashi, Tanabe et al. 2007. For example, the creating step can comprise: a) isolating a somatic cell, such as a skin cell or fibroblast, from the patient; and b) introducing a set of pluripotency-associated genes into the somatic cell in order to induce the cell to become a pluripotent stem cell. The set ofpluripotency-associated genes can be one or more of the genes selected from the group consisting of OCT4, SOX1 , SOX2, SOX3, SOX15, SOX18, NANOG, KLF1 , KLF2, KLF4, KLF5, c-MYC, n-MYC, REM2, TERT and LIN28.

[0273] In some aspects, a biopsy or aspirate of a subject’s bone marrow can be performed. A biopsy or aspirate is a sample of tissue or fluid taken from the body. There are many different kinds of biopsies or aspirates. Nearly all of them involve using a sharp tool to remove a small amount of tissue. If the biopsy will be on the skin or other sensitive area, numbing medicine can be applied first. A biopsy or aspirate can be performed according to any of the known methods in the art. For example, in a bone marrow aspirate, a large needle is used to enter the pelvis bone to collect bone marrow.

[0274] In some aspects, a mesenchymal stem cell can be isolated from a subject. Mesenchymal stem cells can be isolated according to any method known in the art, such as from a subject’s bone marrow or peripheral blood. For example, marrow aspirate can be collected into a syringe with heparin. Cells can be washed and centrifuged on a Percoll™ density gradient. Cells, such as blood cells, liver cells, interstitial cells, macrophages, mast cells, and thymocytes, can be separated using density gradient centrifugation media, Percoll™. The cells can then be cultured in Dulbecco's modified Eagle's medium (DMEM) (low glucose) containing 10% fetal bovine serum (FBS) (Pittinger et. al., 1999, Science 284: 143-147).6.8.1. Exemplary Genomic Targets

[0275] The Type V Cas proteins and gRNAs of the disclosure can be used to alter various genomic targets. In some aspects, the methods of altering a cell are methods for altering a CCR5, EMX1, Fas, FANCF, HBB, ZSCAN2, Chr6, ADAMTSL1, B2M, CXCR4, PD1, DNMT1, Match8, TRAC, TRBC, VEGFAsite2, VEGFAsite3, CACNA, HEKsite3, HEKsite4, Chr8, BCR, ATM, HBG1, HPRT, IL2RG, NF1, USH2A, RHO, BcLenh, or CTFR genomic sequence. In some aspects, the methods of altering a cell are methods of altering a TRAC, B2M, PD1, or LAG3 genomic sequence. Reference sequences of RHO, TRAC, B2M, PD1, and LAG3 are available in public databases, for example those maintained by NCBI. For example, RHO has the NCBI gene ID: 6010; TRAC has the NCBI gene ID:28755; B2M has the NCBI gene ID: 567; PD1 has the NCBI gene ID:5133; and LAG3 has the NCBI gene ID: 3902.

[0276] In some embodiments, the methods of altering a cell are methods for altering a hemoglobin subunit beta (HBB) gene. HBB mutations are associated with p-thalassemia and SCD. Dever et al., 2016 Nature 539(7629):384-389.

[0277] In some embodiments, the methods of altering a cell are methods for altering a CCR5 gene. CCR5 has demonstrated involvement in several different disease states including, but not limited to, human immunodeficiency virus (HIV) and acquired immune deficiency syndrome (AIDS). WO 2018 / 119359 describes CCR5 editing by CRISPR-Cas to make loss of function CCR5 in order to provide protection against HIV infection, decrease one or more symptoms of HIV infection, halt or delay progression of HIV to AIDS, and / or decrease one or more symptoms of AIDS.

[0278] In some embodiments, the methods of altering a cell are methods for altering a PD1 , B2M gene, TRAC gene, or a combination thereof. CAR-T cells having PD1 , B2M and TRAC genes disrupted by CRISPR-Type V Cas have demonstrated enhanced activity in preclinical glioma models. Choi et al., 2019, Journal for ImmunoTherapy of Cancer 7:309.

[0279] In some embodiments, the methods of altering a cell are methods for altering an USH2A gene.Mutations in the USH2A gene can cause Usher syndrome type 2A, which is characterized by progressive hearing and vision loss.

[0280] In some embodiments, the methods of altering a cell are methods for altering a RHO gene. Mutations in the RHO gene can cause retinitis pigmentosa (RP).

[0281] Targeting of (one or more of) human TRAC, human B2M, human PD1, and human LAG3 genes can be used, for example, in the engineering of chimeric antigen receptor (CAR) T cells. For example, CRISPR / Cas technology has been used to deliver CAR-encoding DNA sequences to loci such as TRAC and PD1 (see, e.g., Eyquem et al., 2017, Nature 543(7643):113-117; Hu et al., 2023, eClinicalMedicine 60:102010), while TRAC, B2M, PD1, and LAG3 knockout CAR T-cells have been reported (see, e.g., Dimitri et al., 2022, Molecular Cancer 21 :78; Liu et al., 2016, Cell Research 27:154-157; Ren et al., 2017, Clin Cancer Res. 23(9):2255-2266; Zhang et al., 2017, Front Med. 11 (4): 554-562). Thus, the Type V Cas proteins and TRAC, B2M, PD1, and LAG3 guides of the disclosure can be used for targeted knock-in of an exogenous DNA sequence to a desired genomic site in a human cell and / or knock-out of TRAC, B2M, PD1, or LAG3 in a human cell, for example a human T cell. In some embodiments, T cells are edited ex vivo to produce CAR-T cells and subsequently administered to a subject in need of CAR-T cell therapy.

[0282] In some embodiments, the methods of altering a cell are methods for altering a DNMT1 gene. Mutations in the DNMT1 gene can cause DNMT1 -related disorder, which is a degenerative disorder of the central and peripheral nervous systems. DNMT1-re\ated disorder is characterized by sensory impairment, loss of sweating, dementia, and hearing loss.

[0283] Additional exemplary targets include AVS1, BCL11A, PCSK9, and VEGFA. In some embodiments, the methods of altering a cell are methods for altering an AVS1 gene. A VS1 can be used as a safe harbor locus to insert an transgene of interest (see, e.g., Gu et al., 2022, Methods Mol Biol. 2495:99-114). In some embodiments, the methods of altering a cell are methods for altering a BCL11A gene. Editing BCL11A has been identified in the art a target for treatment of sickle cell disease and p- Thalassemia (see, e.g., Frangoul et al., 2021 , N Eng J Med 384:252-260). In some embodiments, the methods of altering a cell are methods for altering a PCSK9 gene. PCSK9 has been identified in the art as a target for treatment of hypercholesterolemia (see, e.g., Hoekstra & Van Eck, 2024, Current Atherosclerosis Reports, 26:139-146). In some embodiments, the methods of altering a cell are methods for altering a VEGFA gene. VEGFA has been identified in the art as a target for treatment of eye diseases such as age-related macular degeneration (see, e.g., Park et al., 2023, Scientific Reports 13:3715).6.9. Methods of Detecting Target Nucleic Acids

[0284] The disclosure further provides methods of using the Type V Cas proteins, gRNAs, and systems of the disclosure for detecting target nucleic acids (e.g., nucleic acids from pathogens, for example viruses, bacteria, or parasites). Nucleic acid detection methods using Cas12a are described in the art (see, e.g., Kaminski et al., 2021 , Nature Biomedical Engineering 5:643-656; Sashital, 2018, Genome Med. 10:32, each of which is incorporated herein by reference in its entirety), and such methods can be extended to the Type V Cas proteins of the disclosure. Nucleic acid detection methods typically takeadvantage of collateral cleavage activity of Type V Cas proteins. For example, target binding of Type V Cas proteins such as Cas12a activates collateral cleavage activity toward single-stranded DNA, and this activity can be exploited in a detection assay by supplying a single-stranded reporter nucleic acid, for example a reporter nucleic acid comprising a quenched fluorescent reporter. Type V Cas protein binding to the target nucleic acid leads to cleavage of the reporter nucleic acid. Detection of the fluorescent reporter following cleavage of the reporter nucleic acid allows for detection and, optionally, quantification of the target nucleic acid.7. EXAMPLES7.1. Materials and Methods7.1.1. Plasmids and cell lines

[0285] Plasmids: Type V-A Cas proteins were expressed in mammalian cells from a plasmid vector characterized by a EF1 alpha-driven cassette. Each Type V-A Cas protein coding sequence was human codon-optimized and modified by the addition of an SV5 tag and a bipartite nuclear localization signal at the C-terminus. Additional constructs containing different NLS configurations (discussed in Section 7.4.2) were generated using standard cloning techniques. The crRNA were expressed from a U6-driven cassette located on an independent plasmid construct. The human codon-optimized coding sequence of the Type V-A Cas proteins, as well as their crRNA scaffolds, were obtained by synthesis from Twist Bioscience. Spacer sequences (20-24 nt long) were cloned into the crRNA plasmid as annealed DNA oligonucleotides (Eurofins Genomics) using a double Bsal site present in the plasmid. The list of spacer sequences and relative cloning oligonucleotides used in the present example is reported in Table 8. In all cases in which the crRNA scaffold did not contain a matching native 5’-G, this nucleotide was appended upstream the scaffold sequence in order to allow efficient transcription from a U6 promoter. Unless otherwise stated in all studies, full-length crRNAs were used.

