Methods for treating cancer using Anti-CCR8 antibodies

Targeting CCR8 with specific antibodies depletes Tregs and enhances immunotherapy efficacy, addressing the limitations of current cancer treatments by improving immune response and reducing adverse events.

WO2025226603A1PCT designated stage Publication Date: 2025-10-30SURFACE ONCOLOGY LLC
View PDF 61 Cites 0 Cited by

Patent Information

Application Number
PCT/US2025/025623
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-10-23
Filing Date
2025-04-21
Publication Date
2025-10-30

AI Technical Summary

Technical Problem

Current immunotherapies for cancer are limited in efficacy due to the ability of tumor-infiltrating regulatory T cells (Tregs) to dampen the immune response, making it difficult to target and inhibit their activity effectively.

Method used

Administration of antibodies or antigen-binding portions that specifically bind to the N-terminal extracellular domain of human CCR8, comprising specific CDR sequences, to deplete or inhibit Tregs and enhance immune response against tumors, potentially combined with toripalimab for enhanced efficacy.

Benefits of technology

The approach increases anti-tumor efficacy, therapeutic window, and half-life of immunotherapy agents like toripalimab while reducing adverse events, enhancing immune response and depleting Tregs, thereby improving treatment outcomes for various cancers.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure US2025025623_30102025_PF_FP_ABST
    Figure US2025025623_30102025_PF_FP_ABST
Patent Text Reader

Abstract

The present disclosure is directed to methods for treating a tumor or a cancer using antibodies or antigen-binding portions thereof that specifically bind human CCR8 and pharmaceutical compositions comprising the same. Some aspects of the disclosure are directed to methods for treating cancer usinganti-CCR8 antibodies in combination with an additional anticancer agent, including methods of measuring and increasing levels of cytokines and cell surface markers and avoiding treatment emergent adverse events.
Need to check novelty before this filing date? Find Prior Art

Description

METHODS FOR TREATING CANCER USING ANTI-CCR8 ANTIBODIESCROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application claims priority benefit of U.S. Provisional application number 63 / 637,206, filed April 22, 2024, U.S. Provisional application number 63 / 691,576, filed September 6, 2024, and U.S. Provisional application number 63 / 710,846, filed October 23, 2024, the disclosures of which are incorporated herein by reference in their entireties.REFERENCE TO SEQUENCE LISTING

[0002] The present application contains a Sequence Listing which has been submitted electronically in XML format. Said XML copy, created on April 21, 2025, is named “4494- 164W01.xml” and is 296,857 bytes in size. The information in the electronic format of the sequence listing is incorporated herein by reference in its entirety.FIELD OF THE DISCLOSURE

[0003] The present disclosure provides methods and compositions for use in treating tumors and cancer using antibodies and antigen -binding portions thereof that specifically bind human CCR8.BACKGROUND OF THE DISCLOSURE

[0004] Immunotherapy is a rapidly advancing and very promising treatment for various forms of cancer, with many recent successes. However, some patients have limited to no response to current immunotherapies, and others exhibit relapse following initial responsiveness.

[0005] The human immune system includes checks and balances that serve to stop an overactive immune system from harming the body. Regulatory T cells ("Tregs") have a vital role in maintaining a functional immune system by suppressing the immune response. However, the ability of Tregs, and especially tumor infiltrating Tregs, to dampen an immune response can block a natural immune response to a tumor.

[0006] In part because of the significant overlap in gene expression across different immune cell populations, it has been very difficult to generate therapies that specifically target Tregs, and more particularly, tumor infiltrating Tregs. Thus, there remains a need for therapies that are specifically able to target and inhibit the activity of Tregs in the tumor microenvironment.SUMMARY OF THE DISCLOSURE

[0007] In some aspects, the present disclosure includes a method for treating a subject having a tumor or a cancer comprising administering to the subject a pharmaceutical composition comprising about 100 mg to about 3,000 mg of an antibody or an antigen-binding portion thereof that specifically binds to one or more amino acids within the N-terminal extracellular domain of human CCR8, wherein the antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0008] In some aspects, the VH chain comprises the amino acid sequence set forth in SEQ ID NO: 41 . In some aspects, the VL chain comprises the amino acid sequence set forth in SEQ ID NO: 43. In some aspects, the antibody or antigen-binding portion thereof comprises: a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 41 and a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 43. The present disclosure includes an antibody (“CHS-114”) containing VH chain comprising the amino acid sequence set forth in SEQ ID NO: 41 and VL chain comprising the amino acid sequence set forth in SEQ ID NO: 43.

[0009] In one aspect, the present disclosure includes a method of treating a subject having a tumor or a cancer comprising: collecting a baseline blood sample (whole blood, serum, or plasma) from the subject prior to administering a dose of an anti-CCR8 antibody or antigenbinding portion thereof to the subject; measuring a baseline concentration of each of one or more cytokines in the baseline blood sample; administering at least one dose of the anti-CCR8 antibody or antigen-binding portion thereof to the subject for a treatment cycle; collecting a post-dose blood sample from the subject during or after the treatment cycle; measuring a post-dose concentration of each of the one or more cytokines in the post-dose blood sample; and treating the subject with a first treatment regimen comprising administering the anti-CCR8 antibody or antigen-binding portion thereof if the post-dose concentration is greater than the baseline concentration, or treating the subject with a second treatment regimen comprising administering toripalimab and the anti- CCR8 antibody or antigen-binding portion thereof if the post-dose concentration is equal to or less than the baseline concentration.

[0010] In one aspect, the present disclosure includes a method of treating a subject having a tumor or a cancer comprising: collecting a baseline sample (c.g. tumor tissue or blood) from the subject prior to administering a dose of an anti-CCR8 antibody or antigen-binding portion thereof to the subject; measuring a baseline frequency of each of one or more cell surface markers in the baseline sample; administering at least one dose of the anti-CCR8 antibody or antigen-binding portion thereof to the subject for a treatment cycle; collecting a post-dose sample from the subject during or after the treatment cycle; measuring a post-dose frequency of each of the one or more cell surface markers in the post-dose sample; and treating the subject with a first treatment regimen comprising administering the anti-CCR8 antibody or antigen-binding portion thereof if the postdose frequency is greater than the baseline frequency, or treating the subject with a second treatment regimen comprising administering toripalimab and the anti-CCR8 antibody or antigenbinding portion thereof if the post-dose frequency is equal to or less than the baseline frequency.

[0011] In one aspect, the present disclosure includes a method of treating a subject having a head and neck cancer, the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50, optionally wherein the subject has a squamous cell carcinoma of pharynx (oropharynx, hypopharynx, or nasopharynx), larynx, oral cavity, salivary gland, or paranasal sinus. In some aspects, the cancer expresses HPV pl6 or p 18. In some aspects, the cancer is HPV negative. In some aspects, the subject has an oropharyngeal cancer that expresses HPV pl6 and / or pl8.

[0012] In one aspect, the present disclosure includes a method of treating a subject having a gastric cancer or a gastroesophageal junction (GEJ) cancer, the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ IDNO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0013] In some aspects, the cancer has high microsatellite instability (MSI-H) and / or deficient mismatch repair (dMMR). In some aspects, the subject has an endometrial cancer with MSI-H and / or dMMR. In some aspects, the subject has a colorectal cancer with MSI-H and / or dMMR. In some aspects, the subject has a prostate cancer with MSI-H and / or dMMR. In some aspects, the subject has a breast cancer with MSI-H and / or dMMR. In some aspects, the subject has a pancreatic cancer with MSI-H and / or dMMR. In some aspects, the subject has a gastric cancer with MSI-H and / or dMMR. In some aspects, the cancer has micro satellite stability (MSS) and / or proficient mismatch repair (pMMR). In some aspects, the subject has a gastric cancer that has MSS and / or pMMR. In some aspects, the subject has a colorectal cancer (CRC) that has MSS and / or pMMR. In some aspects, the subject has a pancreatic cancer that has MSS and / or pMMR. In some aspects, the subject has a pancreatic ductal adenocarcinoma (PDAC) that has MSS and / or pMMR.

[0014] In one aspect, the present disclosure includes a method of treating a subject having a tumor without inducing one or more treatment emergent adverse effects (TEAEs), the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0015] In certain aspects, the present disclosure provides methods of increasing anti-tumor efficacy, therapeutic window, half-life, or exposure of an anti-PDl antibody without increasing adverse events in a subject. In some aspects, the present disclosure provides a method of increasing anti-tumor efficacy, therapeutic window, half-life, or exposure of toripalimab by administering toripalimab to a subject in combination with administering an anti-CCR8 antibody or antigenbinding portion thereof of the present disclosure. In some aspects, the present disclosure provides such advantageous effects without significantly increasing adverse events in the subject.

[0016] In one aspect, the present disclosure provides a method of increasing the efficacy of an immunotherapy agent in a subject with a tumor administered the immunotherapy agent, comprising administering an anti-CCR8 antibody, or antigen-binding portion thereof, to the subject at a dose of about 100 mg to about 3000 mg. In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50. In some aspects, the present disclose includes increasing a ratio of CD8+T cells to Tregs in the tumor microenvironment compared to a baseline ratio.

[0017] In one aspect, the present disclosure provides a method of treating a subject having a PD-L1 positive tumor or cancer comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50. In some aspects, the tumor or cancer has a combined positive score (CPS) of > 1. In some aspects, the subject has previously been treated with a PD-1 inhibitor.

[0018] In one aspect, the present disclosure includes a method of increasing a concentration of one or more cytokines in a subject comprising administering to the subject a first treatment regimen comprising an anti-CCR8 antibody or an antigen-binding portion thereof, or a second treatment regimen comprising administering toripalimab and the anti-CCR8 antibody or antigen-binding portion thereof, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0019] In one aspect, the present disclosure includes a method of increasing a frequency of one or more cell surface markers in a biopsy sample of a subject comprising administering to the subject a first treatment regimen comprising an anti-CCR8 antibody or an antigen-binding portion thereof, or a second treatment regimen comprising administering toripalimab and the anti- CCR8 antibody or antigen-binding portion thereof, wherein the anti-CCR8 antibody or antigenbinding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0020] In one aspect, the present disclosure provides a method of maintaining a serum concentration of an anti-CCR8 antibody, or antigen-binding portion thereof, at or above a target trough concentration in a subject, comprising administering the anti-CCR8 antibody, or antigenbinding portion thereof, to the subject at a dose of about 100 mg to about 3000 mg. In some aspects, the target trough concentration is about 10 pg / L to about 50 pg / mL. In some aspects, the target trough concentration is about 10 pg / mL to about 35 pg / mL.

[0021] In one aspect, the present disclosure includes a method of treating a subject having a tumor or a cancer comprising intravenously administering to the subject at least 100 mg of an anti-CCR8 antibody or an antigen-binding portion thereof comprising a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 41 and comprising a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 43 every 3 weeks (Q3W).

[0022] In some aspects, the antibody or antigen-binding portion thereof comprises a singlechain variable fragment (scFv) of an antibody. In some aspects, the antibody or antigen-binding portion thereof comprises a humanized antibody; or a chimeric antibody. In some aspects, the antibody or antigen-binding portion thereof comprises a bispecific antibody, a bispecific T cell engager (BiTE), a multispecific antibody, a biparatopic antibody, an immunoconjugate, an antibody drug conjugate, or a combination thereof.

[0023] In some aspects, the antibody or antigen-binding portion thereof is afucosylated.

[0024] In some aspects, the antibody or the antigen-binding portion thereof comprises anIgGl Fc domain.

[0025] In some aspects, the antibody or antigen-binding portion thereof is administered to the subject at a dose of about 100 to about 1,500 mg. In some aspects, the antibody or antigenbinding portion thereof is administered to the subject at a dose of about 100 mg, about 300 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, or about 1600 mg.

[0026] In some aspects, the antibody or antigen-binding portion thereof is administered weekly (QW), bi-weekly (Q2W), every 3 weeks (Q3W), or every 4 weeks (Q4W). In some aspects, the antibody or antigen-binding portion thereof is administered every 3 weeks (Q3W).

[0027] In some aspects, the pharmaceutical composition comprising the antibody or antigen-binding portion thereof is administered parenterally. In some aspects, the pharmaceutical composition comprising the antibody or antigen-binding portion thereof is administered intravenously, subcutaneously, intramuscularly, or intraperitoneally. In some aspects, the pharmaceutical composition comprising the antibody or antigen-binding portion thereof is administered via intravenous infusion.

[0028] In some aspects, the present disclosure includes enhancing an immune response to a tumor; reducing, depleting, or killing tumor infiltrating regulatory T (“Treg”) cells; inducing internalization of CCR8 in tumor infiltrating regulatory T (“Treg”) cells; activating NK cells; inducing NK cell mediated killing of tumor infiltrating regulatory T (“Treg”) cells; binding to cynomolgus monkey (“cyno”) CCR8; inducing antibody-dependent cellular cytotoxicity (ADCC) in a subject following administration of the anti-CCR8 antibody; inducing antibody-dependent cellular phagocytosis (ADCP) in a subject following administration of the anti-CCR8 antibody; inducing upregulation of 4- IBB, CD25, CD 107a, or a combination thereof on the surface of NK cells; inducing down-regulation of CD16 on the surface of NK cells in the subject; inducing upregulation of B7-H3, CD83, CD86, HLA-DR, CD40, or a combination thereof on the surface of monocytes; inducing secretion of one or more cytokines; or combination thereof.

[0029] In some aspects, the method comprises reducing, depleting, or killing tumor infiltrating regulatory T ("Treg") cells in the subject; depleting the number of tumor infiltrating Treg cells relative to the number of tumor infiltrating Treg cells in the absence of the antibody or antigen binding portion thereof; depleting the number of tumor infiltrating Treg cells by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, or at least about 50% relative to the number oftumor infiltrating Treg cells in the absence of the antibody or antigen binding portion thereof. In some aspects, administration of the pharmaceutical composition comprising the antibody or antigen-binding portion thereof induces internalization of CCR8 by tumor infiltrating Treg cells.

[0030] In some aspects, the subject has a solid tumor, a carcinoma, a head and neck squamous cell carcinoma (HNSCC), a refractory or relapsed cancer, advanced, locally advanced, or metastatic cancer. In some aspects, the subject has a squamous cell carcinoma of pharynx (oropharynx, hypopharynx, nasopharynx), larynx, oral cavity, salivary gland, or paranasal sinus.

[0031] In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof is administered in combination with an additional anticancer agent. In some aspects, the additional anticancer agent is selected from a small molecule, an antibody or antigen binding fragment thereof, a polypeptide, a radiation therapy, a surgery, or a combination thereof. In some aspects, the additional anticancer agent comprises a chemotherapy. In some aspects, the chemotherapy comprises a platinum-based chemotherapy. In some aspects, the additional anticancer agent is an immune checkpoint inhibitor. In some aspects, the additional anticancer agent is selected from a PD-1 inhibitor, PD-L1 inhibitor, PD-L2 inhibitor, LAG-3 inhibitor, TIGIT inhibitor, CD112R inhibitor, TIM3 inhibitor, tumor-associated macrophage (TAM) inhibitor, STING agonist, 4- IBB agonist, CL22 inhibitor, VISTA inhibitor, CD47 inhibitor, B7-H3 inhibitor, CTLA4 inhibitor, CCR4 inhibitor, 0X40 inhibitor, OX40L, IDO1 inhibitor, CD70 inhibitor, CD27 inhibitor, or A2AR inhibitor.

[0032] In some aspects, the additional anticancer agent is selected from PDR001, nivolumab, pembrolizumab, pidilizumab, MEDI0680, REGN2810, TSR-042, PF-06801591, AMP-224, FAZO53, Atezolizumab, Avelumab, Durvalumab, and BMS-936559, Sunitinib, Cabozantinib, Axitinib, Lenvatinib, Everolimus, Bevacizumab, epacadostat, NKTR-214 (CD- 122-biased agonist), Tivozanib, abexinostat, Ipilimumab, tremelimumab, Pazopanib, Sorafenib, Temsirolimus, Ramucirumab, niraparib, savolitinib, vorolanib (X-82), Regorafenib, Donafenib, Camrelizumab (SHR- 1210), pexastimogene devacirepvec (JX-594), apatinib (YN968D1), encapsulated doxorubicin, Tivantinib (ARQ197), ADI- PEG 20, binimetinib, apatinib mesylate, nintedanib, lirilumab, Nivolumab, Pembrolizumab, Atezolizumab, Avelumab, Durvalumab, Cemiplimab-rwlc, tislelizumab, spartalizumab, cemiplimab, cetrelimab, toripalimab, sintilimab, SHR-1210, PDR001, MGA012, PDR001, AB122, JTX-4014, BGB-108, BCD-100, BAT1306, LZM009, AK105, HLX10, BMS-935559, MEDI4736, MPDL3280A, MSB0010718C, KN035,CS1001 , SHR-1316, CBT-502, A167, STI-A101 , CK-301, BGB-A333, MSB-231 1 , HLX20, LY3300054, trcmclimumab, AGEN1884, CP-675,206, BMS-986016, LAG525, INCAGN2385, eftilagimod alpha, MEDI9447, OMP-31M32, JNJ-6161O588, CA-170, enoblituzumab, MGD009, 8H9, CPI-444, BMS-936561, INCAGN2390, sabatolimab (MBG453), Hu5F9-G4, TTI-621, INCAGN2390, TSR-022, MEDI0562, MOXR-0916, PF-04518600, GSK3174998, BMS-986178, 9B12, obinutuzumab or rituximab.

[0033] In some aspects, the PD-1 inhibitor is toripalimab. In some aspects, toripalimab is administered at a dose of about 120 mg to about 720 mg, or about 240 mg to about 480 mg, or about 240 mg to about 360 mg. In some aspects, toripalimab is administered at a dose of about 120 mg, about 240 mg, about 340 mg, about 360 mg, or about 480 mg.