[0286] Cell lines: U2OS-EGFP cells, harboring a single integrated copy of an EGFP reporter gene, and wild-type U2OS and HEK293T cells were cultured in DMEM (Life Technologies) supplemented with 10% FBS (Life Technologies), 2 mM L-Glutamine (Life Technologies) and penicillin / streptomycin (Thermo Fisher). All cells were incubated at 37°C and 5% CO2 in a humidified atmosphere. All cells tested mycoplasma negative (PlasmoTest, Invivogen).7.1.2. Identification of novel Type V-A Cas molecules from metagenomic samples

[0287] Type V CRISPR-Cas loci were predicted using CRISPRCasTyper (Russel, J., Pinilla-Redondo, R., Mayo-Munoz, D., Shah, S. A. & Sorensen, S. J. CRISPRCasTyper: Automated Identification, Annotation, and Classification of CRISPR-Cas Loci. CRISPR J 3, 462-469 (2020)) version 1.8.0, startingfrom a collection of >1M metagenome-assembled genomes (MAGs) and reference genomes (Blanco- Miguez, A. et al. Extending and improving metagenomic taxonomic profiling with uncharacterized species using MetaPhlAn 4. Nat. Biotechnol. 41 , 1633-1644 (2023)). A total of 14,568 Type V Cas proteins were recovered. Type V Cas proteins were clustered at 60% sequence identity and 60% sequence coverage using MMseq2 (Steinegger, M. & Soding, J. MMseqs2 enables sensitive protein sequence searching for the analysis of massive data sets. Nat. Biotechnol. 35, 1026-1028 (2017)) version 13.45111 (-c 0.6 - cov-mode 5 -min-seq-id 0.6 -cluster-reassign) and aligned using mafft (Katoh, K. & Standley, D. M. MAFFT multiple sequence alignment software version 7: improvements in performance and usability. Mol. Biol. Evol. 30, 772-780 (2013)) version 7.490 (-maxiterate 100). The resulting alignment was trimmed using TrimAI (Capella-Gutierrez, S., Silla-Martinez, J. M. & Gabaldon, T. trimAI: a tool for automated alignment trimming in large-scale phylogenetic analyses. Bioinformatics 25, 1972-1973 (2009)) version 1 .4.rev15 (-gappyout) and used to generate a phylogenetic tree using IQ-TREE 2 (Minh, B. Q. et al. IQ-TREE 2: New Models and Efficient Methods for Phylogenetic Inference in the Genomic Era. Mol. Biol. Evol. 37, 1530-1534 (2020)) version 2.0.3 (-B 1000) and automatic model selection (Kalyaanamoorthy, S., Minh, B. Q., Wong, T. K. F., von Haeseler, A. & Jermiin, L. S. ModelFinder: fast model selection for accurate phylogenetic estimates. Nat. Methods 14, 587-589 (2017)), which was visualized using GraPhlAn (Asnicar, F., Weingart, G., Tickle, T. L., Huttenhower, C. & Segata, N. Compact graphical representation of phylogenetic data and metadata with GraPhlAn. PeerJ 3, e1029 (2015)) version 1.1.3. PAM predictions were performed using PAMpredict (Ciciani, M. et al. Automated identification of sequence-tailored Cas9 proteins using massive metagenomic data. Nat. Commun. 13, 6474 (2022)), clustering Type V-A Cas proteins at 90% sequence identity. For selected Type V-A Cas proteins, crRNAs resulting from MinCED predictions (Bland, C. et al. CRISPR recognition tool (CRT): a tool for automatic detection of clustered regularly interspaced palindromic repeats. BMC Bioinformatics 8, 209 (2007)) were manually checked for conservation of the 3’ end sequence. The structure of the 3’ end was checked by aligning the crRNAs using Clustal Omega (Sievers, F. et al. Fast, scalable generation of high-quality protein multiple sequence alignments using Clustal Omega. Mol. Syst. Biol. 7, 539 (2011)) version 1 .2.4, generating a consensus secondary structure with RNAalifold version 2.4.17 (-p -r -d2 - noLP) (Lorenz, R. et al. ViennaRNA Package 2.0. Algorithms Mol. Biol. 6, 26 (2011)) and analyzing the resulting structure with R2R (Weinberg, Z. & Breaker, R. R. R2R-software to speed the depiction of aesthetic consensus RNA secondary structures. BMC Bioinformatics 12, 3 (2011)) version 1 .0.6.7.1.3. PAM assay

[0288] An in vitro PAM evaluation of the novel Type V-A Cas proteins was performed according to a modified version of the protocol from Karvelis, Young and Siksnys (Karvelis et al., 2019, Methods in Enzymology 616:219-240). The gRNAs to perform the assay were obtained by in vitro transcription using the High Yield™ T7 RNA Synthesis Kit (Jena Bioscience) starting from a PCR template generated by amplification from each gRNA expression construct. The primers used to generate the IVT templates are reported in Table 9. In vitro transcribed gRNAs were subsequently purified using the MEGACIear™ Transcription Clean-up kit (Thermo Fisher Scientific). HEK293T cells were transfected 48 hours before the study with nuclease-expressing plasmids, and protein lysates were collected and used for RNP complex formation. The complex was assembled by combining 20 pL of the supernatant containing the soluble Type V-A Cas proteins with 1 pL of RiboLock™ RNase Inhibitor (Thermo Fisher Scientific) and 2pg of guide RNAs (previously transcribed in vitro). The RNP complex was used to digest 1 pg of a PAM plasmid DNA library (containing a defined target sequence flanked at the 5’-end by a randomized 8 nucleotide PAM sequence) for 1 hour at 37°C.

[0289] A double stranded DNA adapter (Table 10) was ligated to the DNA ends generated by the targeted Type V-A Cas protein cleavage and the final ligation product was purified using CleanNGS™ SPRI beads.

[0290] One round of a two-step PCR (Phusion™ HF DNA polymerase, Thermo Fisher Scientific) was performed to enrich the sequences that were cut using a set of forward primers annealing on the adapter and a reverse primer designed on the plasmid backbone downstream of the PAM (Table 11). A second round of PCR was performed to attach the Illumina indexes and adapters. PCR products were purified using the GeneJet™ PCR Purification Kit (Thermo Fisher Scientific).

[0291] The library was analysed with a 71-bp single read sequencing, using a flow cell v2 micro, on an Illumina MiSeq™ sequencer.

[0292] PAM sequences were extracted from Illumina MiSeq reads and used to generate PAM sequence logos, using Logomaker version 0.8. PAM heatmaps were used to display PAM enrichment, computed dividing the frequency of PAM sequences in the cleaved library by the frequency of the same sequences in a control uncleaved library.7.1.4. In vitro cleavage assays

[0293] In vitro cleavage assays were performed using an RNP complex targeting a PCR product.Briefly, the RNP was assembled combining 105.7 pmol of synthetic RNA with 35 pmol of protein (ratio 3:1) and the complex was incubated 15 min at room temperature (approximately 20-22°C). Two pg of PCR template was diluted in 90 pl of R buffer ( 10 Mm Tris-HCI pH 7.5; 10 mM NaCI; 1 mM DTT) and mixed with 9 pl of RNP complex. The reaction was incubated at 37°C for 1 hour and then run on 1% agarose gel. Digested bands were gel-extracted and purified using a commercial kit (Macherey-Nagel), and sent for Sanger sequencing using the primers TRAC_ex1 forward and TRAC_ex1 reverse reported in Table 12.7.1.5. Cell line transfections

[0294] For studies in HEK293T cells, 100,000 cells were plated in a 24 well plate. 24 hours later, cells were transfected with 500 ng of nuclease-expressing plasmid and 250 ng of sgRNA-expressing plasmid using Mirus TranslT™-LT1 according to the manufacturer’s instructions. After 15-30 minutes of incubation at room temperature, the mixture was added drop-wise on HEK293T cultures.

[0295] To perform editing studies, 200,000 U2OS-EGFP cells were nucleofected with 500 ng of nuclease-expressing plasmid and 250 ng of sgRNA-expressing plasmid containing a guide designed to target EGFP using the 4D-Nucleofector™ SE Kit (Lonza), DN-100 program, according to the manufacturer’s protocol. After electroporation, cells were plated in a 24-well plate. EGFP knock-out was analyzed 4 days after nucleofection using a BD FACSymphony™ A1 (BD) flow cytometer.7.1.6. RNP electroporation

[0296] 200,000 U2OS cells were electroporated with RNP complexes (450 pmol of crRNAs + 150 pmol of recombinant ZZKD Type V-A Cas protein) pre-formed at room temperature for 20 minutes using the 4D-Nucleofector™ SE Kit (Lonza), DN-100 program, according to the manufacturer’s protocol. For RNP electroporation studies in primary human T cells, commercial lots were purchased from CGT preclinical. Briefly, a vial of 10x106T cells, was thawed and incubated in RPMI + 100 U / mL IL-2 (ImmunoTools). Four hours later, the T cells were counted, spun down, and resuspended in 5 mL of activation media (RPMI+ IL-2 100 U / mL+100 pL TransAct T cell activator from Miltenyi Biotech), resulting in 10 million cells at a concentration of 2 million cells / mL. Three days post-activation, activated T cells wereelectroporated using Lonza 4D-Nucleofector™, EO115 program, with a pre-assembled RNP complex generated by mixing 450 pmol of the ZZKD Type V-A Cas protein and 150 pmol of the sgRNA and kept at room temperature for 20 minutes before electroporation. KO efficiency was evaluated 4 days postelectroporation by staining the T cells with an anti-human TCR alpha / beta chain antibody (BioLegend) for 30 minutes at 4°C and quantifying the percentage of negative cells via flow cytometry. The recombinant ZZKD Type V-A protein was custom-produced by Origene, starting from a 6-His tagged (SEQ ID NO: 365) bacterial expression construct generated by gene synthesis (Twist Bioscience), while synthetic guide RNAs were purchased from IDT.7.1.7. Evaluation of gene editing

[0297] Three days after transfection cells were collected and DNA was extracted using the QuickExtract™ DNA Extraction Solution (Lucigen) according to the manufacturer’s instructions. To amplify the target loci, PCR reactions were performed using the HOT FIREPol™ polymerase (Solis BioDyne) and the oligonucleotides listed in Table 12. The amplified products were purified, sent for Sanger sequencing (EasyRun service, Microsynth) and analyzed with the TIDE web tool (shinyapps.datacurators.nl / tide / ) to quantify indels. The forward primers used for generating the amplicons were also exploited for Sanger sequencing reactions.7.2. Example 1 : Identification and characterization of novel Type V-A Cas molecules

[0298] This Example describes studies performed to identify and characterize ZWGD, ZJHK, ZIKV, ZZFT, YYAN, ZZGY, ZKBG, ZZKD, ZXPB, and ZPPX TYPE V-A Cas proteins.7.2.1. Identification of the crRNAs of novel Type V-A Cas proteins

[0299] crRNA sequences for the selected Type V-A Cas proteins were identified in silico by extracting the repeat region of the CRISPR arrays associated with each nuclease, as described in the Materials &Methods (Section 7.1). The secondary structures of the identified cRNAs for each of the Type V-A Cas proteins are reported in FIGS. 1A-1 E and FIGS. 2A-2E.7.2.2. In silico prediction of the PAM specificity of novel Type V-A Cas proteins

[0300] An in silico PAM prediction pipeline (as reported above in the Materials & Methods (Section 7.1)) has been used to predict the PAM recognition specificity of the novel Type V-A Cas proteins. Table 13 reported here below contains the PAM preferences as predicted by the algorithm. The predicted PAM logos for each enzyme are reported in FIGS. 3A-3E and 4A-4E.7.2.3. Evaluation of Type V-A Cas proteins editing activity using an EGFP reporter system

[0301] By exploiting the knowledge on their predicted PAM sequences and their identified crRNAs, the ability to cleave selected targets in mammalian cells of the selected Type V-A Cas proteins was investigated. An EGFP reporter system was used as it allowed an easier readout on the editing activity, based on the loss of fluorescence of treated cells quantitatively measured by cytofluorimetry. Two gRNAs targeting the EGFP coding sequence were designed exploiting PAMs which, based on the in silico prediction, were compatible for all the Type V-A Cas proteins and tested in U2OS cells stably expressing a single copy of an EGFP reporter by transient electroporation. Surprisingly, as reported in FIG. 5, some of the evaluated guides in combination with their respective Type V-A Cas protein were able to significantly downregulate EGFP expression in target cells. In particular, ZZKD Type V-A Cas protein showed very high activity with both of the guides (>70 and >95% EGFP KO); additionally, ZJHK, ZZGY, ZXPB and YYAN Type V-A Cas proteins showed appreciable knock-out activity (>20% EGFP KO) with at least one of the gRNAs. The remaining Type V-A Cas proteins did not show editing levels above the background of the assay against the currently evaluated targets in the EGFP coding sequence. These data clearlydemonstrate that several of the selected Type V-A Cas proteins were able to modify very efficiently genetic targets in mammalian cells and can thus be exploited to edit the mammalian genome.7.2.4. Evaluation of ZZKD Type V-A Cas protein editing activity on benchmark genomic loci in mammalian cells

[0302] To further validate the editing activity of the highest performing candidate Type V-A Cas protein in the EGFP assay, ZZKD, guide RNAs were designed to target the B2M, TRAC and PD1 benchmark genomic loci in human cells. U2OS cells were electroporated with plasmids encoding ZZKD Type V-A Cas and the selected gRNAs and indel formation was measured by Sanger chromatogram deconvolution on extracted genomic DNA. Strikingly, for all three target loci it was possible to identify at least one gRNA showing high levels of genomic modification (>40%, see FIG. 6A-C) and except for the B2M target locus more than one well performing guide was identified (g3-g4 for the TRAC locus, g1-g2 for the PD1 locus).

[0303] Overall these data clearly demonstrate that ZZKD Type V-A is proficient in editing the human genome at several target sites.7.3. Example 2: Further characterization of novel Type V-A Cas molecules

[0304] This Example describes studies performed to further characterize Type V-A Cas proteins identified in Example 1.7.3.1 . Evaluation of additional Type V-A Cas proteins editing activity using an EGFP reporter system

[0305] Leveraging on the conserved nature of PAM preferences among Type V-A Cas proteins, guide RNAs targeting the EGFP coding sequence were designed for novel Type V-A Cas proteins isolated from the human microbiome to evaluate their activity in human cells. An EGFP reporter system was used as it allowed an easier readout on the editing activity, based on the loss of fluorescence of treated cells quantitatively measured by cytofluorimetry. Two gRNAs targeting the EGFP coding sequence were designed and evaluated in U2OS cells stably expressing a single copy of the EGFP reporter by transient electroporation. As reported in FIG. 10, while most of the evaluated nucleases showed relatively low levels of EGFP downregulation in this particular assay (close to the detection limit of the assay), some of the selected enzymes were particularly proficient in editing their target sequence. In particular, ZZQE Type V-A Cas protein showed very high activity with both of the evaluated guides (>60% EGFP KO), followed by ZRGM, ZSQQ and ZRXE Type V-A Cas proteins which showed appreciable knock-out activity (>40% EGFP KO) with at least one of the evaluated gRNAs. These data clearly demonstrate that several of the selected Type V-A Cas proteins were able to very efficiently modify genetic targets in mammalian cells and can thus be exploited to modify the genome of mammalian cells.7.3.2. Evaluation of novel Type V-A Cas proteins editing activity on benchmark genomic loci in mammalian cells

[0306] The evaluation of the editing activity of the top performing Type V-A Cas proteins from the EGFP reporter assay KO, ZZKD, ZRGM and ZZQE, was extended to endogenous genomic loci. Guide RNAs were designed to target the B2M (g2), TRAC (g3) and PD1 (g2) benchmark genomic loci in human cells. HEK293T cells were lipofected with plasmids encoding ZZKD, ZRGM and ZZQE Type V-A Cas proteins and the selected gRNAs and indel formation was measured by Sanger chromatogram deconvolution onextracted genomic DNA. Strikingly, for all three target loci all evaluated Type V-A Cas proteins were able to produce appreciable levels of indels, with some variability depending on the target (FIG. 11).