[0034] In some aspects, toripalimab is administered weekly (QW), bi-weekly (Q2W), every 3 weeks (Q3W), or every 4 weeks (Q4W) or every 6 weeks (Q6W).

[0035] These and other aspects of the invention will be apparent upon reference to the following detailed description, claims, aspects, procedures, compounds, and / or compositions and associated background information and references, which are hereby incorporated in their entirety.BRIEF DESCRIPTION OF THE DRAWINGS

[0036] FIG. 1A is a graph showing human CCR8 expression levels as median FPKM (number of fragments per kilobase exon per million reads) in different tumor types from TCGA database. FIG. IB shows scatter plots displaying the correlation of CCR8 expression with FOXP3 expression levels (TPM: transcripts per kilobase million) evaluated by TIMER2.0 in HNSCC, NSCLC adenocarcinoma (adeno), NSCLC squamous cell carcinoma (SCC), gastric, breast, testicular and pancreatic tumors. Purity-adjusted partial spearman's rho value as the degree of their correlation is provided as insets for each correlation analysis. Rho< 0.3 considered weak, 0.3<Rho<0.6 considered moderate and Rho>0.6 strong association. FIGs. 1C and ID are graphs showing frequency (1C) and density (ID) of CCR8 receptors on immune cell subsets in healthy human peripheral blood mononuclear cells (PBMCs) and dissociated primary tumor cells (DTCs). HNSCC = head and neck squamous cell carcinoma. NSCLC = non-small cell lung cancer. PDAC = pancreatic ductal adenocarcinoma. RCC - renal cell carcinoma. HCC = hepatocellular carcinoma.

[0037] FIGs. 2A-2B are graphs showing the density (2A) and frequency among total Tregs (2B) of CCR8+Tregs in solid tumor types. FIGs. 2C-2D display the median density of naturalkiller (NK) cells (2C) and the CD64 abundance (2D) as determined by immunohistochemistry (IHC) versus the median density of CCR8+Trcgs.

[0038] FIG. 3A shows box plots demonstrating CCR8+Treg cell density in HNSCC as a function of PD-L1 combined positive score (CPS). FIG. 3B shows box plots demonstrating CCR8+Treg cell density in HNSCC as a function of clinical stage of disease (left) or HPV status (right). FIG. 3C presents box plots demonstrating CCR8+cell density in NSCLC, gastric cancer, and cervical squamous cell carcinoma (SCC) as a function of PD-L1 CPS.

[0039] FIG. 4 is a heatmap of 25 core-enrichment genes from the Treg pathway before or after NSCLC cells are treated with the anti-PD-1 antibody toripalimab.

[0040] FIGs. 5A-5C are graphical representations of anti-CCR8 antibody binding to 293T cells ectopically expressing CCR8. FIG. 5A shows binding affinity of CHS-114 to human CCR8. FIG. 5B shows binding of CHS-114 and other anti-CCR8 antibody candidates to human CCR8. FIG. 5C shows CHS-114 binding or lack of binding to human, cynomolgus, pig, rat, and mouse CCR8. MFI = mean fluorescence intensity.

[0041] FIG. 6A is a line graph illustrating ADCP signaling using CFSE-labeled Raji CCR8 cells co-cultured with monocyte-derived macrophages, and treated with CHS- 114 or isotype control and after 3 hours analyzed by FC. % phagocytosis represents the frequency of CD14+CFSE+macrophages among total CD14+macrophages. Error=SD. FIG. 6B is a line graph illustrating ADCC signaling using labeled Raji-hCCR8 cells co-cultured with NK cells and treated with CHS-114 or isotype control and after 4 hours analyzed by FC. % NK killing represents the frequency of viable dye+CFSE+Raji" hCCR8 cells among total CFSE+Raji-hCCR8 cells.

[0042] FIG. 7A is a scheme portraying a sample analysis workflow. FIG. 7B is a graphical representation of the relative number (%) of FOXP3+cells of total CD4+T cells isolated from freshly resected human tumors and incubated with either CHS-114 or isotype control, as indicated. FIG. 7C is a graphical representation of the relative frequency of Tregs, CD4+T cells, and CD8+T cells following incubation of DTCs with activated NK cells and CHS-114. FIGs. 7D-7G are graphical representations of the relative frequency or gMFI of CD107a+(FIG. 7D), 4-lBB+(FIG. 7E), CD25+(FIG. 7F), and CD16+NK cells (FIG. 7G) following treatment of PBMCs with CHS- 114 or isotype control. FIG. 7H-7L are graphical representations of the relative frequency or gMFI of CD83+(FIG. 7H), CD86+(FIG. 71), HLA-DR+(FIG. 7J), CD40+(FIG. 7K), and B7-H3+(FIG. 7L) monocytes following treatment of PBMCs with CHS-114 or isotype control. FIGs. 7M-7N aregraphical representations of the relative frequency or gMFI of 4-lBB+NK cells (FIG. 7M) and B7-H3+monocytes (FIG. 7N) following treatment of DTCs with CHS- 114 or isotypc control.

[0043] FIGs. 8A-8B are line graphs showing the ADCC activity relative to antibody concentration in CD16VV (FIG. 8A) or CD16FF (FIG. 8B) Jurkat ADCC reporter cells following incubation with increasing concentrations of CHS- 114, fucosylated CHS- 114, and an afucosylated isotype control, as indicated.

[0044] FIGs. 9A-9B are graphical representations illustrating binding of the anti-CCR8-l antibody to tumor Tregs. Tregs were identified using flow cytometry in TIL isolated from tumors as CD3+ / FoxP3+. Binding of anti-CCR8-l antibody was measured on the gated cells from kidney and breast tumors using an APC-conjugated secondary antibody. FIG. 9A is a scatter plot showing the antibody to positive control binding ratio on Treg contacted with the anti-CCR8-l antibody, a positive control, and secondary only (negative control). FIG. 9B is a scatter plot showing the percent of CD3+isolated TIL cells from tumors incubated with allogenic natural killer (NK) cells and contacted with control antibody, anti-CCR8-l antibody, or a positive control antibody. For each antibody condition, the grouping on the left side is the percentage of CD3+ cells that are FoxP3- cells (e.g.. non-Tregs), while the grouping on the right side is the normalized percentage of CD3+ cells that are FoxP3+ cells e.g., Tregs).

[0045] FIGs. 10A-10E show results of experiments treating humanized mice with CHS- 114 or isotype control 10 days after injection with human PBMCs. FIGs. 10A-10B are graphical representations of the relative frequency of CCR8+Tregs or total Tregs (FIG. 10A) and the ratio of CD8+T effector cells to Tregs (FIG. 10B) in the peripheral blood of humanized mice following treatment, as determined by flow cytometry. FIGs. 10C-10E are graphical representations of the number of Tregs or CCR8+cells (FIG. 10C), CD8+T cells (FIG. 10D), and PD-L1+cells (FIG. 10E) in the spleen of mice following treatment, as determined by IHC.

[0046] FIGs. 10F-10K show results of experiments treating human CCR8 knock-in mice with CHS- 114 or isotype control after injection of MC38 cells. FIG. 10F is a representative flow cytometry readout of huCCR8 expression on FOXP3+Tregs on day 10 after tumor injection. FIG. 10G is a graph showing the relative frequency of FOXP3+Tregs following treatment. FIG. 10H is a line graph demonstrating reduced tumor growth in mice treated with CHS- 114 compared to isotype control. FIG. 101 is a bar graph demonstrating the relative change in frequency of immune cell populations following treatment with CHS- 114. FIG. 10J presents graphical representationsof 6 CD8+T cell clusters identified in the MC38 tumors, their time trajectory upon treatment, and the fractional composition of the clusters in each treatment condition. FIG. 10K is a hcatmap showing expression of activation-induced inhibitory receptors, effector function, and transcription factor genes for the six CD8+T cell clusters condition defined in FIG. 10J. The size of the dot corresponds to the percentage of cells expressing the gene in each cluster, and the color represents the expression levels as Z score. Statistical analysis for FIG. 10G and FIG. 10H was performed using unpaired t test. **p<0.01, ****p<0.0001.

[0047] FIGs. 11A-11H show data in mice bearing B16F10 tumors and dosed with control antibody, an anti-murine CCR8.mIgG2a, anti-murine PD-1, or a combination of anti-murine CCR8.mIgG2a and anti-murine PD-1, six days post-implantation. FIG. 11A is a line graph showing tumor volume over time. FIG. 1 IB shows survival of mice bearing subcutaneous B 16F10 tumors. FIGs. 11C-1 ID show cytometric analyses of the frequency of Tregs (FIG. 11C) and CD45+cells (FIG. 1 ID) on Day 9 of treatment. FIG. HE shows average frequency of tumor infiltrating lymphocytes (TILs) on Day 8 of study. FIG. 1 IF shows representative IHC images of infiltrating CD8+T cells in B16F10 tumors on Day 8 of study and the density of infiltrating CD8+T cells. FIG. 11G shows the fold-change n cytokine levels evaluated in bulk tumor lysates. FIG. 11H is a heatmap showing production of pro-inflammatory cytokines and chemokines. Statistical analysis was performed using one-way ANOVA. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001.

[0048] FIGs. 12A-12B present flow cytometric analyses of proliferating T cells from dissociated B16F10 tumors collected on Day 9 after treatment initiation. Mice were dosed with 1 mg 5-Ethynyl-2’ -deoxyuridine (EdU) 24 hours prior to sample collection and frequency of EdU+CD8+ effector T cells (FIG. 12A) and EdU+CD4+ Tconv cells (FIG. 12B) were measured, respectively (n=4). FIGs. 12C-12D present flow cytometric analyses of intracellular cytokine levels of TILs after ex vivo stimulation of dissociated tumors (n=5) harvested following treatment. Resected tumor samples on Day 8 after treatment initiation were stimulated ex vivo with PMA and ionomycin to evaluate intracellular cytokine levels of CD8+ T cells (FIG. 12C) and CD4+ Tconv (FIG. 12D) cells, respectively. Statistical analysis was performed using one-way ANOVA (FIG. 12A, B) or unpaired t test (FIG. 12C, D). *P <0.05, **p<0.01, ***p<0.001.

[0049] FIGs.l3A-13C are line graphs showing the percent increase in 4-lBB+NK cells (FIG. 13A), B7-H3+monocytes (FIG. 13B), and CD83+monocytes (FIG. 13C) upon treatment of PBMCs from multiple donors with increasing concentrations of CHS- 114.

[0050] FIG. 14 schematically shows a phase 1 dose-escalation and expansion study for an anti-CCR8 antibody at different dose levels (DLs). HNSCC = head and neck squamous cell carcinoma; DLTs = dose-limiting toxicities; TEAEs = treatment emergent adverse events; DL-A = dose level A; DL-B = dose level B; 2L = second line.

[0051] FIG. 15 is a graphical representation of the pharmacokinetics of anti-CCR8-l antibody administered at escalating doses with DL1 being the lowest dose and DL7 being the highest dose.

[0052] FIGs. 16A-16C are graphical representations of treatment emergent adverse events (TEAEs) occurring in >10% of patients related to treatment with CHS- 114 antibody or the combination of CHS- 114 and toripalimab versus treatment emergent adverse events (TEAE) unrelated to treatment. TEAE is defined as an AE that emerges or worsens in the period from the first dose of CHS-114 or combination to 30 days after the last dose. FIG. 16A presents preliminary results in which no grade 3 or higher TEAEs were observed with CHS- 114 treatment. FIG. 16B presents TEAEs in patients with head and neck squamous cell carcinoma (HNSCC) administered CHS- 114 monotherapy. FIG. 16C presents TEAEs in patients with HNSCC administered CHS- 114 in combination with toripalimab.

[0053] FIG. 17A-17B are graphical representations of the time on treatment for patients with different cancer types administered CHS- 114 monotherapy (FIG. 17A) and patients with HNSCC administered CHS- 114 monotherapy (FIG. 17B).

[0054] FIG. 18A is a graph portraying the percent change from baseline in sum of target lesion for patients with different cancer types administered CHS- 114 monotherapy. FIG. 18B is a line graph showing target lesion change over time for patients with different cancer types administered CHS-114 monotherapy. FIG. 18C is a graph portraying the percent change from baseline in sum of target lesion for patients with HNSCC administered CHS-114 monotherapy. FIG. 18D is a line graph showing target lesion change over time for patients with HNSCC administered CHS-114 monotherapy.

[0055] FIG. 19A shows images demonstrating a reduction in tumor size for a patient with oropharyngeal squamous cell carcinoma administered CHS-114 and toripalimab as a 4thline treatment. FIG. 19B is a graphical representation of the time on treatment for patients administered CHS-114 in combination with toripalimab.

[0056] FIG. 20A is a graph portraying the percent change from baseline in sum of target lesion for patients administered CHS- 114 in combination with toripalimab. FIG. 20B is a line graph showing target lesion change over time for patients administered CHS- 114 in combination with toripalimab. Solid black lines represent individuals administered 700 mg CHS- 114 + toripalimab. Dashed lines with white dots represent individuals administered 300 mg CHS- 114 + toripalimab.

[0057] FIG. 21 A shows the relative frequency of CCR8+and CCR8" Tregs expressing Ki67, HLA-DR, CTLA-4, and TIGIT in PBMC samples from patients prior to administration of anti-CCR8 antibody. FIGs. 21B-21E are graphs showing cells measured from whole blood using flow cytometry (FC) before CHS- 114 treatment (predose) and at indicated timepoints throughout CHS- 114 Cycle 1. CCR8+Treg depletion (> 85%) was stable through Cycle 1 for all dose levels tested (FIG. 21B). CHS-114 treatment led to a decrease in subset of HLADR+Tregs (FIG. 21E), while preserving broader Treg (FIG. 21C) and non-Treg CD4+T cell populations (FIG. 21D). Tregs were defined as CD127lowCD25hlghcells within the CD3+CD4+T cell population.

[0058] FIG. 22 presents graphical representations of the percent change from baseline in the frequency of Ki67+CD8+T cells, Granzyme B+CD8+T cells, and CD8+TPEX cells in PBMC samples collected from patients administered CHS-114 monotherapy at cycle 1 day 1 (C1D1: before drug administration), cycle 1 day 8 (C1D8), and cycle 2 day 1 (C2D1). Dose group > 300 mg (dashed orange lines depict individual participants; solid orange line depicts median; n=7). Dose group < 100 mg (dashed blue lines depict individual participants; solid blue line depicts median; n=6). Dashed black line depicts median for all participants; n=13. MFI = mean fluorescence intensity. Tpex = progenitor exhausted T cells.

[0059] FIGs. 23A-23E show results of immunofluorescence assays measuring expression of biomarkers in tumor biopsy samples from patients before and after administration of CHS-114 with toripalimab (gray dots / lines) and without toripalimab (black dots / lines). FIG. 23A shows graphs demonstrating the absolute value of density and percent change of density in CCR8+Tregs before and after treatment. FIG. 23B is a graph depicting % change CCR8+Tregs for patients administered 300 mg or 700 mg CHS-114. FIG. 23C is a graph depicting absolute value of density and % change in density of CD8+T cells before and after treatment. FIG. 23D is a graph depicting fold change in the ratio of CD8+T cells to CCR8+Tregs before and after treatment. FIG. 23E is agraph depicting fold change in the ratio of CD8+T cells to CCR8+Tregs for patients administered 300 mg or 700 mg CHS- 114.

[0060] FIG. 24 shows graphical representations of the expression of proinflammatory cytokines at cycle 1 day 1 (C1D1), cycle 1 day 2 (C1D2), cycle 1 day 8 (C1D8), and cycle 2 day 1 (C2D1) of treatment with CHS- 114. Serum cytokines were measured by MSD assay. An increase in proinflammatory cytokines compared to pretreatment indicates induction of an enhanced immune response and is a sign of immune activation against the tumor. The dashed horizontal line represents a +25 % change from baseline.

[0061] FIG. 25 presents graphs depicting the % change of pro-inflammatory cytokines IFNy, TNF, MIPla, and MIPip in the serum of patients administered CHS- 114. A sustained increase in the pro-inflammatory cytokines is observed across all dosing levels. Significant upregulation of IFNy was observed at C2D1 in the > 300 mg group but not the < 100 mg group. Data representative of 18 participants.

[0062] FIG. 26 is a graphical representation of the fold change of IFN-y relative to isotype control for treatment with anti-CCR8 antibody (CHS- 114) and / or PD-1 blockade. PBMCs from healthy donors were cultured with SEB in the presence of isotype control, toripalimab, CHS- 114, or a combination. IFN-y levels in cell supernatants were determined by ELISA. Combination treatment with toripalimab and CHS- 114 enhances IFN-y secretion of SEB-activated PBMCs.

[0063] FIGs. 27A-27D are graphical representations of simulated pharmacokinetic parameters for different toripalimab dosing regimens. FIG. 27A depicts average concentration (Cave), FIG. 27B depicts area under the curve (AUC), FIG. 27C depicts trough concentration levels (Ctrough), and FIG. 27D depicts maximum concentration (Cmax). Q3W = once every 3 weeks. Q4W = once every 4 weeks. Q6W = once every 6 weeks.DETAILED DESCRIPTION OF THE DISCLOSURE

[0064] While aspects of the subject matter of the present disclosure may be embodied in a variety of forms, the following description is merely intended to disclose some of these forms as specific examples of the subject matter encompassed by the present disclosure. Accordingly, the subject matter of this disclosure is not intended to be limited to the forms or aspects so described.