[0307] Overall, these data clearly demonstrate that among the selected Type V-A Cas proteins, ZZKD is the most efficient in editing the human genome at several target sites.7.3.3. In vitro determination of the PAM specificity of top-performing novel Type V-A Cas proteins

[0308] After a first evaluation of their activity in mammalian cells, the PAM preferences of the top performing Type V-A Cas proteins were determined using a well-established in vitro assay. Briefly, ZZKD, ZRGM and ZZQE Type V-A Cas proteins were expressed in HEK293T cells to generate cell lysates which were then used in an in vitro cleavage reaction where a plasmid library including a known target flanked by a randomized 8 nt sequence was cut based on PAM recognition preferences by ribonucleoprotein complexes generated using the cell-expressed nucleases and an in vitro transcribed gRNA targeting the library. Cleaved plasmids were then recovered by amplification and sequenced to determine which PAM sequences were preferentially cleaved (see Materials and Methods for more details). These results confirmed the predicted PAM preferences for ZZKD and ZZQE (see FIG. 4C and FIG. 9, respectively), and in general confirmed the possibility to recognize the TTTV PAM which was used in the initial editing evaluation studies, but showed also additional recognition capabilities. The PAM logos and heatmaps for all the selected Type V-A Cas proteins are reported in FIG. 12A-12B, and FIGS. 13A-13D, while a summary of the in vitro determined PAMs are included in Table 14.

[0309] To further confirm the PAM preferences determined for ZZKD Type V-A Cas, a panel of guide RNAs targeting loci flanked by a VTTV and TTTT PAMs was selected and the editing efficacy of ZZKD towards these loci was evaluated after transient transfection in HEK293T cells. As shown in FIG. 12C, many of the evaluated guides showed efficient editing of the target locus demonstrating the possibility for ZZKD to recognize such PAMs, as indicated by the in vitro assay.7.4. Example 3: Further characterization of ZZKD Type V-A Cas protein

[0310] This example describes additional studies to characterize ZZKD Type V-A Cas protein.7.4.1. Evaluation of the cleavage profile of ZZKD Type V-A Cas protein

[0311] To further characterize the enzymatic activity of ZZKD Type V-A Cas protein, its cleavage profile was investigated in vitro. Recombinant ZZKD was used to digest in vitro a dsDNA target obtained by PCR amplification of a known target region (TRAC locus, g3). The digestion products were separated on agarose gel and independently Sanger sequenced. Based on the two chromatographic profiles (FIG.14A), it was possible to determine where the two DNA strands were cut: a staggered double strand break was produced, with the non-target strand cut 23nt downstream (5’>3’) of the PAM and the target strandcut 18nt upstream (5’>3’). This is in line with what was observed for other well characterized Type V-A Cas proteins.7.4.2. Evaluation of different nuclear localization signals (NLS) forZZKD Type V-A Cas protein

[0312] In order to further improve the editing activity of the ZZKD Type V-A Cas protein, alternative types and positioning of nuclear localization signals were evaluated. The amino acid sequence of the different NLS evaluated as well as the relative position are indicated in Table 15 below.

[0313] As shown in FIG. 15, when the effect on editing activity of the different NLS designs was evaluated by transient transfection in HEK293T cells using the TRAC benchmark locus (g3) as a target, most of the constructs showed high editing levels with the exception of the single npNLS at the C- terminus, as indicated on the graph. Among all evaluated constructs, the FL-SV40 C-term performed particularly well and was thus used in subsequent studies.7.5. Example 4: Novel Type V-A Cas protein alternative crRNA scaffolds

[0314] Alternative trimmed scaffolds were evaluated for the top performing identified Type V-A Cas proteins (ZZKD, ZRGM, ZZQE). The editing activity of these enzymes was evaluated using the standard full length scaffold (36 nt) in comparison to a shorter 20nt scaffold, which nevertheless preserves a conserved stem-loop structure shared among the different crRNAs (FIGS. 16A-16C), using the TRAC locus (g3) as a benchmark. After transient transfection in HEK293T cells, indels were measured at the target locus revealing similar editing levels with both versions of the crRNA for all the evaluated nucleases (FIG. 17A). To further confirm this finding, ZZKD Type V-A Cas protein was evaluated on an extended panel of loci including additional guides on TRAC, BCL11A, AAVS1 and B2M. These studies confirmed a similar activity for both versions of the scaffold (FIG. 17B), in accordance with previously generated data. Overall, this demonstrates that truncating the 5’-end of the crRNA scaffold does not negatively influence the editing activity of these Type V-A Cas proteins after transfection in human cells.7.6. Example 5: Evaluation of ZZKD Type V-A Cas protein spacer length

[0315] With the aim of further improving the editing activity of ZZKD Type V-A Cas, different spacer lengths were evaluated to determine which favored the highest target modification. crRNAs with spacer lengths ranging from 20nt to 24nt were evaluated by targeting the TRAC (g3) and Match6 (see, Kleinstiver et al., 2016, Nat Biotechnol. 34(8):869-74) benchmark loci by transient transfection in HEK293T cells. While appreciable editing levels were observed for all the evaluated lengths (FIGS. 18A- 18B), shorter spacers were generally offering higher activity, with 21 nt being the most preferred length.7.7. Example 6: Side-by-side comparison of ZZKD Type V-A Cas protein activity with the commercially available benchmark AsCasI 2a Ultra

[0316] To characterize in depth the editing activity of ZZKD Type V-A Cas, indel formation was compared to the commercially available benchmark AsCasI 2a Ultra (Zhang et al., 2021 , Nat. comms. 12:3908), on a panel of endogenous loci in HEK293T cells after transient transfection. A total of 17 crRNAs targeting multiple genomic loci (TRAC, PD1 , EMX1 , AAVS1 , BCL11A, PCSK9, Match6, VEGFA) were evaluated. Notably, given the PAM compatibility between ZZKD and AsCasI 2a Ultra, the crRNAs were fully overlapping in all cases. As shown by the violin plots of FIG. 19, summarizing the editing data, the performance of the two nucleases was generally comparable, with ZZKD outperforming AsCasI 2a Ultra at some loci. The editing levels for each target site for the two nucleases are reported in Table 16 below.

[0317] Further to these editing studies, titration studies, where the amounts of transfected nuclease and guide RNA are progressively lowered to better measure differences in the editing activity, were performed on a selection of target loci (BCL11A-g4, B2M-g1 and B2M-g2, VEGFA-g1) in HEK293T cells. As shown in FIGS. 20A-20D, all titration curves showed generally comparable editing activities of the two proteins, with the general tendency for ZZKD Type V-A Cas to perform better than the AsCasI 2a Ultra benchmark (see for example VEGFA-g1 in FIG. 20B).

[0318] Overall, these data demonstrate that ZZKD Type V-A Cas protein is able to match or outperform the editing activity of the current state-of-the-art commercial AsCasI 2 Ultra benchmark.7.8. Example 7: Type V-A Cas protein activity after direct protein delivery in cells

[0319] To demonstrate the efficacy of ZZKD Type V-A Cas protein using alternative delivery modalities, direct ribonucleoprotein (RNP) complex delivery to target cells by electroporation was performed. To this aim, recombinant ZZKD was produced in bacteria and was purified by multiple rounds of chromatographyusing standard techniques, while crRNAs were obtained either from IDT (chemical synthesis) or through in vitro transcription using the T7 RNA polymerase. The activity of the RNP was initially evaluated in U2OS cells using guides targeting the TRAC (FIG. 21 A) and B2M (FIG. 21 B) loci. The observed editing activity was generally higher than that of the corresponding electroporated plasmid and, among the different types of crRNA evaluated, the synthetic crRNAs performed better. An AltR-modified guide (a chemical modification available from IDT) targeting B2M was also included in the panel showing editing levels close to the unmodified synthetic guide. Additionally, a titration study using B2M-g2 crRNA was performed by lowering progressively the amount of either recombinant ZZKD or corresponding crRNA and also changing the proteimcrRNA ratio from 1 :3 to 1 :1 .5 in order to more stringently evaluate ZZKD potency. As shown in FIG. 21C, in most of the conditions evaluated ZZKD Type V-A Cas protein preserved high levels of editing activity indicating high potency even at low concentrations.

[0320] To further confirm the activity of ZZKD Type V-A Cas as RNP, human commercial primary T cells were electroporated with the complex including a guide targeting the TRAC locus (g3). As shown in FIG. 22, ZZKD was able to produce approximately 80% of TRAC-negative cells as measured by cytofluorimetry, demonstrating high editing activity.

[0321] Overall, these data show not only that ZZKD Type V-A Cas protein is compatible with direct protein delivery in multiple cell types including hard-to-edit primary T cells but that ZZKD is also highly potent and can be used at low concentrations to obtain efficient target modification.8. SPECIFIC EMBODIMENTS

[0322] The present disclosure is exemplified by the specific embodiments below.1 . A Type V Cas protein comprising an amino acid sequence having at least 50% sequence identity to:(a) the amino acid sequence of a WED-1 domain of a reference protein sequence;(b) the amino acid sequence of a REC1 domain of a reference protein sequence;(c) the amino acid sequence of a REC2 domain of a reference protein sequence;(d) the amino acid sequence of a WED-II domain of a reference protein sequence;(e) the amino acid sequence of a PI domain of a reference protein sequence;(f) the amino acid sequence of a WED-HI domain of a reference protein sequence;(g) the amino acid sequence of a RuvC-l domain of a reference protein sequence;(h) the amino acid sequence of a BH domain of a reference protein sequence;(i) the amino acid sequence of a RuvC-ll domain of a reference protein sequence;(j) the amino acid sequence of a NUC domain of a reference protein sequence;(k) the amino acid sequence of a RuvC-lll domain of a reference protein sequence; or(l) the amino acid sequence of the full length of a reference protein sequence; wherein the reference protein sequence is SEQ ID NO:1 , SEQ ID NO:2, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:19, SEQ ID NQ:20, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:31 , SEQ ID NO:32, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:49, SEQ ID NQ:50, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:61 , SEQ ID NO:62, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:79, SEQ ID NQ:80, SEQ ID NO:85, SEQ IDNO:86, SEQ ID N0:91 , SEQ ID NO:92, SEQ ID NO:97, SEQ ID NO:98, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:109, SEQ ID NQ:110, SEQ ID N0:115, or SEQ ID NO:116.2. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.3. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.4. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.5. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.6. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.7. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.8. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.9. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.10. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.11 . The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.12. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.13. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.14. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.15. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the WED-I domain of the reference protein sequence.16. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the WED-I domain of the reference protein sequence.17. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.18. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.19. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.20. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.21. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.22. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.23. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.24. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.25. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.26. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.27. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.28. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.29. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.30. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the REC1 domain of the reference protein sequence.31. The Type V Cas protein of any one of embodiments 1 to 16, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the REC1 domain of the reference protein sequence.32. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.33. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.34. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.35. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.36. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.37. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.38. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.39. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.40. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.41 . The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.42. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.43. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.44. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.45. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the REC2 domain of the reference protein sequence.46. The Type V Cas protein of any one of embodiments 1 to 31 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the REC2 domain of the reference protein sequence.47. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.48. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.49. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.50. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.51 . The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.52. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.53. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.54. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.55. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.56. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.57. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.58. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.59. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.60. The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the WED-II domain of the reference protein sequence.61 . The Type V Cas protein of any one of embodiments 1 to 46, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the WED-II domain of the reference protein sequence.62. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the PI domain of the reference protein sequence.63. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the PI domain of the reference protein sequence.64. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the PI domain of the reference protein sequence.65. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the PI domain of the reference protein sequence.66. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the PI domain of the reference protein sequence.67. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the PI domain of the reference protein sequence.68. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the PI domain of the reference protein sequence.69. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the PI domain of the reference protein sequence.70. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the PI domain of the reference protein sequence.71 . The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the PI domain of the reference protein sequence.72. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the PI domain of the reference protein sequence.73. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the PI domain of the reference protein sequence.74. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the PI domain of the reference protein sequence.75. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the PI domain of the reference protein sequence.76. The Type V Cas protein of any one of embodiments 1 to 61 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the PI domain of the reference protein sequence.77. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.78. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.79. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.80. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.81 . The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.82. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.83. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.84. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.85. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.86. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.87. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.88. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.89. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.90. The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the WED-III domain of the reference protein sequence.91 . The Type V Cas protein of any one of embodiments 1 to 76, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the WED-III domain of the reference protein sequence.92. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.93. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.94. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.95. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.96. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.97. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.98. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.99. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.100. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.101 . The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.102. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.103. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.104. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.105. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.106. The Type V Cas protein of any one of embodiments 1 to 91 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the RuvC-l domain of the reference protein sequence.107. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the BH domain of the reference protein sequence.108. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the BH domain of the reference protein sequence.109. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the BH domain of the reference protein sequence.110. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the BH domain of the reference protein sequence.111. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the BH domain of the reference protein sequence.112. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the BH domain of the reference protein sequence.113. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the BH domain of the reference protein sequence.114. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the BH domain of the reference protein sequence.115. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the BH domain of the reference protein sequence.116. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the BH domain of the reference protein sequence.117. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the BH domain of the reference protein sequence.118. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the BH domain of the reference protein sequence.119. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the BH domain of the reference protein sequence.120. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the BH domain of the reference protein sequence.121. The Type V Cas protein of any one of embodiments 1 to 106, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the BH domain of the reference protein sequence.122. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.123. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.124. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.125. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.126. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.127. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.128. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.129. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.130. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.131. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.132. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.133. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.134. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.135. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.136. The Type V Cas protein of any one of embodiments 1 to 121 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the RuvC-ll domain of the reference protein sequence.137. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the NUC domain of the reference protein sequence.138. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the NUC domain of the reference protein sequence.139. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the NUC domain of the reference protein sequence.140. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the NUC domain of the reference protein sequence.141. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the NUC domain of the reference protein sequence.142. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the NUC domain of the reference protein sequence.143. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the NUC domain of the reference protein sequence.144. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the NUC domain of the reference protein sequence.145. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the NUC domain of the reference protein sequence.146. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the NUC domain of the reference protein sequence.147. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the NUC domain of the reference protein sequence.148. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the NUC domain of the reference protein sequence.149. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the NUC domain of the reference protein sequence.150. The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the NUC domain of the reference protein sequence.151 . The Type V Cas protein of any one of embodiments 1 to 136, wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the NUC domain of the reference protein sequence.152. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 50% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.153. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 55% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.154. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 60% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.155. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 65% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.156. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 70% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.157. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 75% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.158. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.159. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.160. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.161. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.162. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 96% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.163. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 97% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.164. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.165. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 99% identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.166. The Type V Cas protein of any one of embodiments 1 to 151 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the amino acid sequence of the RuvC-lll domain of the reference protein sequence.167. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 55% identical to the full length of the reference protein sequence.168. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 60% identical to the full length of the reference protein sequence.169. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 65% identical to the full length of the reference protein sequence.170. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 70% identical to the full length of the reference protein sequence.171 . The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 75% identical to the full length of the reference protein sequence.172. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 80% identical to the full length of the reference protein sequence.173. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 85% identical to the full length of the reference protein sequence.174. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 90% identical to the full length of the reference protein sequence.175. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 95% identical to the full length of the reference protein sequence.176. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 96% identical to the full length of the reference protein sequence.177. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 97% identical to the full length of the reference protein sequence.178. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 98% identical to the full length of the reference protein sequence.179. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is at least 99% identical to the full length of the reference protein sequence.180. The Type V Cas protein of embodiment 1 , wherein the amino acid sequence of the TypeV Cas protein comprises an amino acid sequence that is identical to the full length of the reference protein sequence.181 . The Type V Cas protein of any one of embodiments 1 to 180, which is a chimeric Type V Cas protein.182. The Type V Cas protein of any one of embodiments 1 to 181 , which is a fusion protein.183. The Type V Cas protein of embodiment 182, which comprises one or more nuclear localization signals.184. The Type V Cas protein of embodiment 183, which comprises two or more nuclear localization signals.185. The Type V Cas protein of embodiment 183 or embodiment 184, which comprises an N- terminal nuclear localization signal.186. The Type V Cas protein of any one of embodiments 183 to 185, which comprises a C- terminal nuclear localization signal.-ISO-187. The Type V Cas protein of any one of embodiments 183 to 186, which comprises an N- terminal nuclear localization signal and a C-terminal nuclear localization signal.188. The Type V Cas protein of any one of embodiments 183 to 187, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence KRTADGSEFESPKKKRKV (SEQ ID NO:122), PKKKRKV (SEQ ID NO:123), PKKKRRV (SEQ ID NO:124), KRPAATKKAGQAKKKK (SEQ ID NO:125), YGRKKRRQRRR (SEQ ID NO:126), RKKRRQRRR (SEQ ID NO:127), PAAKRVKLD (SEQ ID NO:128), RQRRNELKRSP (SEQ ID NO:129), VSRKRPRP (SEQ ID NQ:130), PPKKARED (SEQ ID NO:131), PQPKKKPL (SEQ ID NO:132), SALIKKKKKMAP (SEQ ID NO:133), PKQKKRK (SEQ ID NO:134), RKLKKKIKKL (SEQ ID NO:135), REKKKFLKRR (SEQ ID NO:136), KRKGDEVDGVDEVAKKKSKK (SEQ ID NO:137), RKCLQAGMNLEARKTKK (SEQ ID NO:138), NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO:139), RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NQ:140), or SSDDEATADSQHAAPPKKKRKV (SEQ ID NO:178).189. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence KRTADGSEFESPKKKRKV (SEQ ID NO:122).190. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence PKKKRKV (SEQ ID NO:123).191 . The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence PKKKRRV (SEQ ID NO:124).192. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence KRPAATKKAGQAKKKK (SEQ ID NO:125).193. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence YGRKKRRQRRR (SEQ ID NO:126).194. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence RKKRRQRRR (SEQ ID NO:127).195. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence PAAKRVKLD (SEQ ID NO:128).196. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence RQRRNELKRSP (SEQ ID NO:129).197. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence VSRKRPRP (SEQ ID NQ:130).198. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence PPKKARED (SEQ ID NO:131).199. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence PQPKKKPL (SEQ ID NO:132).200. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence SALIKKKKKMAP (SEQ ID NO:133).201 . The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence PKQKKRK (SEQ ID NO:134).202. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence RKLKKKIKKL (SEQ ID NO:135).203. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence REKKKFLKRR (SEQ ID NO:136).204. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO:137).205. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence RKCLQAGMNLEARKTKK (SEQ ID NO:138).206. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO:139).207. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NQ:140).208. The Type V Cas protein of embodiment 188, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence SSDDEATADSQHAAPPKKKRKV (SEQ ID NO:178).209. The Type V Cas protein of any one of embodiments 183 to 187, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence PKKKRKVG (SEQ ID NO:179).210. The Type V Cas protein of any one of embodiments 183 to 187, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence GRSSDDEATADSQHAAPPKKKRKV (SEQ ID NQ:180).211 . The Type V Cas protein of any one of embodiments 183 to 210, wherein the amino acid sequence of each nuclear localization signal is the same.212. The Type V Cas protein of any one of embodiments 181 to 211 , which comprises a fusion partner which is a DNA, RNA or protein modification enzyme, optionally wherein the DNA, RNA or protein modification enzyme is an adenosine deaminase, a cytidine deaminase, a reverse transcriptase, a guanosyl transferase, a DNA methyltransferase, a RNA methyltransferase, a DNA demethylase, a RNA demethylase, a dioxygenase, a polyadenylate polymerase, a pseudouridine synthase, an acetyltransferase, a deacetylase, a ubiquitin-ligase, a deubiquitinase, a kinase, a phosphatase, a NEDD8-ligase, a de-NEDDylase, a SUMO-ligase, a deSUMOylase, a histone deacetylase, a histone acetyltransferase, a histone methyltransferase, or a histone demethylase.213. The Type V Cas protein of any one of embodiments 181 to 212, which comprises a means for deaminating a nucleobase, optionally wherein the means for deaminating a nucleobase is a deaminase, e.g., an adenosine deaminase or cytidine deaminase.214. The Type V Cas protein of any one of embodiments 181 to 213, which comprises a fusion partner comprising a deaminase, optionally wherein the deaminase is an adenosine deaminase or cytidine deaminase.215. The Type V Cas protein of embodiment 214, wherein the amino acid sequence of the deaminase comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any one of SEQ ID NOS:214-249.216. The Type V Cas protein of any one of embodiments 181 to 212, which comprises a means for deaminating adenosine, optionally wherein the means for deaminating adenosine is an adenosine deaminase.217. The Type V Cas protein of any one of embodiments 181 to 212, which comprises a fusion partner which is an adenosine deaminase, optionally wherein the amino acid sequence of the adenosine deaminase comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with SEQ ID NO:166, optionally wherein the adenosine deaminase is the adenosine deaminase moiety contained in the adenine base editor ABE8e.218. The Type V Cas protein of any one of embodiments 181 to 212, which comprises a means for deaminating cytidine, optionally wherein the means for deaminating cytidine is a cytidine deaminase.219. The Type V Cas protein of any one of embodiments 181 to 212, which comprises a fusion partner which is a cytidine deaminase.220. The Type V Cas protein of any one of embodiments 181 to 219, which comprises a fusion partner comprising a UGI domain, optionally wherein the amino acid sequence of the UGI domain comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NQ:250.221 . The Type V Cas protein of any one of embodiments 181 to 220, which comprises a means for repressing gene expression, optionally wherein the means for repressing gene expression comprises a transcriptional repressor or effector domain thereof.222. The Type V Cas protein of any one of embodiments 181 to 220, which comprises a fusion partner comprising a transcriptional repressor or effector domain thereof.223. The Type V Cas protein of embodiment 221 or embodiment 222, wherein the amino acid sequence of the transcriptional repressor or effector domain thereof comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to any one of SEQ ID NOS:251-255.224. The Type V Cas protein of any one of embodiments 181 to 212, which comprises a means for synthesizing DNA from a single-stranded template, optionally wherein the means for synthesizing DNA from a single-stranded template is a reverse transcriptase.225. The Type V Cas protein of any one of embodiments 181 to 212, which comprises a fusion partner which is a reverse transcriptase.226. The Type V Cas protein of embodiment 224 or embodiment 225, wherein the amino acid sequence of the reverse transcriptase comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO:256 or SEQ ID NO:257.227. The Type V Cas protein of any one of embodiments 181 to 225, which comprises a tag.228. The Type V Cas protein of embodiment 226, wherein the tag is a SV5 tag, optionally wherein the SV5 tag comprises the amino acid sequence GKPIPNPLLGLDST (SEQ ID NO:141) or IPNPLLGLD (SEQ ID NO:142).229. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:1 .230. The Type V Cas protein of embodiment 229, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:1 .231 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:2.232. The Type V Cas protein of any one of embodiments 229 to 231 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:2.233. The Type V Cas protein of embodiment 229 or embodiment 230, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:3.234. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:7.235. The Type V Cas protein of embodiment 234, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:7.236. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:8.237. The Type V Cas protein of any one of embodiments 234 to 236, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:8.238. The Type V Cas protein of embodiment 234 or embodiment 235, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:9.239. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:13.240. The Type V Cas protein of embodiment 239, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:13.241 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:14.242. The Type V Cas protein of any one of embodiments 239 to 241 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:14.243. The Type V Cas protein of embodiment 239 or embodiment 240, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:15.244. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:19.245. The Type V Cas protein of embodiment 244, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:19.246. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NQ:20.247. The Type V Cas protein of any one of embodiments 244 to 246, whose amino acid sequence comprises the amino acid sequence of SEQ ID NQ:20.248. The Type V Cas protein of embodiment 244 or embodiment 245, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:21 .249. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:25.250. The Type V Cas protein of embodiment 249, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:25.251 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:26.252. The Type V Cas protein of any one of embodiments 249 to 251 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:26.253. The Type V Cas protein of embodiment 250 or embodiment 251 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:27.254. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:31.255. The Type V Cas protein of embodiment 254, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:31 .256. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:32.257. The Type V Cas protein of any one of embodiments 255 to 256, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:32.258. The Type V Cas protein of embodiment 254 or embodiment 255, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:33.259. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:37.260. The Type V Cas protein of embodiment 259, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:37.261 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:38.262. The Type V Cas protein of any one of embodiments 259 to 261 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:38.263. The Type V Cas protein of embodiment 259 or embodiment 260, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:39.264. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:43.265. The Type V Cas protein of embodiment 264, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:43.266. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:44.267. The Type V Cas protein of any one of embodiments 264 to 266, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:44.268. The Type V Cas protein of embodiment 264 or embodiment 265, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:45.269. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:49.270. The Type V Cas protein of embodiment 269, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:49.271 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NQ:50.272. The Type V Cas protein of any one of embodiments 269 to 271 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NQ:50.273. The Type V Cas protein of embodiment 269 or embodiment 270, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:51 .274. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:55.275. The Type V Cas protein of embodiment 274, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:55.276. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:56.277. The Type V Cas protein of any one of embodiments 274 to 276, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:56.278. The Type V Cas protein of embodiment 274 or embodiment 275, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:57.279. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:61.280. The Type V Cas protein of embodiment 279, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:61 .281 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:62.282. The Type V Cas protein of any one of embodiments 279 to 281 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:62.283. The Type V Cas protein of embodiment 279 or embodiment 280, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:63.284. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:67.285. The Type V Cas protein of embodiment 284, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:67.286. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:68.287. The Type V Cas protein of any one of embodiments 284 to 286, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:68.288. The Type V Cas protein of embodiment 284 or embodiment 285, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:69.289. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:73.290. The Type V Cas protein of embodiment 289, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:73.291 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:74.292. The Type V Cas protein of any one of embodiments 289 to 291 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:74.293. The Type V Cas protein of embodiment 289 or embodiment 290, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:75.294. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:79.295. The Type V Cas protein of embodiment 294, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:79.296. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NQ:80.297. The Type V Cas protein of any one of embodiments 294 to 296, whose amino acid sequence comprises the amino acid sequence of SEQ ID NQ:80.298. The Type V Cas protein of embodiment 294 or embodiment 295, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:81 .299. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:85.300. The Type V Cas protein of embodiment 299, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:85.301 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:86.302. The Type V Cas protein of any one of embodiments 299 to 301 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:86.303. The Type V Cas protein of embodiment 299 or embodiment 300, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:87.304. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:91.305. The Type V Cas protein of embodiment 304, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:91 .306. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:92.307. The Type V Cas protein of any one of embodiments 304 to 306, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:92.308. The Type V Cas protein of embodiment 304 or embodiment 305, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:93.309. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:97.310. The Type V Cas protein of embodiment 309, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:97.311 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:98.312. The Type V Cas protein of any one of embodiments 309 to 311 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:98.313. The Type V Cas protein of embodiment 309 or embodiment 310, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:99.314. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NQ:103.315. The Type V Cas protein of embodiment 314, whose amino acid sequence comprises the amino acid sequence of SEQ ID NQ:103.316. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NQ:104.317. The Type V Cas protein of any one of embodiments 314 to 316, whose amino acid sequence comprises the amino acid sequence of SEQ ID NQ:104.318. The Type V Cas protein of embodiment 314 or embodiment 315, whose amino acid sequence comprises the amino acid sequence of SEQ ID NQ:105.319. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NQ:109.320. The Type V Cas protein of embodiment 319, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:109.321 . The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:110.322. The Type V Cas protein of any one of embodiments 319 to 321 , whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:110.323. The Type V Cas protein of embodiment 319 or embodiment 320, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:111 .324. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:115.325. The Type V Cas protein of embodiment 324, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:115.326. The Type V Cas protein of any one of embodiments 1 to 228, wherein the reference protein sequence is SEQ ID NO:116.327. The Type V Cas protein of any one of embodiments 324 to 326, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:116.328. The Type V Cas protein of embodiment 324 or embodiment 325, whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:117.329. A Type V Cas protein whose amino acid sequence is identical to a Type V Cas protein of any one of embodiments 1 to 328 except for one or more amino acid substitutions relative to the reference sequence that provide nickase activity, optionally wherein the one or more amino acid substitutions comprise a substiution (e.g., alanine substitution) at a position corresponding to position D908 of Cas12a, E993 of Cas12a, R1226 of Cas12a, or D1263 of Cas12a (e.g., as shown in Table 5), or a combination thereof.330. A ZWGD Type V Cas guide RNA (gRNA) molecule.331 . A ZJHK Type V Cas guide RNA (gRNA) molecule.332. A ZIKV Type V Cas guide RNA (gRNA) molecule.333. A ZZFT Type V Cas guide RNA (gRNA) molecule.334. A YYAN Type V Cas guide RNA (gRNA) molecule.335. A ZZGY Type V Cas guide RNA (gRNA) molecule.336. A ZKBG Type V Cas guide RNA (gRNA) molecule.337. A ZZKD Type V Cas guide RNA (gRNA) molecule.338. A ZXPB Type V Cas guide RNA (gRNA) molecule.339. A ZPPX Type V Cas guide RNA (gRNA) molecule.340. A ZXHQ Type V Cas guide RNA (gRNA) molecule.341 . A ZQKH Type V Cas guide RNA (gRNA) molecule.342. A ZRGM Type V Cas guide RNA (gRNA) molecule.343. A ZTAE Type V Cas guide RNA (gRNA) molecule.344. A ZSQQ Type V Cas guide RNA (gRNA) molecule.345. A ZSYN Type V Cas guide RNA (gRNA) molecule.346. A ZRBH Type V Cas guide RNA (gRNA) molecule.347. A ZWPU Type V Cas guide RNA (gRNA) molecule.348. A ZZQE Type V Cas guide RNA (gRNA) molecule.349. A ZRXE Type V Cas guide RNA (gRNA) molecule.350. The gRNA of any one of embodiments 330 to 349, which is a gRNA for editing a human 62 / W gene.351 . The gRNA of any one of embodiments 330 to 349, which is a gRNA for editing a human TRAC gene.352. The gRNA of any one of embodiments 330 to 349, which is a gRNA for editing a human PD1 gene.353. The gRNA of any one of embodiments 330 to 349, which is a gRNA for editing a human AAVS1 genomic sequence.354. The gRNA of any one of embodiments 330 to 349, which is a gRNA for editing a human EMX1 gene.355. The gRNA of any one of embodiments 330 to 349, which is a gRNA for editing a human BCL11A gene.356. The gRNA of any one of embodiments 330 to 349, which is a gRNA for editing a human PCSK9 gene.357. The gRNA of any one of embodiments 330 to 349, which is a gRNA for editing a human VEGF gene.358. The gRNA of any one of embodiments 330 to 349, which is a gRNA for editing a human Match6 genomic sequence.359. A guide RNA (gRNA) molecule for editing a human B2M gene comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:164-168 and 181-183.360. A guide RNA (gRNA) molecule for editing a human TRAC gene comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:169-173 and 184-192.361 . A guide RNA (gRNA) molecule for editing a human PD1 gene comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:174-177.362. A guide RNA (gRNA) molecule for editing a human AAVS1 genomic sequence comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:193-196.363. A guide RNA (gRNA) molecule for editing a human EMX1 genomic sequence comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:197-198.-1 go-364. A guide RNA (gRNA...