[0001] As used herein, a plurality of compounds, elements, uses or method steps may be presented in a common list for convenience. However, these lists should be construed as though each member of the list is individually identified as a separate and unique member. Thus, noindividual member of such list should be construed as a de facto equivalent of any other member of the same list solely based on their presentation in a common group without indications to the contrary. Furthermore, certain molecules, constructs, compositions, elements, moieties, excipients, disorders, conditions, properties, uses, method steps, or the like may be discussed in the context of one specific aspect or aspect or in a separate paragraph or section of this disclosure. It is understood that this is merely for convenience and brevity, and any such disclosure is equally applicable to and intended to be combined with any other aspects or aspects found anywhere in the present disclosure and claims, which all form the application and claimed invention at the filing date. For example, a list of constructs, molecules, method steps, kits, or compositions described with respect to an antibody, molecule, polypeptide, composition, or method is intended to and does find direct support for aspects related to antibodies, molecules, polypeptides, compositions, formulations, and methods described in any other part of this disclosure, even if those method steps, active agents, kits, or compositions are not re-listed in the context or section of that aspect or aspects.

[0065] Certain aspects of the present disclosure are directed to methods of treating a subject having a tumor or a cancer by administering about 100 mg to about 3,000 mg of an anti- CCR8 antibody or an antigen-binding portion thereof that specifically binds to one or more amino acids within the N-terminal extracellular domain of human CCR8, wherein the antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0066] In one aspect, the present disclosure includes a method of treating a subject having a tumor or a cancer comprising: collecting a baseline blood sample (whole blood, serum or plasma) from the subject prior to administering a dose of an anti-CCR8 antibody or antigen-binding portion thereof to the subject; measuring a baseline concentration of each of one or more cytokines in the baseline blood sample; administering at least one dose of the anti-CCR8 antibody or antigenbinding portion thereof to the subject for a treatment cycle; collecting a post-dose blood sample from the subject during or after the treatment cycle; measuring a post-dose concentration of eachof the one or more cytokines in the post-dose blood sample; and treating the subject with a first treatment regimen comprising administering the anti-CCR8 antibody or antigen-binding portion thereof if the post-dose concentration is greater than the baseline concentration, or treating the subject with a second treatment regimen comprising administering toripalimab and the anti-CCR8 antibody or antigen-binding portion thereof if the post-dose concentration is equal to or less than the baseline concentration.

[0067] In one aspect, the present disclosure includes a method of treating a subject having a tumor or a cancer comprising; collecting a baseline sample (e.g. tumor tissue, blood, or other suitable biological sample for detection of cell surface markers) from the subject prior to administering a dose of an anti-CCR8 antibody or antigen-binding portion thereof to the subject; measuring a baseline frequency of each of one or more cell surface markers in the baseline sample; administering at least one dose of the anti-CCR8 antibody or antigen-binding portion thereof to the subject for a treatment cycle; collecting a post-dose sample from the subject during or after the treatment cycle; measuring a post-dose frequency of each of the one or more cell surface markers in the post-dose sample; and treating the subject with a first treatment regimen comprising administering the anti-CCR8 antibody or antigen-binding portion thereof if the post-dose frequency is greater than the baseline frequency, or treating the subject with a second treatment regimen comprising administering toripalimab and the anti-CCR8 antibody or antigen-binding portion thereof if the post-dose frequency is equal to or less than the baseline frequency.

[0068] In one aspect, the present disclosure includes a method of treating a subject having a head and neck cancer, the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50, optionally wherein the subject has a squamous cell carcinoma of pharynx (oropharynx, hypopharynx, or nasopharynx), larynx, oral cavity, salivary gland, or paranasal sinus. In some aspects, the cancer expresses HPV pl6 or p 18. In some aspects, the cancer is HPV negative. In some aspects, the subject has an oropharyngeal cancer that expresses HPV p!6 and / or p!8.

[0069] In one aspect, the present disclosure includes a method of treating a subject having a gastric cancer or gastroesophageal junction (GEJ) cancer, the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50. In some aspects, the cancer has high microsatellite instability (MSLH) and / or deficient mismatch repair (dMMR). In some aspects, the subject has an endometrial cancer with MSLH and / or dMMR. In some aspects, the subject has a colorectal cancer with MSI-H and / or dMMR. In some aspects, the subject has a prostate cancer with MSLH and / or dMMR. In some aspects, the subject has a breast cancer with MSI-H and / or dMMR. In some aspects, the subject has a pancreatic cancer with MSI-H and / or dMMR. In some aspects, the subject has a gastric cancer with MSI-H and / or dMMR. In some aspects, the cancer has microsatellite stability (MSS) and / or proficient mismatch repair (pMMR). In some aspects, the subject has a gastric cancer that has MSS and / or pMMR. In some aspects, the subject has a colorectal cancer (CRC) that has MSS and / or pMMR. In some aspects, the subject has a pancreatic cancer that has MSS and / or pMMR. In some aspects, the subject has a pancreatic ductal adenocarcinoma (PDAC) that has MSS and / or pMMR.

[0070] In one aspect, the present disclosure includes a method of treating a subject having a tumor without inducing one or more treatment emergent adverse effects (TEAEs), the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0071] In certain aspects, the present disclosure provides methods of increasing anti-tumor efficacy, therapeutic window, half-life, or exposure of an anti-PDl antibody without increasing adverse events in a subject. In some aspects, the present disclosure provides a method of increasinganti-tumor efficacy, therapeutic window, half-life, or exposure of toripalimab by administering toripalimab to a subject in combination with administering an anti-CCR8 antibody or antigenbinding portion thereof of the present disclosure. In some aspects, the present disclosure provides such advantageous effects without significantly increasing adverse events in the subject.

[0072] In one aspect, the present disclosure provides a method of increasing the efficacy of an immunotherapy agent in a subject with a tumor administered the immunotherapy agent, comprising administering an anti-CCR8 antibody, or antigen-binding portion thereof, to the subject at a dose of about 100 mg to about 3000 mg, for example about 200 mg to about 2000 mg, or about 200 mg to about 1000 mg. In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50. In some aspects, the step of administering the anti-CCR8 antibody or antigen-binding portion thereof causes an increase in a ratio of CD8+T cells to Tregs in the tumor microenvironment compared to a baseline ratio.

[0073] In some aspects, the immunotherapy agent is an immune checkpoint inhibitor. In some aspects, the immune checkpoint inhibitor is selected from the group consisting of: atezolizumab, avelumab, cemiplimab, cosibelimab, dostarlimab, durvalamab, nivolumab, pembrolizumab, tislelizumab, toripalimab, rilatimab, ipilimumab, tremelimumab, and a combination thereof. In some aspects, the immunotherapy agent is a T cell engager. In some aspects, the T-cell engager is selected from the group consisting of blinatumomab, tarlatamab, tebentafusp, mosunetuzumab, glofitamab, epcoritamab, talquetamab, teclistamab, and elranatamab. In some aspects, the immunotherapy agent is a chimeric antigen receptor (CAR)-T cell therapy. In some aspects, the CAR-T cell therapy is selected from the group consisting of tisagenlecleucel, axicabtagene ciloleucel, brexueabtagene autoleucel, lisocabtagene maraleucel, idecabtagene vicleucel, ciltacabtagene autoleucel, and obecabtagene autoleucel.

[0074] In some aspects, the step of administering the anti-CCR8 antibody or antigenbinding portion thereof causes an increase in CD8+T cells in the tumor microenvironment. In some aspects, the step of administering the anti-CCR8 antibody or antigen-binding portion thereofcauses a decrease in Tregs in the tumor microenvironment. In some aspects, the method comprises administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose such that the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 5-fold, about 10- fold, about 15-fold, about 20-fold, about 25-fold, about 30-fold, about 35-fold, about 40-fold, about 45-fold, or about 50-fold compared to the baseline ratio. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 5-fold. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 10-fold. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 15-fold. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 20-fold. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 25-fold. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 30-fold. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 35-fold. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 40-fold. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 45-fold. In some aspects, the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 50-fold.

[0075] In one aspect, the present disclosure provides a method of treating a subject having a PD-L1 positive tumor or cancer comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50. In some aspects, the tumor or cancer has a combined positive score (CPS) of > 1. In some aspects, the subject has previously been treated with a PD-1 inhibitor.

[0076] In one aspect, the present disclosure includes a method of increasing a concentration of one or more cytokines in a subject comprising administering to the subject a first treatment regimen comprising an anti-CCR8 antibody or an antigen-binding portion thereof, or a second treatment regimen comprising administering toripalimab and the anti-CCR8 antibody or antigen-binding portion thereof, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45,a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0077] In one aspect, the present disclosure includes a method of increasing a frequency of one or more cell surface markers in a tumor or a cell population of a subject comprising administering to the subject a first treatment regimen comprising an anti-CCR8 antibody or an antigen-binding portion thereof, or a second treatment regimen comprising administering toripalimab and the anti-CCR8 antibody or antigen-binding portion thereof, wherein the anti- CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0078] In one aspect, the present disclosure provides a method of maintaining a serum concentration of an anti-CCR8 antibody, or antigen-binding portion thereof, at or above a target trough concentration in a subject, comprising administering the anti-CCR8 antibody, or antigenbinding portion thereof, to the subject at a dose of about 100 mg to about 3000 mg, for example about 200 mg to about 2000 mg, or about 200 mg to about 1000 mg. In some aspects, the target trough concentration is about 10 pg / mL to about 50 pg / mL. In some aspects, the target trough concentration is about 10 pg / mL to about 35 pg / mL.

[0079] In one aspect, the present disclosure includes a method of treating a subject having a tumor or a cancer comprising intravenously administering to the subject at least 100 mg of an anti-CCR8 antibody or an antigen-binding portion thereof comprising a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 41 and comprising a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 43 every 3 weeks (Q3W).

[0080] Treatment-emergent adverse events (TEAEs) related to antibodies used in cancer therapy can vary in severity, from mild to life-threatening, depending on the antibody's target and mechanism of action. Common TEAEs of known antibodies indicated for treating cancer patientsinclude hypernatremia, fatigue, pain, infusion-related reaction, increased lipase, diarrhea, dry eye, food intolerance, headache, nausea, rash, dyspnea, dysgeusia, hypoxia, increased amylase, acute respiratory failure, wound infection, musculoskeletal chest pain, aspiration pneumonia, pyrexia, acneiform dermatitis, hypokalaemia, abdominal pain, cough, embolism, tumor pain, anemia, increased alanine aminotransferase, increased aspartate aminotransferase, constipation, urinary retention, hypomagnesaemia, or hyponatremia. In some instances, TEAEs can include autoimmune-like symptoms, decreased neutrophil count, colitis, hepatitis, pneumonitis, and endocrine dysfunction. Hematological toxicities like increased blood alkaline phosphatase, increased blood bilirubin, increased blood thyroid stimulating hormone, decreased platelet count, decreased white blood cell count, anemia, thrombocytopenia, and neutropenia can also arise, especially with antibody-drug conjugates (ADCs), where cytotoxic agents are linked to antibodies. For certain cancer types, such as head and neck cancer, TEAEs can also include oral pain, mouth hemorrhage, or oropharyngeal fistula. The monotherapy and combination therapy described herein are unexpectedly useful in methods of avoiding TEAEs associated with known antibodies indicated for treating cancer patients.[00811 FOXP3+ regulatory T (Treg) cells play a crucial role in modulating immune responses across several tissues, including the tumor microenvironment (TME). Though therapeutic depletion of Treg cells has the potential to unleash antitumor immune responses, the broad elimination of the Treg cell population leads to systemic autoimmune disease in both humans and mice. Thus, there is an unmet need to selectively deplete Treg cells within the tumor microenvironment. Herein, CCR8 expression was evaluated within human tumors (55 primary tumor tissues from 12 types of cancer). The inventors demonstrated an abundance of Treg cells expressing higher levels of CCR8 within tumors (-60%) in comparison conventional CD4+ T cells (-9%), CD8+ T cells (-3%) or peripheral Tregs (-19%). Thus, leveraging controlled depletion of Treg cells in tumor tissue while sparing effector lymphocytes and Treg cells in healthy tissue was achieved through targeting of CCR8 with effector enhanced monoclonal antibodies (mAb). CHS- 114 is a highly selective human anti-CCR8 afucosylated antibody, that lacks off target binding and exhibits no cross reactivity to CCR8 expressed in other species. The present disclosure includes using CHS- 114 to selectively deplete CCR8+ Treg cells in tumors without any depletion of conventional CD4+ T cells or CD8+ T cells, while mediating the activation of NK cells, monocytes, and T cells and elevating levels of pro-inflammatory cytokines. The present disclosureincludes in vivo data showing that treatment of tumor bearing human CCR8 knock-in (hCCR8KT) mice with CHS- 114 resulted in significant antitumor activity (62.6% tumor growth inhibition), and analysis of the tumors showed CHS- 114 treatment depleted intratumoral Tregs and increased immune cell infiltration. Furthermore, in vitro studies using human PBMCs treated with the combination of CHS- 114 and toripalimab (anti-PD-1 mAb) elicited a stronger immune activation than single agent treatments. The present disclosure also includes clinical data demonstrating dosing for CHS-114 and clinical efficacy in treating cancer patients with CHS-114 alone or in combination with the anti-PD-1 antibody toripalimab. Altogether, selective depletion of intratumoral CCR8+ Treg cells results in robust antitumor activity by reshaping the TME toward a more pro-inflammatory milieu, providing an orthogonal approach to checkpoint inhibition for eliciting antitumor immunity.

[0082] The disclosures of U.S. Pat. No. 11,859,000 are incorporated herein by reference in their entireties for all purposes.I. Terms

[0083] In order that the present disclosure can be more readily understood, certain terms are first defined. As used in this application, except as otherwise expressly provided herein, each of the following terms shall have the meaning set forth below. Additional definitions are set forth throughout the application.

[0084] It is to be noted that the term “a” or “an” entity refers to one or more of that entity; for example, “a nucleotide sequence,” is understood to represent one or more nucleotide sequences. As such, the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.

[0085] Furthermore, “and / or” where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term “and / or” as used in a phrase such as “A and / or B” herein is intended to include “A and B,” “A or B,” “A” (alone), and “B” (alone). Likewise, the term “and / or” as used in a phrase such as “A, B, and / or C” is intended to encompass each of the following aspects: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).

[0086] The term “about” is used herein to mean approximately, roughly, around, or in the regions of. When the term “about” is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. In general, theterm “about” is used herein to modify a numerical value above and below the stated value by a variance of 10 percent, up or down (higher or lower).

[0087] It is understood that wherever aspects are described herein with the language “comprising,” otherwise analogous aspects described in terms of “consisting of” and / or “consisting essentially of’ are also provided.

[0088] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure is related. For example, the Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei- Show, 2nded., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rded., 1999, Academic Press; and the Oxford Dictionary of Biochemistry And Molecular Biology, Revised, 2000, Oxford University Press, provide one of skill with a general dictionary of many of the terms used in this disclosure.

[0089] Units, prefixes, and symbols are denoted in their Systeme International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, nucleotide sequences are written left to right in 5’ to 3’ orientation. Amino acid sequences are written left to right in amino to carboxy orientation. The headings provided herein are not limitations of the various aspects of the disclosure, which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification in its entirety.

[0090] As used herein, the term “amount” or “level” is used in the broadest sense and refers to a quantity, concentration or abundance of a substance (e.g., a metabolite, a small molecule, a protein, an mRNA, a marker). When referring to a metabolite or small molecule (e.g. a drug) or a peptide or protein, the terms “amount”, “level” and “concentration” are generally used interchangeably and generally refer to a detectable amount in a biological sample. When referring to a cell population, cell surface marker, or protein, the terms “amount”, “level” and “frequency” are generally used interchangeably and generally refer to a detectable amount in a biological sample. “Elevated levels” or “increased levels” refers to an increase in the quantity, concentration or abundance of a substance within a sample relative to a control sample, such as from an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control. In some aspects, the elevated level of a substance (e.g., a drug) in a sample refers to an increase in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%,45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g., HPLC). “Reduced levels” refers to a decrease in the quantity, concentration or abundance of a substance (e.g., a drug) in an individual relative to a control, such as from an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control. In some aspects, a reduced level is little or no detectable quantity, concentration or abundance. In some aspects, the reduced level of a substance (e.g., a drug) in a sample refers to a decrease in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g., HPLC).

[0091] When referring to a protein, mRNA or a marker, such as those described herein, the terms “level of expression” or “expression level” in general are used interchangeably and generally refer to a detectable amount of a protein, mRNA, or marker in a biological sample. In some aspects, a detectable amount or detectable level of a protein, mRNA or a marker is associated with a likelihood of a response to an agent, such as those described herein. “Expression” generally refers to the process by which information contained within a gene is converted into the structures (e.g., a protein marker, such as PD-L1) present and operating in the cell. Therefore, as used herein, “expression” may refer to transcription into a polynucleotide, translation into a polypeptide, or even polynucleotide and / or polypeptide modifications (e.g., posttranslational modification of a polypeptide). Fragments of the transcribed polynucleotide, the translated polypeptide, or polynucleotide and / or polypeptide modifications (e.g., posttranslational modification of a polypeptide) shall also be regarded as expressed whether they originate from a transcript generated by alternative splicing or a degraded transcript, or from a post-translational processing of the polypeptide, e.g., by proteolysis. “Expressed genes” include those that are transcribed into a polynucleotide as mRNA and then translated into a polypeptide, and also those that are transcribed into RNA but not translated into a polypeptide (for example, transfer and ribosomal RNAs). “Elevated expression,” “elevated expression levels,” or “elevated levels” refers to an increased expression or increased levels of a substance within a sample relative to a control sample, such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control. In some aspects, the elevated expression of a substance (e.g., a protein marker,such as PD-L1 ) in a sample refers to an increase in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g., FACS). “Reduced expression,” “reduced expression levels,” or “reduced levels” refers to a decrease expression or decreased levels of a substance (e.g., a protein marker) in an individual relative to a control, such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control. In some aspects, reduced expression is little or no expression. In some aspects, the reduced expression of a substance (e.g., a protein marker) in a sample refers to a decrease in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g., FACS).