Claims

WHAT IS CLAIMED IS:1 . A Type V Cas protein comprising an amino acid sequence having at least 90% sequence identity to:(a) the amino acid sequence of a WED-I domain of a reference protein sequence;(b) the amino acid sequence of a REC1 domain of a reference protein sequence;(c) the amino acid sequence of a REC2 domain of a reference protein sequence;(d) the amino acid sequence of a WED-II domain of a reference protein sequence;(e) the amino acid sequence of a PI domain of a reference protein sequence;(f) the amino acid sequence of a WED-HI domain of a reference protein sequence;(g) the amino acid sequence of a RuvC-l domain of a reference protein sequence;(h) the amino acid sequence of a BH domain of a reference protein sequence;(i) the amino acid sequence of a RuvC-ll domain of a reference protein sequence;(j) the amino acid sequence of a NUC domain of a reference protein sequence;(k) the amino acid sequence of a RuvC-lll domain of a reference protein sequence; or(l) the amino acid sequence of the full length of a reference protein sequence; wherein the reference protein sequence is SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:1 , SEQ ID NO:2, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:19, SEQ ID NQ:20, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:31 , SEQ ID NO:32, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:49, SEQ ID NQ:50, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:61 , SEQ ID NO:62, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:79, SEQ ID NQ:80, SEQ ID NO:85, SEQ ID NO:86, SEQ ID NO:91 , SEQ ID NO:92, SEQ ID NO:97, SEQ ID NO:98, SEQ ID NQ:103, SEQ ID NQ:104, SEQ ID NQ:109, SEQ ID NQ:110, SEQ ID NO:115, or SEQ ID NO:116.

2. The Type V Cas protein of claim 1 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, or is identical to the full length of the reference protein sequence.

3. The Type V Cas protein of claim 1 , wherein the amino acid sequence of the Type V Cas protein comprises an amino acid sequence that is identical to the full length of the reference protein sequence.

4. The Type V Cas protein of any one of claims 1 to 3, which is a fusion protein.

5. The Type V Cas protein of claim 4, which comprises one or more nuclear localization signals, and which optionally comprises an N-terminal nuclear localization signal and / or a C-terminal nuclear localization signal.