[0092] As used herein, the term “antagonist” refers to any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a native polypeptide disclosed herein. Suitable antagonist molecules specifically include antagonist antibodies or antibody fragments, fragments or amino acid sequence variants of native polypeptides, peptides or proteins. In some aspects, inhibition in the presence of the antagonist is observed in a dose-dependent manner. In some aspects, the measured signal (e.g., biological activity) is at least about 5%, at least about10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about85%, at least about 90%, at least about 95%, or at least about 100% lower than the signal measured with a negative control under comparable conditions. Also disclosed herein, are methods of identifying antagonists suitable for use in the methods of the disclosure. For example, these methods include, but are not limited to, binding assays such as enzyme-linked immune-absorbent assay (ELISA), ForteBio®systems, radioimmunoassay (RIA), Meso Scale Discovery assay (e.g., Meso Scale Discovery Electrochemiluminescence (MSD-ECL), and bead-based Luminex® assay). These assays determine the ability of an antagonist to bind the polypeptide of interest (e.g., a receptor or ligand) and therefore indicate the ability of the antagonist to inhibit, neutralize or block the activity of the polypeptide. Efficacy of an antagonist can also be determined using functional assays, such as the ability of an antagonist to inhibit the function of the polypeptide or an agonist.For example, a functional assay may comprise contacting a polypeptide with a candidate antagonist molecule and measuring a detectable change in one or more biological activities normally associated with the polypeptide. The potency of an antagonist is usually defined by its IC50 value (concentration required to inhibit 50% of the agonist response). The lower the IC50 value the greater the potency of the antagonist and the lower the concentration that is required to inhibit the maximum biological response.

[0093] As used herein, the term “anti-CCR8 antibody” refers to an antibody that specifically binds to CCR8. In some aspects, the anti-CCR8 antibody inhibits a CCR8 biological activity and / or a downstream pathway(s) mediated by CCR8 signaling or other CCR8-mediated function. An anti-CCR8 antibody includes, but is not limited to, antibodies that block, antagonize, suppress, inhibit or reduce a CCR8 biological activity (e.g., ligand binding, activation of G-protein signaling), including downstream pathways mediated by CCR8 signaling or function, such as receptor binding and / or elicitation of a cellular response to CCR8 or its metabolites (e.g. , immune suppression). In some aspects, an anti-CCR8 antibody provided by the disclosure binds to human CCR8 and prevents, blocks, or inhibits binding of human CCR8 to a ligand (e.g., CCL1) or interaction between CCR8 and G-protein. In some aspects, the anti-CCR8 antibody prevents, blocks, or inhibits the binding of human CCR8 to CCL1. In some aspects, the anti-CCR8 antibody prevents, blocks, or inhibits the binding of human CCR8 to the CCL8. In some aspects, the anti- CCR8 antibody prevents, blocks, or inhibits the binding of human CCR8 to the CCL16. In some aspects, the anti-CCR8 antibody prevents, blocks, or inhibits the binding of human CCR8 to the CCL18.

[0094] As used herein, the term “antibody” refers to a whole antibody comprising two light chain polypeptides and two heavy chain polypeptides. Whole antibodies include different antibody isotypes including IgM, IgG, IgA, IgD, and IgE antibodies. The term “antibody” includes a polyclonal antibody, a monoclonal antibody, a chimerized or chimeric antibody, a humanized antibody, a primatized antibody, a deimmunized antibody, and a fully human antibody. The antibody can be made in or derived from any of a variety of species, e.g., mammals such as humans, non-human primates (e.g., orangutan, baboons, or chimpanzees), horses, cattle, pigs, sheep, goats, dogs, cats, rabbits, guinea pigs, gerbils, hamsters, rats, and mice. The antibody can be a purified or a recombinant antibody. As used herein, the term “antibody fragment,” “antigenbinding fragment,” or similar terms refer to a fragment of an antibody that retains the ability tobind to a target antigen (e.g., CCR8) and inhibit the activity of the target antigen. Such fragments include, e.g., a single chain antibody, a single chain Fv fragment (scFv), an Fd fragment, an Fab fragment, an Fab’ fragment, or an F(ab’)2 fragment. An scFv fragment is a single polypeptide chain that includes both the heavy and light chain variable regions of the antibody from which the scFv is derived. In addition, intrabodies, minibodies, triabodies, and diabodies are also included in the definition of antibody and are compatible for use in the methods described herein. See, e.g., Todorovska et al., (2001) J. Immunol. Methods 248(l):47-66; Hudson and Kortt, (1999) J. Immunol. Methods 231(1): 177-189; Poljak, (1994) Structure 2(12):1121-1123; Rondon and Marasco, (1997) Annu. Rev. Microbiol. 51:257-283, the disclosures of each of which are incorporated herein by reference in their entirety.

[0095] As used herein, the term “antibody fragment” also includes, e.g., single domain antibodies such as camelid single domain antibodies. See, e.g., Muyldermans et al., (2001) Trends Biochem. Sci. 26:230-235; Nuttall et al., (2000) Curr. Pharm. Biotech. 1:253-263; Reichmann et al., (1999) J. Immunol. Meth. 231:25-38; PCT application publication nos. WO 94 / 04678 and WO 94 / 25591; and U.S. patent no. 6,005,079, all of which are incorporated herein by reference in their entireties. In some aspects, the disclosure provides single domain antibodies comprising two VH domains with modifications such that single domain antibodies are formed.

[0096] In some aspects, an antigen-binding fragment includes the variable region of a heavy chain polypeptide and the variable region of a light chain polypeptide. In some aspects, an antigen-binding fragment described herein comprises the CDRs of the light chain and heavy chain polypeptide of an antibody.

[0097] As used herein, the term “bispecific” or “bifunctional antibody” refers to an artificial hybrid antibody having two different heavy / light chain pairs and two different binding sites. Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab’ fragments. See, e.g., Songsivilai & Lachmann, (1990) Clin. Exp. Immunol. 79:315-321; Kostelny et al., (1992) J. Immunol. 148:1547-1553.

[0098] Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain / light-chain pairs, where the two heavy chain / light chain pairs have different specificities (Milstein and Cuello, (1983) Nature 305:537- 539). Antibody variable domains with the desired binding specificities (antibody -antigen combining sites) can be fused to immunoglobulin constant domain sequences. The fusion of theheavy chain variable region is preferably with an immunoglobulin heavy-chain constant domain, including at least part of the hinge, CH2, and CH3 regions. For further details of illustrative currently known methods for generating bispecific antibodies see, e.g., Suresh et al., (1986) Methods Enzymol. 121:210; PCT Publication No. WO 96 / 27011; Brennan et al., (1985) Science 229:81; Shalaby et al., J. Exp. Med. (1992) 175:217-225; Kostelny et al., (1992) J. Immunol. 148(5): 1547-1553; Hollinger et al., (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Gruber et al., (1994) J. Immunol. 152:5368; and Tutt et al., (1991) J. Immunol. 147:60. Bispecific antibodies also include cross-linked or heteroconjugate antibodies. Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Pat. No. 4,676,980, along with a number of cross-linking techniques.

[0099] Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. See, e.g., Kostelny et al. (1992) J Immunol 148(5): 1547- 1553. The leucine zipper peptides from the Fos and Jun proteins may be linked to the Fab' portions of two different antibodies by gene fusion. The antibody homodimers may be reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers. The “diabody” technology described by Hollinger et al. (1993) Proc Natl Acad Sci USA 90:6444-6448 has provided an alternative mechanism for making bispecific antibody fragments. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites. Another strategy for making bispecific antibody fragments by the use of single-chain Fv (scFv) dimers has also been reported. See, e.g., Gruber et al. (1994) J Immunol 152:5368. Alternatively, the antibodies can be “linear antibodies” as described in, e.g., Zapata et al. (1995) Protein Eng. 8(10): 1057-1062. Briefly, these antibodies comprise a pair of tandem Fd segments (VH-CH1-VH-CH1) which form a pair of antigen binding regions. Linear antibodies can be bispecific or monospecific.

[0100] Antibodies with more than two valencies (e.g., trispecific antibodies) are contemplated and described in, e.g., Tutt et al. (1991) J Immunol 147:60.

[0101] As used herein, the term “biparatopic” refers to an antibody that is capable of binding two epitopes on a single antigen, e.g., polypeptide, target. In some aspects, the biparatopic antibody comprises a first antigen-binding region and a second antigen-binding region, wherein the first antigen-binding region binds a first epitope and the second antigen-binding region binds a second epitope on the same antigen.

[0102] The disclosure also embraces variant forms of multi-specific antibodies such as the dual variable domain immunoglobulin (DVD-Ig) molecules described in Wu et al. (2007) Nat Biotechnol 25(11): 1290-1297. The DVD-Ig molecules are designed such that two different light chain variable domains (VL) from two different parent antibodies are linked in tandem directly or via a short linker by recombinant DNA techniques, followed by the light chain constant domain. Similarly, the heavy chain comprises two different heavy chain variable domains (VH) linked in tandem, followed by the constant domain CHI and Fc region. Methods for making DVD-Ig molecules from two parent antibodies are further described in, e.g., PCT Publication Nos. WO 08 / 024188 and WO 07 / 024715. In some aspects, the bispecific antibody is a Fabs-in-Tandem immunoglobulin, in which the light chain variable region with a second specificity is fused to the heavy chain variable region of a whole antibody. Such antibodies are described in, e.g., International Patent Application Publication No. WO 2015 / 103072.

[0103] As used herein, “cancer antigen” or “tumor antigen” refers to (i) tumor- specific antigens, (ii) tumor- associated antigens, (iii) cells that express tumor- specific antigens, (iv) cells that express tumor- associated antigens, (v) embryonic antigens on tumors, (vi) autologous tumor cells, (vii) tumor- specific membrane antigens, (viii) tumor- associated membrane antigens, (ix) growth factor receptors, (x) growth factor ligands, and (xi) any other type of antigen or antigen- presenting cell or material that is associated with a cancer.

[0104] As used herein, the term “cancer- specific immune response” refers to the immune response induced by the presence of tumors, cancer cells, or cancer antigens. In certain aspects, the response includes the proliferation of cancer antigen specific lymphocytes. In certain aspects, the response includes expression and upregulation of antibodies and T-cell receptors and the formation and release of lymphokines, chemokines, and cytokines. Both innate and acquired immune systems interact to initiate antigenic responses against the tumors, cancer cells, or cancer antigens. In certain aspects, the cancer- specific immune response is a T cell response.

[0105] The term “carcinoma” is art recognized and refers to malignancies of epithelial or endocrine tissues including respiratory system carcinomas, gastrointestinal system carcinomas, genitourinary system carcinomas, testicular carcinomas, breast carcinomas, prostatic carcinomas, endocrine system carcinomas, and melanomas. The anti-CCR8 antibodies described herein can be used to treat patients who have, who are suspected of having, or who may be at high risk for developing any type of cancer, including renal carcinoma or melanoma, or any viral disease. Exemplary carcinomas include those forming from tissue of the cervix, lung, prostate, breast, head and neck, colon and ovary. The term also includes carcinosarcomas, which include malignant tumors composed of carcinomatous and sarcomatous tissues. An “adenocarcinoma” refers to a carcinoma derived from glandular tissue or in which the tumor cells form recognizable glandular structures.

[0106] As used herein, the term “CCR8” or “C-C chemokine receptor type 8” refers to a G-protein coupled receptor. CCR8 is known to have at least four ligands: CCL1, CCL8, CCL16, and CCL18. CCL1 is thought to potentiate human Treg cells by inducing CCR8, FOXp3, CD39, Granzyme B, and IL- 10 Expression, in a STAT3-dependent manner. See, e.g.. Barsheshet et al., PNAS 114(23 ):6086-91 (June 6, 2017). CCR8 is expressed primarily on Treg cells and to a lesser extent on small fractions of TH2 cells, monocytic cells, NK cells, and CD8+cells. CCR8 is a transmembrane receptor having seven transmembrane domains, an extracellular N-terminal domain (SEQ ID NO: 172), and an intracellular C-terminal domain, which interacts with G- protein. The amino acid sequence for human CCR8 (UniProt P51685; SEQ ID NO: 171) is shown in Table 1, below.Table 1: Human CCR8 Sequence. The N-Terminal Extracellular domain (SEQ ID NO: 172) is underlined.

[0107] As used herein the term “compete,” when used in the context of antigen-binding proteins (c.g., immunoglobulins, antibodies, or antigen-binding fragments thereof) that compete for binding to the same epitope, refers to a interaction between antigen-binding proteins as determined by an assay (e.g., a competitive binding assay; a cross -blocking assay), wherein a test antigen-binding protein (e.g., a test antibody) inhibits (e.g., reduces or blocks) specific binding of a reference antigen-binding protein (e.g., a reference antibody) to a common antigen (e.g., CCR8 or a fragment thereof).

[0108] A polypeptide or amino acid sequence “derived from” a designated polypeptide or protein refers to the origin of the polypeptide. Preferably, the polypeptide or amino acid sequence which is derived from a particular sequence has an amino acid sequence that is essentially identical to that sequence or a portion thereof, wherein the portion consists of at least 10-20 amino acids, preferably at least 20-30 amino acids, more preferably at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the sequence. Polypeptides derived from another peptide may have one or more mutations relative to the starting polypeptide, e.g., one or more amino acid residues which have been substituted with another amino acid residue or which has one or more amino acid residue insertions or deletions.

[0109] A polypeptide can comprise an amino acid sequence that is not naturally occurring. Such variants necessarily have less than 100% sequence identity or similarity with the starting molecule. In certain aspects, the variant will have an amino acid sequence from about 75% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the starting polypeptide, more preferably from about 80% to less than 100%, more preferably from about 85% to less than 100%, more preferably from about 90% to less than 100% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) and most preferably from about 95% to less than 100%, e.g., over the length of the variant molecule.

[0110] In certain aspects, the antibodies of the disclosure are encoded by a nucleotide sequence. Nucleotide sequences of the invention can be useful for a number of applications, including cloning, gene therapy, protein expression and purification, mutation introduction, DNA vaccination of a host in need thereof, antibody generation for, e.g., passive immunization, PCR, primer and probe generation, and the like.

[0111] It will also be understood by one of ordinary skill in the art that the antibodies suitable for use in the methods disclosed herein may be altered such that they vary in sequencefrom the naturally occurring or native sequences from which they were derived, while retaining the desirable activity of the native sequences. For example, nucleotide or amino acid substitutions leading to conservative substitutions or changes at “non-essential” amino acid residues may be made. Mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.

[0112] The antibodies suitable for use in the methods disclosed herein may comprise conservative amino acid substitutions at one or more amino acid residues, e.g., at essential or non- essential amino acid residues. A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a nonessential amino acid residue in a binding polypeptide is preferably replaced with another amino acid residue from the same side chain family. In certain aspects, a string of amino acids can be replaced with a structurally similar string that differs in order and / or composition of side-chain family members. Alternatively, in certain aspects, mutations may be introduced randomly along all or part of a coding sequence, such as by saturation mutagenesis, and the resultant mutants can be incorporated into binding polypeptides of the invention and screened for their ability to bind to the desired target.

[0113] As used herein, the term “cross-reacts” refers to the ability of an antibody of the disclosure to bind to CCR8 from a different species. For example, an antibody of the present disclosure that binds human CCR8 can also bind another species of CCR8. As used herein, crossreactivity is measured by detecting a specific reactivity with purified antigen in binding assays (e.g., SPR, ELISA) or binding to, or otherwise functionally interacting with, cells physiologically or ectopically expressing CCR8. Methods for determining cross-reactivity include standard binding assays as described herein, for example, by BIACORE™ surface plasmon resonance (SPR) analysis using a BIACORE™ 2000 SPR instrument (BIACORE AB, Uppsala, Sweden), or flow cytometric techniques. As used herein, the term “by BIACORE™” refers to a real-timebiomolecular interaction assay determined by surface plasmon resonance (SPR) analysis technology using a BIACORE™ 2000 instrument (BIACORE AB, Uppsala, Sweden).

[0114] As used herein, the term "cytotoxic T lymphocyte (CTL) response" refers to an immune response induced by cytotoxic T cells. CTL responses are mediated primarily by CD8+T cells.

[0115] As used herein, the term "ECso" refers to the concentration of an antibody or an antigen-binding portion thereof, which induces a response, either in an in vitro or an in vivo assay, which is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.

[0116] As used herein, the term "effective dose" or "effective dosage" is defined as an amount sufficient to achieve or at least partially achieve the desired effect. The term "therapeutically effective dose" is defined as an amount sufficient to cure or at least partially arrest the disease and its complications in a patient already suffering from the disease. Amounts effective for this use will depend upon the severity of the disorder being treated and the general state of the patient’s own immune system.

[0117] As used herein, the term "epitope" or "antigenic determinant" refers to a site on an antigen to which an immunoglobulin or antibody specifically binds. The term "epitope mapping" refers to a process or method of identifying the binding site, or epitope, of an antibody, or antigenbinding fragment thereof, on its target protein antigen. Epitope mapping methods and techniques are provided herein. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation. Methods for determining what epitopes are bound by a given antibody (i.e., epitope mapping) are well known in the art and include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides from CCR8 are tested for reactivity with the given anti-CCR8 antibody. Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance (see, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).

[0118] Also encompassed by the present disclosure are antibodies that bind to an epitope on CCR8 which comprises all or a portion of an epitope recognized by the particular antibodies described herein (e.g., the same or an overlapping region or a region between or spanning the region).

[0119] Also encompassed by the present disclosure are antibodies that bind the same epitope and / or antibodies that compete for binding to human CCR8 with the antibodies described herein. Antibodies that recognize the same epitope or compete for binding can be identified using routine techniques. Such techniques include, for example, an immunoassay, which shows the ability of one antibody to block the binding of another antibody to a target antigen, i.e., a competitive binding assay. Competitive binding is determined in an assay in which the immunoglobulin under test inhibits specific binding of a reference antibody to a common antigen, such as CCR8. Numerous types of competitive binding assays are known, for example: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see Stahli et al., Methods in Enzymology 9:242 (1983)); solid phase direct biotin-avidin EIA (see Kirkland et al., J. Immunol. 137:3614 (1986)); solid phase direct labeled assay, solid phase direct labeled sandwich assay (see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988)); solid phase direct label RIA using 1-125 label (see Morel et al., Mol. Immunol. 25(1):7 (1988)); solid phase direct biotin-avidin EIA (Cheung et al., Virology 176:546 (1990)); and direct labeled RIA. (Moldenhauer et al., Scand. J. Immunol. 32:77 (1990)). Typically, such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test immunoglobulin and a labeled reference immunoglobulin. Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test immunoglobulin. Usually, the test immunoglobulin is present in excess. Usually, when a competing antibody is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 50-55%, 55- 60%, 60-65%, 65-70% 70-75% or more.

[0120] Other techniques include, for example, epitope mapping methods, such as, x-ray analyses of crystals of antigen: antibody complexes which provides atomic resolution of the epitope and mass spectrometry combined with hydrogen / deuterium (H / D) exchange which studies the conformation and dynamics of antigen: antibody interactions. Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of bindingdue to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component. In addition, computational combinatorial methods for epitope mapping can also be used. These methods rely on the ability of the antibody of interest to affinity isolate specific short peptides from combinatorial phage display peptide libraries. The peptides are then regarded as leads for the definition of the epitope corresponding to the antibody used to screen the peptide library. For epitope mapping, computational algorithms have also been developed which have been shown to map conformational discontinuous epitopes.

[0121] As used herein, the term "Fc-mediated effector functions" or "Fc effector functions" refer to the biological activities of an antibody other than the antibody’s primary function and purpose. For example, the effector functions of a therapeutic agnostic antibody are the biological activities other than the activation of the target protein or pathway. Examples of antibody effect functions include Clq binding and complement dependent cytotoxicity; Fc receptor binding; antibody -dependent cell-mediated cytotoxicity (ADCC); antibody-dependent cellular phagocytosis (ADCP); down regulation of cell surface receptors (e.g., B cell receptor); lack of activation of platelets that express Fc receptor; and B cell activation. Many effector functions begin with Fc binding to an Fc-gamma receptor. In some aspects, the tumor antigen-targeting antibody has effector function, e.g., ADCC or ADCP activity. In some aspects, a tumor antigen-targeting antibody described herein comprises a variant constant region having increased effector function (e.g. increased ability to mediate ADCC or ADCP) relative to the unmodified form of the constant region.

[0122] As used herein, the term "Fc receptor" refers to a polypeptide found on the surface of immune effector cells, which is bound by the Fc region of an antibody. In some aspects, the Fc receptor is an Fc gamma receptor. There are three subclasses of Fey receptors, FcyRI (CD64), FcyRII (CD32) and FcyRIII (CD 16). All four IgG isotypes (IgGl, IgG2, IgG3 and IgG4) bind and activate Fc receptors FcyRI, FcyRIIA and FcyRIIIA. FcyRIIB is an inhibitory receptor, and therefore antibody binding to this receptor does not activate complement and cellular responses. FcyRI is a high affinity receptor that binds to IgG in monomeric form, whereas FcyRIIA and FcyRIIA are low affinity receptors that bind IgG only in multimeric form and have slightly lower affinity. The binding of an antibody to an Fc receptor and / or Clq is governed by specific residues or domains within the Fc regions. Binding also depends on residues located within the hinge region and within the CH2 portion of the antibody. In some aspects, the agonistic and / or therapeuticactivity of the antibodies described herein is dependent on binding of the Fc region to the Fc receptor (c.g., FcyR). In some aspects, the agonistic and / or therapeutic activity of the antibodies described herein is enhanced by binding of the Fc region to the Fc receptor (e.g., FcyR).

[0123] As used herein, the term "human antibody" includes antibodies having variable and constant regions (if present) of human germline immunoglobulin sequences. Human antibodies of the disclosure can include amino acid residues not encoded by human germline immunoglobulin sequences e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo) (See, e.g., Lonberg et al., (1994) Nature 368(6474): 856-859); Lonberg, (1994) Handbook of Experimental Pharmacology 113:49-101; Lonberg & Huszar, (1995) Intern. Rev. Immunol. 13:65-93, and Harding & Lonberg, (1995) Ann. N.Y. Acad. Sci. 764:536-546). However, the term "human antibody" does not include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences (i.e. humanized antibodies).

[0124] As used herein, the term "humanized" refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In some embodiments of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen. A "humanized" antibody retains an antigenic specificity similar to that of the original antibody.

[0125] A "chimeric antibody" refers to an antibody in which the variable regions are derived from one species and the constant regions are derived from another species, such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.

[0126] As used herein, the term a "heterologous antibody" is defined in relation to the transgenic non-human organism producing such an antibody. This term refers to an antibody having an amino acid sequence or an encoding nucleic acid sequence corresponding to that found in an organism not consisting of the transgenic non-human animal, and generally from a species other than that of the transgenic non-human animal.

[0127] The terms "inducing an immune response" and "enhancing an immune response" arc used interchangeably and refer to the stimulation of an immune response (i.e., either passive or adaptive) to a particular antigen. The terms "induce" as used with respect to inducing CDC or ADCC or ADCP refer to the stimulation of particular direct cell killing mechanisms.

[0128] As used herein, the term "immunogenic cell death" (alternatively known as "immunogenic apoptosis" refers to a cell death modality associated with the activation of one or more signaling pathways that induces the pre-mortem expression and emission of damaged- associated molecular pattern (DAMPs) molecules (e.g., adenosine triphosphate, ATP) from the tumor cell, resulting in the increase of immunogenicity of the tumor cell and the death of the tumor cell in an immunogenic manner (e.g., by phagocytosis). As used herein, the term "immunogenic cell death-inducing agent" refers to a chemical, biological, or pharmacological agent that induces an immunogenic cell death process, pathway, or modality.

[0129] As used herein, the terms "inhibits", "reduces" or "blocks" (e.g., referring to inhibition or reduction of human CCR8-mediated phosphorylation of STAT 1 and / or STAT3 in a cell) are used interchangeably and encompass both partial and complete inhibition / blocking. The inhibition / blocking of CCR8 reduces or alters the normal level or type of activity that occurs without inhibition or blocking. Inhibition and blocking are also intended to include any measurable decrease in the binding affinity of CCR8 when in contact with an anti-CCR8 antibody as compared to CCR8 not in contact with an anti-CCR8 antibody, e.g., inhibits binding of CCR8 by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%.

[0130] As used herein, the term "inhibits growth" (e.g., referring to a tumor or cells, e.g., tumor cells) is intended to include any measurable decrease in the growth of a tumor or a cell, e.g., the inhibition of growth of a tumor by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 99%, or 100%.

[0131] As used herein, a subject "in need of prevention," "in need of treatment," or "in need thereof," refers to one, who by the judgment of an appropriate medical practitioner (e.g., a doctor, a nurse, or a nurse practitioner in the case of humans; a veterinarian in the case of nonhuman mammals), would reasonably benefit from a given treatment (such as treatment with a composition comprising an anti-CCR8 antibody).

[0132] The term "in vivo" refers to processes that occur in a living organism.

[0133] As used herein, the term "isolated antibody" is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to human CCR8 is substantially free of antibodies that specifically bind antigens other than CCR8). An isolated antibody that specifically binds to an epitope may, however, have cross-reactivity to other CCR8 proteins from different species. However, the antibody continues to display specific binding to human CCR8 in a specific binding assay as described herein. In addition, an isolated antibody is typically substantially free of other cellular material and / or chemicals. In some aspects, a combination of "isolated" antibodies having different CCR8 specificities is combined in a well-defined composition.

[0134] As used herein, the term "isolated nucleic acid molecule" refers to nucleic acids encoding antibodies or antibody portions (e.g., VH, VL, CDR3) that bind to CCR8, and is intended to refer to a nucleic acid molecule in which the nucleotide sequences encoding the antibody or antibody portion are free of other nucleotide sequences encoding antibodies or antibody portions that bind antigens other than CCR8, which other sequences may naturally flank the nucleic acid in human genomic DNA. For example, a sequence selected from a sequence set forth in Table 12 corresponds to the nucleotide sequences comprising the heavy chain (VH) and light chain (VL) variable regions of anti-CCR8 antibody monoclonal antibodies described herein.

[0135] As used herein, "isotype" refers to the antibody class (e.g., IgM or IgGl) that is encoded by heavy chain constant region genes. In some aspects, a human monoclonal antibody of the disclosure is of the IgGl isotype. In some aspects, a human monoclonal antibody of the disclosure is of the IgG2 isotype. In some aspects, a human monoclonal antibody of the disclosure is of the IgG3 isotype. In some aspects, a human monoclonal antibody of the disclosure is of the IgG4 isotype. As is apparent to a skilled artisan, identification of antibody isotypes (e.g., IgGl, IgG2, IgG3, IgG4, IgM, IgAl IgA2, IgD, and IgE) is routine in the art and commonly involves a combination of sequence alignments with known antibodies, published Fc variant sequences and conserved sequences.

[0136] As used herein the term "KD" or "KD" refers to the equilibrium dissociation constant of a binding reaction between an antibody and an antigen. The value of KD is a numeric representation of the ratio of the antibody off-rate constant (kd) to the antibody on-rate constant (ka). The value of KD is inversely related to the binding affinity of an antibody to an antigen. The smaller the KD value the greater the affinity of the antibody for its antigen. Affinity is the strengthof binding of a single molecule to its ligand and is typically measured and reported by the equilibrium dissociation constant (KD), which is used to evaluate and rank order strengths of bimolecular interactions.

[0137] As used herein, the term "kd" or "kd" (alternatively "koff" or "koff") is intended to refer to the off-rate constant for the dissociation of an antibody from an antibody / antigen complex. The value of kd is a numeric representation of the fraction of complexes that decay or dissociate per second, and is expressed in units sec'1.

[0138] As used herein, the term "ka" or "ka" (alternatively "kon" or "kOn") is intended to refer to the on-rate constant for the association of an antibody with an antigen. The value of ka is a numeric representation of the number of antibody / antigen complexes formed per second in a 1 molar (IM) solution of antibody and antigen, and is expressed in units M^sec'1.

[0139] As used herein, the term "lymphocytes" refers to a type of leukocyte or white blood cell that is involved in the immune defenses of the body. There are two main types of lymphocytes: B-cells and T-cells. The term "tumor-infiltrating lymphocyte" (abbreviated "TIL") or "tumorinfiltrating Treg," as used herein, refers to a lymphocyte or a Treg, respectively, that is associated with tumor cells, e.g., that is localized within a tumor mass.

[0140] As used herein, the terms "linked," "fused," or "fusion," are used interchangeably. These terms refer to the joining of two more elements, components, or domains by whatever means including chemical conjugation or recombinant means. Methods of chemical conjugation (e.g., using heterobifunctional crosslinking agents) are known in the art.

[0141] As used herein, the term "monoclonal antibody" refers to an antibody that displays a single binding specificity and affinity for a particular epitope. Accordingly, the term "human monoclonal antibody" refers to an antibody which displays a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences. In some aspects, human monoclonal antibodies are produced by a hybridoma that includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.

[0142] As used herein, the term "natural killer (NK) cell" refers to a type of cytotoxic lymphocyte. These are large, usually granular, non-T, non-B lymphocytes, which kill certain tumorcells and play an important role in innate immunity to viruses and other intracellular pathogens, as well as in antibody-dependent cell-mediated cytotoxicity (ADCC).

[0143] As used herein, the term "naturally-occurring" as applied to an object refers to the fact that an object can be found in nature. For example, a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally-occurring.

[0144] As used herein, the term "nucleic acid" refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double- stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and / or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081, 1991; Ohtsuka et al., Biol. Chem. 260:2605-2608, 1985; and Cassol et al, 1992; Rossolini et al, Mol. Cell. Probes 8:91-98, 1994). For arginine and leucine, modifications at the second base can also be conservative. The term nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.

[0145] Polynucleotides used herein can be composed of any polyribonucleotide or polydeoxribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA. For example, polynucleotides can be composed of single- and double- stranded DNA, DNA that is a mixture of single- and double- stranded regions, single- and double- stranded RNA, and RNA that is mixture of single- and double- stranded regions, hybrid molecules comprising DNA and RNA that can be single- stranded or, more typically, double-stranded or a mixture of single- and doublestranded regions. In addition, the polynucleotide can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA. A polynucleotide can also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons. "Modified" bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications can be made to DNA and RNA; thus, "polynucleotide" embraces chemically, enzymatically, or metabolically modified forms.

[0146] A nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For instance, a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence. With respect to transcription regulatory sequences, operably linked means that the DNA sequences being linked are contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame. For switch sequences, operably linked indicates that the sequences are capable of effecting switch recombination.

[0147] As used herein, "parenteral administration," "administered parenterally," and other grammatically equivalent phrases, refer to modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intranasal, intraocular, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural, intracerebral, intracranial, intracarotid and intrasternal injection and infusion.

[0148] As used herein, the term "patient" includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.

[0149] The term "percent identity," in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection. Depending on the application, the "percent identity" can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared. For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.

[0150] Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).

[0151] One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website.

[0152] As generally used herein, "pharmaceutically acceptable" refers to those compounds, materials, compositions, and / or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues, organs, and / or bodily fluids of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit / risk ratio.

[0153] As used herein, a "pharmaceutically acceptable carrier" refers to, and includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. The compositions can include a pharmaceutically acceptable salt, e.g., an acid addition salt or a base addition salt (see, e.g., Berge et al. (1977) J Pham Sci 66:1-19).

[0154] As used herein, the terms "polypeptide," "peptide," and "protein" are used interchangeably to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.

[0155] As used herein, the term "preventing" when used in relation to a condition, refers to administration of a composition that reduces the frequency of, or delays the onset of, symptoms of a medical condition in a subject relative to a subject that does not receive the composition.

[0156] As used herein, the term "purified" or "isolated" as applied to any of the proteins (antibodies or fragments) described herein refers to a polypeptide that has been separated orpurified from components (e.g., proteins or other naturally-occurring biological or organic molecules) which naturally accompany it, e.g., other proteins, lipids, and nucleic acid in a prokaryote expressing the proteins. Typically, a polypeptide is purified when it constitutes at least 60 % (e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, 97%, or 99%), by weight, of the total protein in a sample.

[0157] As used herein, the term "rearranged" refers to a configuration of a heavy chain or light chain immunoglobulin locus wherein a V segment is positioned immediately adjacent to a D- J or J segment in a conformation encoding essentially a complete VH or VL domain, respectively. A rearranged immunoglobulin gene locus can be identified by comparison to germline DNA; a rearranged locus will have at least one recombined heptamer / nonamer homology element.

[0158] As used herein, the term "recombinant host cell" (or simply "host cell") is intended to refer to a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell" as used herein.

[0159] As used herein, the term "recombinant antibody" includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies comprise variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations which occur, for example, during antibody maturation. As known in the art (see, e.g., Lonberg (2005) Nature Biotech. 23(9): 1117- 1125), the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen. In addition to rearrangement, the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen.The constant region will change in further response to an antigen (z.e., isotype switch). Therefore, the rearranged and somatically mutated nucleic acid molecules that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not have sequence identity with the original nucleic acid molecules, but instead will be substantially identical or similar (i.e., have at least 80% identity).

[0160] As used herein, the term "reference antibody" (used interchangeably with "reference mAb") or "reference antigen-binding protein" refers to an antibody, or an antigenbinding fragment thereof, that binds to a specific epitope on CCR8 and is used to establish a relationship between itself and one or more distinct antibodies, wherein the relationship is the binding of the reference antibody and the one or more distinct antibodies to the same epitope on CCR8. As used herein, the term connotes an anti-CCR8 antibody that is useful in a test or assay, such as those described herein, (e.g., a competitive binding assay), as a competitor, wherein the assay is useful for the discovery, identification or development, of one or more distinct antibodies that bind to the same epitope.

[0161] As used herein, the terms "specific binding," "selective binding," "selectively binds," and "specifically binds," refer to antibody binding to an epitope on a predetermined antigen. Typically, the antibody binds with an equilibrium dissociation constant (KD) of approximately less than 10‘6M, such as approximately less than 10‘7, 10‘8M, 10‘9M or IO"10M or even lower when determined by surface plasmon resonance (SPR) technology in a BIACORE™ 2000 instrument using recombinant human CCR8 as the analyte and the antibody as the ligand and binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen. In certain aspects, an antibody that specifically binds to CCR8 binds with an equilibrium dissociation constant (KD) of approximately less than 100 nM (10‘7M), optionally approximately less than 50 nM (5 x 10'8M), optionally approximately less than 15 nM (1.5 x 10’8M), optionally approximately less than 10 nM (10‘8M), optionally approximately less than 5 nM (5 x 10’9M), optionally approximately less than 1 nM (10‘9M), optionally approximately less than 0.1 nM (10‘10M), optionally approximately less than 0.01 nM (W11M), or even lower, when determined by surface plasmon resonance (SPR) technology in a BIACORE™ 2000 instrument using recombinant human CCR8 as the analyte and the antibody as the ligand, where binding to the predetermined antigen occurs with an affinity that is at least two-fold greater than theantibody’s affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen The phrases "an antibody recognizing an antigen" and "an antibody specific for an antigen" are used interchangeably herein with the term "an antibody which binds specifically to an antigen."

[0162] As used herein, the term "subject" includes any human or non-human animal. For example, the methods and compositions of the present invention can be used to treat a subject with an immune disorder. The term "non-human animal" includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.

[0163] For nucleic acids, the term "substantial homology" indicates that two nucleic acids, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80% of the nucleotides, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the nucleotides. Alternatively, substantial homology exists when the segments will hybridize under selective hybridization conditions, to the complement of the strand.

[0164] The percent identity between two sequences is a function of the number of identical positions shared by the sequences (z.e., % homology = # of identical positions / total # of positions x 100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.