6. The Type V Cas protein of claim 5, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence KRTADGSEFESPKKKRKV (SEQ ID NO:122), PKKKRKV (SEQ ID NO:123), PKKKRRV (SEQ ID NO:124), KRPAATKKAGQAKKKK (SEQ IDNO:125), YGRKKRRQRRR (SEQ ID NO:126), RKKRRQRRR (SEQ ID NO:127), PAAKRVKLD (SEQ ID NO:128), RQRRNELKRSP (SEQ ID NO:129), VSRKRPRP (SEQ ID NQ:130), PPKKARED (SEQ ID N0:131), PQPKKKPL (SEQ ID NO:132), SALIKKKKKMAP (SEQ ID NO:133), PKQKKRK (SEQ ID NO:134), RKLKKKIKKL (SEQ ID NO:135), REKKKFLKRR (SEQ ID NO:136), KRKGDEVDGVDEVAKKKSKK (SEQ ID NO:137), RKCLQAGMNLEARKTKK (SEQ ID NO:138), NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO:139), RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NQ:140), or SSDDEATADSQHAAPPKKKRKV (SEQ ID NO:178).

7. The Type V Cas protein of claim 5, wherein the amino acid sequence of one or more of the nuclear localization signals comprises the amino acid sequence GRSSDDEATADSQHAAPPKKKRKV (SEQ ID NQ:180).

8. The Type V Cas protein of any one of claims 5 to 7, comprising a C-terminal nuclear localization signal.

9. The Type V Cas protein of any one of claims 4 to 8, which comprises a fusion partner which is a DNA, RNA or protein modification enzyme, optionally wherein the DNA, RNA or protein modification enzyme is an adenosine deaminase, a cytidine deaminase, a reverse transcriptase, a guanosyl transferase, a DNA methyltransferase, a RNA methyltransferase, a DNA demethylase, a RNA demethylase, a dioxygenase, a polyadenylate polymerase, a pseudouridine synthase, an acetyltransferase, a deacetylase, a ubiquitin-ligase, a deubiquitinase, a kinase, a phosphatase, a NEDD8-ligase, a de-NEDDylase, a SUMO-ligase, a deSUMOylase, a histone deacetylase, a histone acetyltransferase, a histone methyltransferase, or a histone demethylase.

10. The Type V Cas protein of any one of claims 4 to 9, which comprises (a) a fusion partner which is an adenosine deaminase, optionally wherein the amino acid sequence of the adenosine deaminase comprises an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with SEQ ID NO:143, optionally wherein the adenosine deaminase is the adenosine deaminase moiety contained in the adenine base editor ABE8e; (b) a fusion partner which is a cytodine deaminase; or (c) a fusion partner which is a reverse transcriptase.11 . The Type V Cas protein of any one of claims 4 to 10, which comprises a tag, e.g., a SV5 tag, optionally wherein the SV5 tag comprises the amino acid sequence GKPIPNPLLGLDST (SEQ ID NO:141).

12. A Type V Cas protein whose amino acid sequence is identical to a Type V Cas protein of any one of claims 1 to 11 except for one or more amino acid substitutions relative to the reference sequence that provide nickase activity, optionally wherein the one or more amino acid substitutions comprise a substiution (e.g., alanine substitution) at a position corresponding to position D908 of Cas12a, E993 of Cas12a, R1226 of Cas12a, or D1263 of Cas12a (e.g., as shown in Table 5), or a combination thereof.

3. A guide RNA (gRNA) molecule:(a) for editing a human B2 / W gene comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs: 164-168;(b) for editing a human TRAC gene comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs: 169-173;(c) for editing a human PD1 gene comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:174-177;(d) for editing a human B2 / Wgene comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs: 181 -183;(e) for editing a human TRAC gene comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:184-192;(f) for editing a human AAVS1 genomic sequence comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:193-196;(g) for editing a human EMX1 genomic sequence comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:197-198;(h) for editing a human BCL11A genomic sequence comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID NOs:199-202;(i) for editing a human PCSK9 genomic sequence comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence orcomprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is selected from SEQ ID N0s:203-204; or(j) for editing a human VEGF genomic sequence comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence or comprises a nucleotide sequence that is at least 85% identical to the reference sequence, wherein the reference sequence is SEQ ID NO:205.

14. A gRNA comprising a spacer and a crRNA scaffold, wherein:(a) the spacer is positioned 3’ to the crRNA scaffold; and(b) the nucleotide sequence of the crRNA scaffold comprises a nucleotide sequence that is at least 50% identical to a reference scaffold sequence, wherein the reference scaffold sequence is selected from SEQ ID NOS:211-213.

15. A gRNA comprising a spacer and a crRNA scaffold, wherein:(a) the spacer is positioned 3’ to the crRNA scaffold; and(b) the nucleotide sequence of the crRNA scaffold comprises a nucleotide sequence that is at least 50% identical to a reference scaffold sequence, wherein the reference scaffold sequence is selected from SEQ ID NOS:144-163.

16. The gRNA of any one of claims 14 to 15, which comprises a spacer that is 15 to 30 nucleotides in length, 18 to 30 nucleotides in length, 20 to 28 nucleotides in length, 22 to 26 nucleotides in length, 23 to 25 nucleotides in length, 22 to 25 nucleotides in length, 15 to 25 nucleotides in length, 16 to 24 nucleotides in length, 17 to 23 nucleotides in length, 18 to 22 nucleotides in length, 19 to 21 nucleotides in length, 25 nucleotides in length, 24 nucleotides in length, 23 nucleotides in length, 22 nucleotides in length, 21 nucleotides in length, or 20 nucleotides in length.

17. A system comprising the Type V Cas protein of any one of claims 1 to 12 and a guide RNA (gRNA) comprising a spacer sequence, optionally wherein the gRNA is a gRNA according to any one of claims 13 to 16.

18. A nucleic acid encoding the Type V Cas protein of any one of claims 1 to 12, optionally wherein the nucleotide sequence encoding the Type V Cas protein is operably linked to a promoter that is heterologous to the Type V Cas protein.

19. The nucleic acid of claim 18, wherein the nucleotide sequence encoding the Type V Cas protein is codon optimized for expression in human cells.

20. The nucleic acid of claim 18 or claim 19, which is a plasmid or a viral genome, optionally an adeno-associated virus (AAV) genome, e.g., an AAV2, AAV5, AAV7m8, AAV8, AAV9, AAVrh8r, or AAVrhI O genome.

21. The nucleic acid of any one of claims 18 to 20, further encoding a gRNA22. A nucleic acid encoding the gRNA of any one of claims 13 to 16.

23. A nucleic acid encoding the Type V Cas protein and gRNA of the system of claim 17.

24. A plurality of nucleic acids comprising separate nucleic acids encoding the Type V Cas protein and gRNA of the system of claim 17.

25. A particle comprising a Type V Cas protein according to any one of claims 1 to 12, a gRNA according to any one of claims 13 to 16, a system according to claim 17, a nucleic acid according to any one of claims 18 to 23, or a plurality of nucleic acids according to claim 24.

26. A pharmaceutical composition comprising a Type V Cas protein according to any one of claims 1 to 12, a gRNA according to any one of claims 13 to 16, a system according to claim 17, a nucleic acid according to any one of claims 18 to 23, a plurality of nucleic acids according to claim 24, or a particle according to claim 25 and at least one pharmaceutically acceptable excipient.

27. A Type V Cas protein according to any one of claims 1 to 12, a gRNA according to any one of claims 13 to 16, a system according to claim 17, a nucleic acid according to any one of claims 18 to 23, a plurality of nucleic acids according to claim 24, a particle according to claim 25, or a pharmaceutical composition according to claim 26 for use in a method of editing a human genomic sequence.

28. The Type V Cas protein, gRNA, system, nucleic acid, a plurality of nucleic acids, particle, or pharmaceutical composition for use according to claim 27, wherein the human genomic sequence is a TRAC, B2M, or PD1 , genomic sequence, optionally wherein the human genomic sequence is in a T cell.

29. An ex vivo human cell comprising a Type V Cas protein according to any one of claims 1 to 12, a gRNA according to any one of claims 13 to 16, a system according to claim 17, a nucleic acid according to any one of claims 18 to 23, a plurality of nucleic acids according to claim 24, or a particle according to claim 25.

30. A Type V Cas protein according to any one of claims 1 to 12, the gRNA according to any one of claims 13 to 16, or the system of claim 17 for use in a nucleic acid detection assay.

Citation Information

Patent Citations

  • Nuclease resistant chimeric oligonucleotides

    US20030158403A1

  • Synthetic polynucleotides

    US3687808A

  • Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof

    US4469863A

  • Oligonucleotides, a process for preparing the same and their application as mediators of the action of interferon

    US4476301A

  • Linkage of proteins to nucleic acids

    US4587044A