[0165] The percent identity between two nucleotide sequences can be determined using the GAP program in the GCG software package (available at gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. The percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4:11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol. (48):444-453 (1970)) algorithm which has been incorporated into the GAP program in the GCG software package (available at gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.

[0166] As used herein, “CHS-1 14” refers to an afucosylated IgGl antibody having a variable heavy chain sequence according to SEQ ID NO: 41 and a variable light chain sequence according to SEQ ID NO: 43. CHS-114 may also be referred to herein as SRF114, or SRF-114.

[0167] The nucleic acid and protein sequences of the present disclosure can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score = 100, wordlength = 12 to obtain nucleotide sequences homologous to the nucleic acid molecules of the invention. BLAST protein searches can be performed with the XBLAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to the protein molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g. , XBLAST and NBLAST) can be used.

[0168] The nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form. A nucleic acid is "isolated" or "rendered substantially pure" when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids or proteins, by standard techniques, including alkaline / SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et al., ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).

[0169] The nucleic acid compositions of the present disclosure, while often in a native sequence (except for modified restriction sites and the like), from either cDNA, genomic or mixtures thereof may be mutated, in accordance with standard techniques to provide gene sequences. For coding sequences, these mutations may affect amino acid sequence as desired. In particular, DNA sequences substantially homologous to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated (where "derived" indicates that a sequence is identical or modified from another sequence).

[0170] The term "T cell" refers to a type of white blood cell that can be distinguished from other white blood cells by the presence of a T cell receptor on the cell surface. There are several subsets of T cells, including, but not limited to, T helper cells (a.k.a. TH cells or CD4+T cells) andsubtypes, including Tul , TH2, TH3, TH17, TH9, and TFH cells, cytotoxic T cells (a.k.a Tc cells, CD8+T cells, cytotoxic T lymphocytes, T-killcr cells, killer T cells), memory T cells and subtypes, including central memory T cells (TCM cells), effector memory T cells (TEM and TEMRA cells), and resident memory T cells (TRM cells), regulatory T cells (a.k.a. Tregcells or suppressor T cells) and subtypes, including CD4+FOXP3+Treg cells, CD4+FOXP3‘ Treg cells, Tri cells, Th3 cells, and Treg17 cells, natural killer T cells (a.k.a. NKT cells), mucosal associated invariant T cells (MAITs), and gamma delta T cells (y5 T cells), including Vy9 / V82 T cells. Any one or more of the aforementioned or unmentioned T cells may be the target cell type for a method of use of the invention.

[0171] As used herein, the term "T cell-mediated response" refers to any response mediated by T cells, including, but not limited to, effector T cells (e.g., CD8+cells) and helper T cells (e.g., CD4+cells). T cell mediated responses include, for example, T cell cytotoxicity and proliferation.

[0172] As used herein, the term "regulatory T cell," "T regulatory cell," Treg," or "Treg", used interchangeably herein, refers to a subpopulation of T cells that modulate the immune system, maintain tolerance to self-antigens, and prevent autoimmune disease. Tregs are immunosuppressive and generally suppress or downregulate induction and proliferation of effector T cells. Tregs are known to direct effector T cell lysis, support tolerogenic dendritic cell formation, support M2 macrophage formation, produce immunosuppressive metabolites and cytokines, serve as an IL-2 sink, and to promote neovasculature formation. Though there are many types of Tregs, many Tregs express CD4 and FOXP3, with FOXP3 serving as a marker for Tregs in many cases.

[0173] As used herein, the terms "therapeutically effective amount" or "therapeutically effective dose," or similar terms used herein are intended to mean an amount of an agent (e.g., an anti-CCR8 antibody or an antigen-binding fragment thereof) that will elicit the desired biological or medical response (e.g., an improvement in one or more symptoms of a cancer).

[0174] The terms "treat," "treating," and "treatment," as used herein, refer to therapeutic or preventative measures described herein. The methods of "treatment" employ administration to a subject, in need of such treatment, a human antibody of the present disclosure, for example, a subject in need of an enhanced immune response against a particular antigen or a subject who ultimately may acquire such a disorder, in order to prevent, cure, delay, reduce the severity of, orameliorate one or more symptoms of the disorder or recurring disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.

[0175] The term “trough level” refers to the lowest concentration of a drug in a patient's bloodstream between doses of administration of the drug.

[0176] As used herein, the term "tumor microenvironment" (alternatively "cancer microenvironment;" abbreviated TME) refers to the cellular environment or milieu in which the tumor or neoplasm exists, including surrounding blood vessels as well as non-cancerous cells including, but not limited to, immune cells, fibroblasts, bone marrow-derived inflammatory cells, and lymphocytes. Signaling molecules and the extracellular matrix also comprise the TME. The tumor and the surrounding microenvironment are closely related and interact constantly. Tumors can influence the microenvironment by releasing extracellular signals, promoting tumor angiogenesis and inducing peripheral immune tolerance, while the immune cells in the microenvironment can affect the growth and evolution of tumor cells.

[0177] As used herein, the term "vector" is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid," which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors"). In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" may be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.

[0178] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosurepertains. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the presently disclosed methods and compositions. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety.

[0179] Various aspects of the disclosure are described in further detail in the following subsections.II. Compositions of the Disclosure

[0180] Certain aspects of the present disclosure are directed to antibodies or antigenbinding portions thereof that specifically bind CCR8 ("anti-CCR8 antibody"). In certain aspects, the anti-CCR8 antibody specifically binds the N-terminal extracellular domain of human CCR8. Historically, it has been very difficult to generate therapeutic antibodies to CCR8. CCR8, like other G protein-coupled receptor (GPCRs), is challenging to raise antibodies against due to their strong membrane association, lack of exposure of sequence on the cell surface, and difficulty expressing the CCR8 full-length protein itself. Numerous previous attempts leveraging multiple antibody generation platforms have failed. (See also Jo and Jung, Experimental & Molecular Medicine 48 e207 (2016).) The present disclosure solves this problem by specifically targeting the N- terminal extracellular domain of human CCR8. By raising antibodies specifically targeting to the N-terminal domain, the present disclosure focused on generating antibodies that target the longest extracellular portion of CCR8. This enabled the achievement of previously unattainable anti-CCR8 antibodies. In doing so, the antibodies described herein are capable of inhibiting CCR8 activity in a way not previously described. In particular, the antibodies disclosed herein are capable of (a) enhancing an immune response to a tumor; (b) reducing, depleting, or killing tumor infiltrating regulatory T ("Treg") cells; (c) inducing internalization of CCR8 in tumor infiltrating regulatory T ("Treg") cells; (d) activating NK cells, (e) inducing NK cell mediated killing of tumor infiltrating regulatory T ("Treg") cells; (f) binding to cynomolgus monkey ("cyno") CCR8; (g) binding to human CCR8 with KD of 10 nM or less as measured by BIACORE™; or (h) any combination thereof.

[0181] In some aspects, the anti-CCR8 antibody or the antigen-binding portion thereof is further engineered by removing one or more post-translation modification. In some aspects, the anti-CCR8 antibody or the antigen-binding portion thereof is engineered to remove one or more fucose sugar' units. In some aspects, the anti-CCR8 antibody or the antigen-binding portion thereofis modified to remove one or more fucose sugar units from the (IgG 1 ) Fc region of the anti-CCR8 antibody. In some aspects, the anti-CCR8 antibody or the antigen-binding portion thereof is afucosylated. In some aspects, removal of one or more fucose sugar units increases the ADCC of the anti-CCR8 antibody or antigen-binding fragment thereof. In some aspects, the ADCC of the anti-CCR8 antibody modified to remove one or more fucose sugar units (e.g., afucosylated antibody) is at least about 1.5-fold, at least about 2.0-fold, at least about 2.5-fold, at least about 3.0-fold, at least about 3.5-fold, at least about 4.0-fold, at least about 4.5-fold, or at least about 5.0- fold higher than the anti-CCR8 antibody that is not modified to remove one or more fucose sugar units (e.g., fucosylated antibody). In some aspects, the ADCC activity of the anti-CCR8 antibody modified to remove one or more fucose sugar units is at least about 3.0-fold higher than the anti- CCR8 antibody that is not modified to remove one or more fucose sugar units. In some aspects, the ADCC activity of the anti-CCR8 antibody modified to remove one or more fucose sugar units is at least about 3.5-fold higher than the anti-CCR8 antibody that is not modified to remove one or more fucose sugar units. In some aspects, the ADCC activity of the anti-CCR8 antibody modified to remove one or more fucose sugar units is at least about 4.0-fold higher than the anti-CCR8 antibody that is not modified to remove one or more fucose sugar units.

[0182] In some aspects, the ADCP of the anti-CCR8 antibody modified to remove one or more fucose sugar units (e.g., afucosylated antibody) is at least about 1.5-fold, at least about 2.0- fold, at least about 2.5-fold, at least about 3.0-fold, at least about 3.5-fold, at least about 4.0-fold, at least about 4.5-fold, or at least about 5.0-fold higher than the anti-CCR8 antibody that is not modified to remove one or more fucose sugar units (e.g., fucosylated antibody). In some aspects, the ADCP activity of the anti-CCR8 antibody modified to remove one or more fucose sugar units is at least about 3.0-fold higher than the anti-CCR8 antibody that is not modified to remove one or more fucose sugar units. In some aspects, the ADCP activity of the anti-CCR8 antibody modified to remove one or more fucose sugar units is at least about 3.5-fold higher than the anti-CCR8 antibody that is not modified to remove one or more fucose sugar units. In some aspects, the ADCP activity of the anti-CCR8 antibody modified to remove one or more fucose suga' units is at least about 4.0-fold higher than the anti-CCR8 antibody that is not modified to remove one or more fucose sugar units.

[0183] In certain aspects, the anti-CCR8 antibody is capable of inducing an immune response to a tumor. Treg cells serve to regulate the immune response by down regulating theactivity of T cells as a means of keeping the immune system in check. Tumor infiltrating Tregs can act to prevent an immune response targeting the tumor, thereby allowing the tumor to evade destruction by a subject's immune system. The anti-CCR8 antibodies described herein are capable of inhibiting tumor infiltrating Tregs, thereby reducing this barrier to an anti-tumor immune response. In some aspects, the anti-CCR8 antibody increases an immune response to a tumor in a subject in need thereof by at least about 50%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, or at least about 500% relative to an immune response in the absence of the anti-CCR8 antibody.

[0184] An anti-tumor immune response can be measured using any indicators known in the art. In some aspects, the anti-tumor immune response is determined by comparing the number of tumor infiltrating T cells (TILs) in a tumor sample obtained by a subject before and after contacting the tumor with the anti-CCR8 antibody. In some aspects, the number of TILs is measured by immunohistochemistry or quantitative polymerase chain reaction (qPCR). In some aspects, the number of TILs in the tumor sample is increase by at least about 1.5 fold, at least about 2 fold, at least about 2.5 fold, at least about 3 fold, at least about 3.5 fold, at least about 4 fold, at least about 4.5 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, at least about 10 fold, at least about 15 fold, or at least about 20 fold, relative to the number of TILs in a tumor sample obtained from the subject prior to contacting the tumor with the anti-CCR8 antibody.

[0185] In certain aspects, the anti-CCR8 antibody is capable of reducing, depleting, or killing tumor infiltrating Treg cells. In some aspects, the anti-CCR8 antibody induces depletion in the number of tumor infiltrating Treg cells in a subject following administration of the anti-CCR8 antibody or antigen-binding portion thereof, relative to the number of tumor infiltrating Treg cells prior to the administration. In some aspects, the number of tumor infiltrating Treg cells is depleted by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or about 100% relative to the number of tumor infiltrating Treg cells prior tothe administration. Tn some aspects, the anti-CCR8 preferentially reduces, depletes, or kills tumor infiltrating Trcg cells relative to peripheral Trcg cells.

[0186] In certain aspects, the anti-CCR8 antibody is capable of increasing a concentration of one or more cytokines in a subject. In some aspects, the anti-CCR8 antibody increases a concentration of one or more cytokines in a subject following administration of the antibody or antigen-binding portion thereof, relative to the concentration of the one or more cytokines prior to the administration. In some aspects, the concentration of one or more cytokines is increased by at least about 5%, at least about 10%, at least about 12%, at least about 15%, at least about 18%, at least about 20%, at least about 23%, at least about 25%, at least about 27%, at least about 30%, at least about 32%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, or at least about 75%, relative to the concentration of the one or more cytokines prior to the administration. In some aspects, the concentration of one or more cytokines is increased by at least about 1.1 fold, at least about 1.2 fold, at least about 1.3 fold, at least about 1.4 fold, at least about 1.5 fold, at least about 2 fold, at least about 2.5 fold, at least about 3 fold, at least about 3.5 fold, at least about 4 fold, at least about 4.5 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, at least about 10 fold, at least about 15 fold, or at least about 20 fold, relative to the concentration of the one or more cytokines prior to administration of the anti-CCR8 antibody. In some aspects, the one or more cytokines are selected from IFN-y, TNFot, CXCL10, IL-12 / IL-23p40, M-CSF-1, IL-la, IL-27, VCAM-1, IL-10, MlP-ly, IL-2, Eotaxin, IL-18, Granzyme B, and MIPlb (macrophage inflammatory protein 1 beta). In some aspects, the cytokine is IFN-y. In some aspects, the cytokine is TNFa. In some aspects, the cytokine is CXCL10. In some aspects, the cytokine is IL-12 / IL-23p40. In some aspects, the cytokine is M-CSF-1. In some aspects, the cytokine is IL-la. In some aspects, the cytokine is IL-27. In some aspects, the cytokine isVCAM-1. In some aspects, the cytokine is IL-10. In some aspects, the cytokine is MlP-ly. In some aspects, the cytokine is IL-2. In some aspects, the cytokine is Eotaxin. In some aspects, the cytokine is IL-18. In some aspects, the cytokine is Granzyme B. In some aspects, the cytokine is MIPlb.

[0187] In certain aspects, the anti-CCR8 antibody is capable of increasing a frequency of one or more cell surface markers in a tumor or a cell population of a subject. In some aspects, the anti-CCR8 antibody increases a frequency of one or more cell surface markers in a tumor or a cellpopulation of a subject following administration of the antibody or antigen-binding portion thereof, relative to the frequency of the one or more cell surface markers prior to the administration. In some aspects, the frequency of one or more cell surface markers is increased by at least about 5%, at least about 10%, at least about 12%, at least about 15%, at least about 18%, at least about 20%, at least about 23%, at least about 25%, at least about 27%, at least about 30%, at least about 32%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, or at least about 75%, relative to the frequency of the one or more cell surface markers prior to the administration. In some aspects, the frequency of one or more cell surface markers is increased by at least about 1.1 fold, at least about 1.2 fold, at least about 1.3 fold, at least about 1.4 fold, at least about 1.5 fold, at least about 2 fold, at least about 2.5 fold, at least about 3 fold, at least about 3.5 fold, at least about 4 fold, at least about 4.5 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, at least about 10 fold, at least about 15 fold, or at least about 20 fold, relative to the frequency of the one or more cell surface markers prior to administration of the anti-CCR8 antibody. In some aspects, the one or more cell surface markers are selected from 4- IBB, CD25, CD 107a, and a combination thereof, on the surface of NK cells. In some aspects, the one or more cell surface markers are selected from B7-H3, CD83, CD86, HLA-DR, CD40, and a combination thereof, on the surface of monocytes.

[0188] In some aspects, the tumor or cell population is a tumor tissue sample. In some aspects, the tumor or cell population is a liquid biopsy sample. In some aspects, the tumor or cell population is a blood sample.

[0189] In some aspects, the anti-CCR8 antibody induces antibody-dependent cellular cytotoxicity (ADCC) in a subject following administration of the anti-CCR8 antibody. In some aspects, the ADCC comprises an EC50 of about 100 pg / mL or less following the administration of the antibody or antigen-binding portion thereof. In some aspects, the ADCC comprises an EC50 of about 100 pg / mL or less, about 90 pg / mL or less, about 80 pg / mL or less, about 70 pg / mL or less, about 60 pg / mL or less, about 50 pg / mL or less, about 45 pg / mL or less, about 40 pg / mL or less, about 35 pg / mL or less, about 30 pg / mL or less, about 30 pg / mL or less, about 25 pg / mL or less, about 20 pg / mL or less, about 15 pg / mL or less, about 10 pg / mL or less, about 5 pg / mL or less, about 1 pg / mL or less, about 0.5 pg / mL or less, about pg / mL or less, about 0.1 pg / mL or less, or about 0.01 pg / mL or less following the administration of the ant-CCR8 antibody. In someaspects, the ADCC comprises an EC50 of about 1 pg / mL or less following the administration of the anti-CCR8 antibody or antigen-binding portion thereof. In some aspects, the ADCC comprises an EC50 of about 0.1 pg / mL or less following the administration of the antibody or antigenbinding portion thereof.

[0190] Without being bound by any theory or particular mechanism, it is hypothesized that targeting CCR8 in tumor infiltrating Tregs leads to activation of NK cells in the tumor microenvironment. Activated NK cells are then able to target and kill tumor infiltrating Tregs, reducing their number and enhancing the immune response to the tumor. Accordingly, in some aspects, the anti-CCR8 antibody is capable of activating NK cells. In some aspects, the NK cells are activated in the tumor microenvironment. In some aspects, the NK cells are tumor infiltrating NK cells. NK cell activation can be measured using any techniques known in the art. In some aspects, NK cell activation is determined by measuring the percentage of cells that express one or more marker of activated NK cells. In certain aspects, NK cell activation is determined by measuring the percent of cells in the tumor microenvironment that express NKp46, but do not express CD3 (e.g., NKp46+ / CD3‘ cells).

[0191] In some aspects, NK cell activation is characterized by increased expression of one or more target genes by NK cells. In some aspects, the anti-CCR8 antibody is capable of inducing upregulation of 4- IBB on the surface of NK cells. In some aspects, the anti-CCR8 antibody is capable of inducing upregulation of ICAM-1 on the surface of NK cells. In some aspects, the anti- CCR8 antibody is capable of inducing upregulation of 4- IBB and ICAM-1 on the surface of NK cells. In some aspects, the anti-CCR8 antibody is capable of inducing upregulation of CD25 on the surface of NK cells. In some aspects, the anti-CCR8 antibody is capable of inducing upregulation of CD107a on the surface of NK cells. In some aspects, the level of 4-1BB, CD25, CD107a, and / or ICAM-1 on the surface of NK cells following the contacting of the anti-CCR8 antibody to a tumor is upregulated by at least about 1.5 fold, 2 fold, 2.5 fold, 3.0 fold, 3.5 fold, 4.0 fold, 4.5 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, or 10 fold, relative to the level of 4- IBB, CD25, CD107a, and / or ICAM-1 on the surface of NK cells in a tumor sample taken prior to the contacting.

[0192] In some aspects, NK cell activation is characterized by decreased expression of one or more target genes by NK cells. In some aspects, the anti-CCR8 antibody is capable of inducing downregulation of CD 16 on the surface of NK cells. In some aspects, the level of CD 16 on the surface of NK cells following the contacting of the anti-CCR8 antibody to a tumor isdownregulated by at least about 1.5 fold, 2 fold, 2.5 fold, 3.0 fold, 3.5 fold, 4.0 fold, 4.5 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, or 10 fold, relative to the level of CD 16 on the surface of NK cells in a tumor sample taken prior to the contacting.

[0193] In some aspects, the number of activated NK cells in the tumor microenvironment is increased by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or about 100% relative to the percent of activated NK cells in a tumor sample obtained from the subject prior to contacting the tumor with the anti-CCR8 antibody. In some aspects, the percent of activated NK cells in the tumor microenvironment is increased by at least about 1.5 fold, at least about 2 fold, at least about 2.5 fold, at least about 3 fold, at least about 3.5 fold, at least about 4 fold, at least about 4.5 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, at least about 10 fold, at least about 15 fold, or at least about 20 fold, relative to the number of activated NK cells in a tumor sample obtained from the subject prior to contacting the tumor with the anti-CCR8 antibody. In some aspects, the anti-CCR8 antibody is capable of inducing NK cell mediated killing of tumor infiltrating Tregs.

[0194] In some aspects, the anti-CCR8 antibody induces antibody-dependent cellular phagocytosis (ADCP) in a subject following administration of the anti-CCR8 antibody. In some aspects, the ADCP comprises an EC50 of about 100 g / mL or less following the administration of the antibody or antigen-binding portion thereof. In some aspects, the ADCP comprises an EC50 of about 100 pg / mL or less, about 90 pg / mL or less, about 80 pg / mL or less, about 70 pg / mL or less, about 60 pg / mL or less, about 50 pg / mL or less, about 45 pg / mL or less, about 40 pg / mL or less, about 35 pg / mL or less, about 30 pg / mL or less, about 30 pg / mL or less, about 25 pg / mL or less, about 20 pg / mL or less, about 15 pg / mL or less, about 10 pg / mL or less, about 5 pg / mL or less, about 1 pg / mL or less, about 0.5 pg / mL or less, about 0.2 pg / mL or less, about 0.1 pg / mL or less, or about 0.01 pg / mL or less following the administration of the ant-CCR8 antibody. In some aspects, the ADCP comprises an EC50 of about 1 pg / mL or less following the administration of the anti-CCR8 antibody or antigen-binding portion thereof. In some aspects, the ADCP comprisesan EC50 of about 0.1 pg / mL or less following the administration of the antibody or antigenbinding portion thereof.

[0195] Without being bound by any theory or particular mechanism, it is hypothesized that targeting CCR8 in tumor infiltrating Tregs leads to activation of macrophages in the tumor microenvironment. Activated macrophages are then able to phagocytize infiltrating Tregs, reducing their number and enhancing the immune response to the tumor. Accordingly, in some aspects, the anti-CCR8 antibody is capable of activating macrophages. In some aspects, the macrophages are activated in the tumor microenvironment. In some aspects, the macrophages are tumor infiltrating macrophages. Macrophage activation and / or phagocytosis can be measured using any techniques known in the art. In some aspects, macrophage activation and / or phagocytosis is determined by measuring the percentage of macrophages that express one or more marker indicative of activation. In certain aspects, macrophage activation and / or phagocytosis is determined by measuring the percentage of macrophages in the tumor microenvironment that express CD14 and CFSE (e.g., CD14+ / CFSE+cells) among total CD14+macrophages.

[0196] In some aspects, monocyte activation is characterized by increased expression of one or more target genes by monocytes. In some aspects, the anti-CCR8 antibody is capable of inducing upregulation of B7-H3 on the surface of monocytes. In some aspects, the anti-CCR8 antibody is capable of inducing upregulation of CD83 on the surface of monocytes. In some aspects, the anti-CCR8 antibody is capable of inducing upregulation of CD86 on the surface of monocytes. In some aspects, the anti-CCR8 antibody is capable of inducing upregulation or HLA- DR on the surface of monocytes. In some aspects, the anti-CCR8 antibody is capable of inducing upregulation of CD40 on the surface of monocytes. In some aspects, the level of B7-H3, CD83, CD86, HLA-DR, and / or CD40 on the surface of monocytes following the contacting of the anti- CCR8 antibody to a tumor is upregulated by at least about 1.5 fold, 2 fold, 2.5 fold, 3.0 fold, 3.5 fold, 4.0 fold, 4.5 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, or 10 fold, relative to the level of B7- H3, CD83, CD86, HLA-DR, and / or CD40 on the surface of monocytes in a tumor sample taken prior to the contacting.

[0197] In some aspects, the number of macrophages in the tumor microenvironment is increased by at least about 1%, at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 6%, at least about 7%, at least about 8%, at least about 9%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or about 100% relative to the percent of macrophages in a tumor sample obtained from the subject prior to contacting the tumor with the anti-CCR8 antibody. In some aspects, the percent of macrophages in the tumor microenvironment is increased by at least about 1.1 fold, at least about 1.2 fold, at least about 1.3 fold, at least about 1.4 fold, at least about 1.5 fold, at least about 2 fold, at least about 2.5 fold, at least about 3 fold, at least about 3.5 fold, at least about 4 fold, at least about 4.5 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, at least about 10 fold, at least about 15 fold, or at least about 20 fold, relative to the number of activated macrophages in a tumor sample obtained from the subject prior to contacting the tumor with the anti-CCR8 antibody. In some aspects, the anti-CCR8 antibody is capable of inducing macrophage-mediated phagocytosis of tumor infiltrating Tregs.

[0198] The anti-CCR8 antibodies described herein are capable of specific binding to human CCR8. In some aspects, the anti-CCR8 antibody binds human CCR8 but does not bind cyno CCR8.

[0199] In some aspects, the anti-CCR8 antibody binds human CCR8 with an equilibrium dissociation constant (KD) of about 100 nM or less. In some aspects, the anti-CCR8 antibody binds human CCR8 with a KD of about 50 nM or less. In some aspects, the anti-CCR8 antibody binds human CCR8 with a KD of about 25 nM or less. In some aspects, the anti-CCR8 antibody binds human CCR8 with a KD of about 20 nM or less. In some aspects, the anti-CCR8 antibody binds human CCR8 with a KD of about 15 nM or less. In some aspects, the anti-CCR8 antibody binds human CCR8 with a KD of about 10 nM or less. In some aspects, the anti-CCR8 antibody binds human CCR8 with a KD of about 5 nM or less. In some aspects, the anti-CCR8 antibody binds human CCR8 with a KD of about 1 nM or less. In some aspects, KD is measured by BIACORE™. In certain aspects, the anti-CCR8 antibody binds human CCR8 with a KD of about 10 nM or less as measured by BIACORE™. In certain aspects, the anti-CCR8 antibody binds human CCR8 with a KD of about 1 nM or less as measured by BIACORE™.

[0200] Inhibition of CCR8 by the antibodies and antigen-binding portions thereof disclosed herein can occur through any mechanism. Without being bound by any particular mechanism, in some aspects, the anti-CCR8 antibody induces internalization of CCR8 by tumorinfiltrating Treg cells. Internalization of the CCR8 receptor from the surface eliminates the ability of the receptor to bind its ligand and potentiate intracellular signaling, effectively inhibiting CCR8 activity in tumor infiltrating Treg cells. In certain aspects, the anti-CCR8 antibody binds CCR8 expressed by tumor infiltrating Treg cells.

[0201] In some aspects, the anti-CCR8 antibody blocks the interaction between CCR8 and its ligand, e.g., through steric hindrance, a confirmation change, internalization of the CCR8 receptor, or any combination thereof. In some aspects, binding of the anti-CCR8 antibody to the N-terminal extracellular domain of CCR8 inhibits the ability of the CCR8 receptor to interact with G-protein, e.g., through a conformational change and / or through internalization of the CCR8 receptor.A. Epitopes

[0202] The antibodies described herein specifically bind the N-terminal extracellular domain of CCR8 or a fragment thereof. The N-terminal extracellular domain of human CCR8 is generally defined as consisting of amino acids 1-35 of the full-length CCR8 sequence (e.g., amino acids 1-35 of SEQ ID NO: 171) (see uniprot.org / uniprot / P51685). The amino acid sequence of the N-terminal extracellular domain of human CCR8 comprises the amino acid sequence MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK (SEQ ID NO: 172).

[0203] In some aspects, the anti-CCR8 antibody binds at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten amino acids within the N-terminal extracellular domain of human CCR8, e.g., as set forth in SEQ ID NO: 172. In some aspects, the at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten amino acids within the N-terminal extracellular domain of human CCR8, e.g., as set forth in SEQ ID NO: 172 are contiguous. In some aspects, the anti-CCR8 antibody binds at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten contiguous amino acids within the N-terminal extracellular domain of human CCR8, e.g., as set forth in SEQ ID NO: 172. In some aspects, the at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten amino acids within the N-terminal extracellular domain of human CCR8, e.g., as set forth in SEQ ID NO: 172 are not contiguous. In some aspects, the anti-CCR8 antibody binds at least one amino acid in the N-terminal extracellular domain ofhuman CCR8 and at least one amino acid of human CCR8 that is not within the N-terminal extracellular domain of human CCR8.

[0204] In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 1-10 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 1-15 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 1-20 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 1-25 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 1-35 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 5-10 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 5-15 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 5-20 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 5-25 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 5-30 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 5-35 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 10-15 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 10-20 of SEQ ID NO: 172. In some aspects, the anti- CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 10-25 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 10-30 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 10-35 ofSEQ ID NO: 172. Tn some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 15-20 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 15-25 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 15-30 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 15-35 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 20-25 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 20-30 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 20-35 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 25-30 of SEQ ID NO: 172. In some aspects, the anti- CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 25-35 of SEQ ID NO: 172. In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8, comprising one or more amino acids selected from amino acid residues 30-35 of SEQ ID NO: 172.

[0205] In some aspects, the anti-CCR8 antibody binds an epitope on human CCR8 comprising an amino acid sequence selected from SEQ ID NOs: 180-200.B. Antibody Sequences

[0206] In some aspects, the anti-CCR8 antibody comprises a whole antibody, e.g., an antibody comprising two light chain polypeptides and two heavy chain polypeptides. In some aspects, the anti-CCR8 antibody comprises a fragment of a whole antibody that retains the ability to bind CCR8. In some aspects, the anti-CCR8 antibody is a single chain antibody. In some aspects, the anti-CCR8 antibody is a single chain Fv fragment (scFv). In some aspects, the anti- CCR8 antibody is an Fd fragment. In some aspects, the anti-CCR8 antibody is an Fab fragment. In some aspects, the anti-CCR8 antibody is an Fab’ fragment. In some aspects, the anti-CCR8 antibody is an F(ab’)2 fragment. In some aspects, the anti-CCR8 antibody is selected from an intrabody, a minibody, a triabody, or a diabody.

[0207] In some aspects, the anti-CCR8 antibody comprises a variable heavy (VH) chain and a variable light (VL) chain. In some aspects, the VH comprises a VH complementaritydetermining region (CDR) 1, a VH CDR2, and a VH CDR3; and the VL comprises a VL CDR1, a VL CDR2, and a VL CDR3. In some aspects, the VH CDR1 comprises the amino acid sequence set forth in Table 2A. In some aspects, the VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 201. In some aspects, the VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 202. In some aspects, the VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 203. In some aspects, the VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 204.Table 2A: VH CDR1 Consensus SequencesNote: amino acid residue listed in parenthesis above (and elsewhere in the present disclosure) designate the amino acid at that particular position in the alternative. For example, Y(Y / A)MH means that the sequence can be either YYMH or YAMH.

[0208] In some aspects, the VH CDR2 comprises the amino acid sequence set forth in Table 2B. In some aspects, the VH CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 205. In some aspects, the VH CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 206. In some aspects, the VH CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 207. In some aspects, the VH CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 208.Table 2B: VH CDR2 Consensus Sequences

[0209] In some aspects, the VH CDR3 comprises the amino acid sequence set forth in Tabic 2C. In some aspects, the VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 209. In some aspects, the VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 210.Table 2C: VH CDR3 Consensus Sequences

[0210] In some aspects, the anti-CCR8 antibody comprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 201, a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 205, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 209. In some aspects, the anti-CCR8 antibody comprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 204, a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 205, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 209. In some aspects, the anti-CCR8 antibody comprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 201, a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 208, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 209. In some aspects, the anti-CCR8 antibody comprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 204, a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 208, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 209. In some aspects, the anti-CCR8 antibody comprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 201, a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 208, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 209. In some aspects, the anti- CCR8 antibody comprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 201 , a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 208, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 209. In some aspects, the anti-CCR8 antibody comprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 202, a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 206, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 210. In some aspects, the anti-CCR8 antibodycomprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 202, a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 207, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 210. In some aspects, the anti-CCR8 antibody comprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 203, a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 206, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 210. In some aspects, the anti-CCR8 antibody comprises a VH CDR1 having the amino acid sequence set forth in SEQ ID NO: 203, a VH CDR2 having the amino acid sequence set forth in SEQ ID NO: 207, and a VH CDR3 having the amino acid sequence set forth in SEQ ID NO: 210.

[0211] In some aspects, the VL CDR1 comprises the amino acid sequence set forth in Table 3A. In some aspects, the VL CDRlcomprises the amino acid sequence set forth in SEQ ID NO: 211. In some aspects, the VL CDR1 comprises the amino acid sequence set forth in SEQ IDNO: 212. In some aspects, the VL CDR1 comprises the amino acid sequence set forth in SEQ IDNO: 213. In some aspects, the VL CDR1 comprises the amino acid sequence set forth in SEQ IDNO: 214. In some aspects, the VL CDR1 comprises the amino acid sequence set forth in SEQ IDNO: 215. In some aspects, the VL CDR1 comprises the amino acid sequence set forth in SEQ IDNO: 216. In some aspects, the VL CDR1 comprises the amino acid sequence set forth in SEQ IDNO: 217. In some aspects, the VL CDR1 comprises the amino acid sequence set forth in SEQ IDNO: 218. In some aspects, the VL CDR1 comprises the amino acid sequence set forth in SEQ IDNO: 219.Table 3A: VL CDR1 Consensus Sequences

[0212] In some aspects, the VL CDR2 comprises the amino acid sequence set forth inTable 3B. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 220. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 221. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 222. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 223. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 224. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 225. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 226. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 227. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 228. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 229. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 230. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 231. In some aspects, the VL CDR2 comprises the amino acid sequence set forth in SEQ IDNO: 232.Table 3B: VL CDR2 Consensus Sequences

[0213] In some aspects, the VL CDR3 comprises the amino acid sequence set forth in Table 3C. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 233. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 234. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 235. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 236. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ IDNO: 236. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ IDNO: 236. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ IDNO: 237. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ IDNO: 238. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ IDNO: 239. In some aspects, the VL CDR3 comprises the amino acid sequence set forth in SEQ IDNO: 240.Table 3C: VL CDR3 Consensus Sequences

[0214] In some aspects, the anti-CCR8 antibody comprises a VL CDR1 having the amino acid sequence set forth in SEQ ID NO: 211, a VL CDR2 having the amino acid sequence set forth in SEQ ID NO: 220, and a VL CDR3 having the amino acid sequence set forth in SEQ ID NO: 233. In some aspects, the anti-CCR8 antibody comprises a VL CDR1 having the amino acid sequence set forth in SEQ ID NO: 212, a VL CDR2 having the amino acid sequence set forth in SEQ ID NO: 221, and a VL CDR3 having the amino acid sequence set forth in SEQ ID NO: 234. In some aspects, the anti-CCR8 antibody comprises a VL CDR1 having the amino acid sequence set forth in SEQ ID NO: 213, a VL CDR2 having the amino acid sequence set forth in SEQ ID NO: 222, and a VL CDR3 having the amino acid sequence set forth in SEQ ID NO: 235. In some aspects, the anti-CCR8 antibody comprises a VL CDR1 having the amino acid sequence set forth in SEQ ID NO: 213, a VL CDR2 having the amino acid sequence set forth in SEQ ID NO: 222, and a VL CDR3 having the amino acid sequence set forth in SEQ ID NO: 236. In some aspects, the anti-CCR8 antibody comprises a VL CDR1 having the amino acid sequence set forth in SEQ ID NO: 213, a VL CDR2 having the amino acid sequence set forth in SEQ ID NO: 223, and a VL CDR3 having the amino acid sequence set forth in SEQ ID NO: 235. In some aspects, the anti- CCR8 antibody comprises a VL CDR1 having the amino acid sequence set forth in SEQ ID NO:213, a VL CDR2 having the amino acid sequence set forth in SEQ ID NO: 223, and a VL CDR3 having the amino acid sequence set forth in SEQ ID NO: 236. In some aspects, the anti-CCR8 antibody comprises a VL CDR1 having the amino acid sequence set forth in SEQ ID NO: 217, a VL CDR2 having the amino acid sequence set forth in SEQ ID NO: 227, and a VL CDR3 having the amino acid sequence set forth in SEQ ID NO: 238. In some aspects, the anti-CCR8 antibody comprises a VL CDR1 having the amino acid sequence set forth in SEQ ID NO: 218, a VL CDR2 having the amino acid sequence set forth in SEQ ID NO: 231, and a VL CDR3 having the amino acid sequence set forth in SEQ ID NO: 239. In some aspects, the anti-CCR8 antibody comprises a VL CDR1 having the amino acid sequence set forth in SEQ ID NO: 219, a VL CDR2 having the amino acid sequence set forth in SEQ ID NO: 232, and a VL CDR3 having the amino acid sequence set forth in SEQ ID NO: 240.

[0215] In some aspects, the VH CDR3 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 7, 17, 27, 37, 47, 57, 67, 77, 87, 97, 107, 117, 127, 137, 147, 157, and 167. In some aspects, the VH CDR2 of the anti- CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 6, 16, 26, 36, 46, 56, 66, 76, 86, 96, 106, 116, 126, 136, 146, 156, and 166. In some aspects, the VH CDR1 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 5, 15, 25, 35, 45, 55, 65, 75, 85, 95, 105, 115, 125, 135, 145, 155, and 165.

[0216] In some aspects, the VH CDR3 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 47, 107, 117, 137, and 147. In some aspects, the VH CDR2 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 46, 106, 116, 136, and 146. In some aspects, the VH CDR1 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 45, 105, 115, 135, and 145.

[0217] In some aspects, the VH CDR3 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 7, 17, 27, 37, 57, 67, 77, 87, 97, 127, 157, and 167. In some aspects, the VH CDR2of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 6, 16, 26, 36, 56, 66, 76, 86, 96, 126, 156, and 166. In some aspects, the VH CDR2 of the anti-CCR8antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 5, 15, 25, 35, 55, 65, 75, 85, 95, 125, 155, and 165.

[0218] In some aspects, the VL CDR3 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, and 170. In some aspects, the VL CDR2 of the anti- CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 9, 19, 29, 39, 49, 59, 69, 79, 89, 99, 109, 119, 129, 139, 149, 159, and 169. In some aspects, the VL CDR1 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 8, 18, 28, 38, 48, 58, 68, 78, 88, 98, 108, 118, 128, 138, 148, 158, and 168.

[0219] In some aspects, the VL CDR3 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 50, 110, 120, 140, and 150. In some aspects, the VL CDR2 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 49, 109, 119, 139, and 149. In some aspects, the VL CDR1 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 48, 108, 118, 138, and 148.

[0220] In some aspects, the VL CDR3 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 10, 20, 30, 40, 60, 70, 80, 90, 100, 130, 160, and 170. In some aspects, the VL CDR2 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 9, 19, 29, 39, 59, 69, 79, 89, 99, 129, 159, and 169. In some aspects, the VL CDR2 of the anti-CCR8 antibody comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 8, 18, 28, 38, 58, 68, 78, 88, 98, 128, 158, and 168.

[0221] In some aspects the anti-CCR8 antibody comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0222] In some aspects the anti-CCR8 antibody comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 105, a VH CDR2 comprising the amino acidsequence set forth in SEQ ID NO: 106, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 108, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 109, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 110.

[0223] In some aspects the anti-CCR8 antibody comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 115, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 116, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 117, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 118, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 119, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 120.

[0224] In some aspects the anti-CCR8 antibody comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140.

[0225] In some aspects the anti-CCR8 antibody comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 145, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 147, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 148, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 149, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 150.

[0226] In some aspects the anti-CCR8 antibody comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 125, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 126, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 127, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 128, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 129, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130.

[0227] In some aspects, the VH chain comprises an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to an amino acid selectedfrom SEQ ID NOs: 41 , 101 , 11 1 , 121 , 131 , and 141. In some aspects, the VH chain comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 41, 101, 111, 121, 131, and 141. In some aspects, the VL chain comprises an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to an amino acid selected from SEQ ID NOs: 43, 103, 113, 123, 133, and 143. In some aspects, the VL chain comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 43, 103, 113, 123, 133, and 143. In some aspects, the VH chain comprises an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to an amino acid selected from SEQ ID NOs: 41, 101, 111, 121, 131, and 141; and the VL chain comprises an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to an amino acid selected from SEQ ID NOs: 43, 103, 113, 123, 133, and 143; wherein the anti-CCR8 antibody does not bind cyno CCR8. In some aspects, the VH chain comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 41, 101, 111, 121, 131, and 141; and the VL chain comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 43, 103, 113, 123, 133, and 143; wherein the anti-CCR8 antibody does not bind cyno CCR8.

[0228] In some aspects, the anti-CCR8 antibody comprises a VH chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 41 and a VL chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 43; wherein the anti-CCR8 antibody does not bind cyno CCR8. In some aspects, the anti-CCR8 antibody comprises a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 41 and a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 43; wherein the anti-CCR8 antibody does not bind cyno CCR8.

[0229] In some aspects, the anti-CCR8 antibody comprises a VH chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 101 and a VL chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 103; wherein the anti-CCR8 antibody does not bind cyno CCR8. In some aspects, the anti-CCR8 antibody comprises a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 101 and a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 103; wherein the anti-CCR8 antibody does not bind cyno CCR8.

[0230] In some aspects, the anti-CCR8 antibody comprises a VH chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 111 and a VL chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 113; wherein the anti-CCR8 antibody does not bind cyno CCR8. In some aspects, the anti-CCR8 antibody comprises a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 111 and a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 113; wherein the anti-CCR8 antibody does not bind cyno CCR8.

[0231] In some aspects, the anti-CCR8 antibody comprises a VH chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 131 and a VL chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 133; wherein the anti-CCR8 antibody does not bind cyno CCR8. In some aspects, the anti-CCR8 antibody comprises a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 131 and a VLchain comprising the amino acid sequence set forth in SEQ ID NO: 133; wherein the anti-CCR8 antibody docs not bind cyno CCR8.

[0232] In some aspects, the anti-CCR8 antibody comprises a VH chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 141 and a VL chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 143; wherein the anti-CCR8 antibody does not bind cyno CCR8. In some aspects, the anti-CCR8 antibody comprises a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 141 and a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 143; wherein the anti-CCR8 antibody does not bind cyno CCR8.

[0233] In some aspects, the anti-CCR8 antibody comprises a VH chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 121 and a VL chain comprising an amino acid sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 123; wherein the anti-CCR8 antibody binds human CCR8 and cyno CCR8. In some aspects, the anti-CCR8 antibody comprises a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 121 and a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 123; wherein the anti-CCR8 antibody binds human CCR8 and cyno CCR8.

[0234] In some aspects, the anti-CCR8 antibody is a human antibody. In some aspects, the anti-CCR8 antibody is a humanized antibody. In some aspects, the anti-CCR8 is a chimeric antibody.

[0235] In some aspects, the anti-CCR8 antibody is selected from the group consisting of an IgGl, an IgG2, an IgG3, an IgG4, an IgM, an IgAl an IgA2, an IgD, and an IgE antibody. In some aspects, the anti-CCR8 antibody is an IgGl antibody. In some aspects, the anti-CCR8 antibody is an IgG4 antibody. In some aspects, the anti-CCR8 antibody comprises a wild typeIgGl heavy chain constant region. In some aspects, the anti-CCR8 antibody comprises a wild type IgG4 heavy chain constant region. In some aspects, the anti-CCR8 antibody comprises an Fc domain comprising at least one mutation. In some aspects, the anti-CCR8 antibody comprises a mutant IgGl heavy chain constant region. In some aspects, the anti-CCR8 antibody comprises a mutant IgG4 heavy chain constant region. In some aspects, the mutant IgG4 heavy chain constant region comprises any one of the substitutions S228P, L235E, L235A, or a combination thereof, according to EU numbering.

[0236] In some aspects, the disclosure provides an antibody or antigen-binding portion thereof that binds to substantially the same epitope on human CCR8 as the anti-CCR8 antibody according to any one of the aforementioned aspects. In some aspects, the disclosure provides an antibody or antigen-binding portion thereof that cross-competes for binding to human CCR8 as the anti-CCR8 antibody according to any one of the aforementioned aspects.

[0237] In some aspects, the anti-CCR8 antibody comprises an altered heavy chain constant region that has modified effector function relative to its corresponding unaltered constant region. Effector functions involving the constant region of the anti-CCR8 antibody may be modulated by altering properties of the constant or Fc region. Altered effector functions include, for example, a modulation in one or more of the following activities: ADCC, ADCP, complement-dependent cytotoxicity (CDC), apoptosis, binding to one or more Fc-receptors, and pro-inflammatory responses. Modulation refers to an increase, decrease, or elimination of an effector function activity exhibited by a subject antibody containing an altered constant region as compared to the activity of the unaltered form of the constant region. In particular aspects, modulation includes situations in which an activity is abolished or completely absent.

[0238] In one aspect, the anti-CCR8 antibody comprises an IgG4 heavy chain constant region. In one aspect, the IgG4 heavy chain constant region is a wild type IgG4 heavy chain constant region. In another aspect, the IgG4 constant region comprises a mutation, e.g., one or both of S228P and L235E or L235A, e.g., according to EU numbering (Kabat, E.A., et al., supra). In one aspect, the anti-CCR8 antibody described herein comprises an IgGl constant region. In one aspect, the IgGl heavy chain constant region is a wild type IgGl heavy chain constant region. In another aspect, the IgGl heavy chain constant region comprises a mutation.

[0239] An altered constant region with altered FcR binding affinity and / or ADCC activity and / or ADCP activity and / or altered CDC activity is a polypeptide that has either an enhanced ordiminished FcR binding activity and / or ADCC activity and / or ADCP activity and / or CDC activity compared to the unaltered form of the constant region. An altered constant region that displays increased binding to an FcR binds at least one FcR with greater affinity than the unaltered polypeptide. An altered constant region that displays decreased binding to an FcR binds at least one FcR with lower affinity than the unaltered form of the constant region. Such variants which display decreased binding to an FcR may possess little or no appreciable binding to an FcR, e.g., 0 to 50% (e.g., less than 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%) of the binding to the FcR as compared to the level of binding of a native sequence immunoglobulin constant or Fc region to the FcR. Similarly, an altered constant region that displays modulated ADCC and / or ADCP activity and / or CDC activity may exhibit either increased or reduced ADCC and / or ADCP and / or CDC activity compared to the unaltered constant region.

[0240] In some aspects, the anti-CCR8 antibody exhibits increased effector function. In some aspects, an anti-CCR8 antibody comprises a hybrid constant region, or a portion thereof, such as a G2 / G4 hybrid constant region (see e.g., Burton et al. (1992) Advlmmun 51:1-18; Canfield et al. (1991) J Exp Med 173:1483-1491; and Mueller et al. (1997) Mol Immunol 34(6):441-452).

[0241] In some aspects, the anti-CCR8 antibody comprises an altered constant region exhibiting enhanced CDC. Modulated CDC activity may be achieved by introducing one or more amino acid substitutions, insertions, or deletions in an Fc region of the antibody. See, e.g., U.S. patent no. 6,194,551. Alternatively, or additionally, cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region. The homodimeric antibody thus generated may have improved internalization capability and / or increased complement-mediated cell killing. See, e.g., Caron et al. (1992) J Exp Med 176:1191-1195 and Shopes (1992) Immunol 148:2918-2922; PCT publication nos. WO 99 / 51642 and WO 94 / 29351; Duncan and Winter (1988) Nature 322:738-40; and U.S. Patent Nos. 5,648,260 and 5,624,821.

[0242] In some aspects, the anti-CCR8 antibody is a bispecific antibody, a T cell engager (TCE), a bispecific T cell engager (BiTE), a multispecific antibody, a biparatopic antibody, an immunoconjugate, an antibody drug conjugate, or any combination thereof.C. Antibody Variants and Immunoconjugates

[0243] Certain aspects of the present disclosure are directed to antibodies comprising a first antigen-binding region that binds to human CCR8 and a second antigen-binding region thatbinds a second antigen, wherein the first antigen-binding region comprises an anti-CCR8 antibody described herein. In some aspects, the antibody is a bispccific antibody, e.g., capable of binding only two antigens. In some aspects, the antibody is a multispecific antibody, e.g., capable of binding more than two antigens. In some aspects, the multispecific antibody is capable of binding at least about 3 antigens, at least about 4 antigens, at least about 5 antigens, or at least about 6 antigens.

[0244] In some aspects, the antibody is a biparatopic antibody. Biparatopic antibodies are capable of binding two epitopes on a single polypeptide target. In some aspects, the biparatopic antibody comprises a first antigen-binding region and a second antigen-binding region, wherein the first antigen-binding region and / or the second antigen-binding region comprises an anti-CCR8 antibody disclosed herein.

[0245] In some aspects, the antibody is a T cell engager (TCE). TCE constructs comprise a first antigen-binding region that binds a receptor on T cells and a second antigen- specific binding region. In some aspects, the TCE comprises a first antigen-binding region that binds 4-1BB. In some aspects, the TCE comprises a first antigen-binding region that binds CD28. In some aspects, the TCE comprises a second antigen-binding region that binds human CCR8, wherein the second antigen-binding region comprises an anti-CCR8 antibody disclosed herein.

[0246] In some aspects, the multispecific antibody is a bispecific T cell engager (BiTE). BiTE constructs comprise a first antigen-binding region that binds CD3 receptor on T cell and a second antigen- specific binding region. In some aspects, the BiTE comprises a first antigenbinding region that binds CD3 and a second antigen-binding region that binds human CCR8, wherein the second antigen-binding region comprises an anti-CCR8 antibody disclosed herein.

[0247] In some aspects, the bispecific antibody, the multispecific antibody, the TCE, the BiTE, or the biparatopic antibody comprises a first VH CDR1, a first VH CDR2, and a first VH CDR3; a first VL domain, comprising a first VL CDR1, a first VL CDR2, and a first VL CDR3; a second VH domain, comprising a second VH CDR1, a second VH CDR2, and a second VH CDR3; and a second VL domain, comprising a second VL CDR1, a second VL CDR2, and a second VL CDR3; wherein (a) the first VH CDR1 comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 45, 105, 115, 125, 135, and 145; (b) the first VH CDR2 comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 46, 106, 116, 126, 136, and 146; and (c) the first VH CDR3 comprises an amino acidsequence selected from the amino acid sequence set forth in SEQ ID NOs: 47, 107, 117, 127, 137, and 147. In some aspects, the first VL CDR1 comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 48, 108, 118, 128, 138, and 148; (b) the first VL CDR2 comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 49, 109, 119, 129, 139, and 149; and (c) the first VL CDR3 comprises an amino acid sequence selected from the amino acid sequence set forth in SEQ ID NOs: 50, 110, 120, 130, 140, and 150.

[0248] Certain aspects of the present disclosure are directed to an immunoconjugate comprising an anti-CCR8 antibody disclosed herein. In some aspects, the immunoconjugate is an antibody-drug conjugate. The immunoconjugate can include any cytotoxic agent known in the art linked to an anti-CCR8 antibody disclosed herein. In some aspects, the antibody-drug conjugate comprises a cytotoxic agent selected from the group consisting of a maytansinoid (e.g., maytansine), a dolastatin, an auristatin drug analogue, cryptophycin, a duocarmycin deriative (e.g., a CC-1065 analog and duocarmycin), an enediyne antibiotic (e.g., esperamicin and calicheamicin), pyrolobenodiazepine (PBD), and any combination thereof. An antibody-drug conjugate comprising an anti-CCR8 antibody and a cytotoxic agent may allow efficacy in tumor indications with low numbers of effector cells, including NK cells and macrophages.D. Fc region variants

[0249] In certain embodiments, one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.

[0250] In certain embodiments, the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody in vivo is important yet certain effector functions (such as complement, ADCP and ADCC) are unnecessary or deleterious. In vitro and / or in vivo cytotoxicity assays can be conducted to confirm the reduction / depletion of CDC, ADCP and / or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas16monocytes express FcyRl, FcyRII and FcyRIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravctch and Kinct, Annu. Rev. Immunol. 9:457-492 (1991). Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Patent No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat’l Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc. Nat’l Acad. Sci. USA 82:1499-1502 (1985); 5,821,337 (see Bruggemann, M. et al., J. Exp. Med. 166:1351-1361 (1987)). Alternatively, nonradioactive assays methods may be employed (see, for example, ACTI™ non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, CA; and CytoTox 96® non-radioactive cytotoxicity assay (Promega, Madison, WI). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat’l Acad. Sci. USA 95:652- 656 (1998). Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity. See, e.g., Clq and C3c binding ELISA in WO 2006 / 029879 and WO 2005 / 100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996); Cragg, M.S. et al., Blood 101:1045-1052 (2003); and Cragg, M.S. and M.J. Glennie, Blood 103:2738- 2743 (2004)). FcRn binding and in vivo clearance / half-life determinations can also be performed using methods known in the art (see, e.g., Petkova, S.B. et al., Int’l. Immunol. 18(12): 1759- 1769 (2006)).

[0251] Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581).

[0252] Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Patent No. 6,737,056; WO 2004 / 056312, and Shields et al., J. Biol. Chem. 9(2): 6591-6604 (2001).)

[0253] In certain embodiments, an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and / or 334 of the Fc region (EU numbering of residues).

[0254] In some embodiments, alterations are made in the Fc region that result in altered (i.c., cither improved or diminished) Clq binding and / or Complement Dependent Cytotoxicity (CDC), e.g., as described in US Patent No. 6,194,551, WO 99 / 51642, and Idusogie et al. J. Immunol. 164: 4178-4184 (2000).

[0255] Antibodies with increased half-lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in US2005 / 0014934A1 (Hinton et al.). Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 252, 254, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (e.g., US Patent No. 7,371,826).

[0256] See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Patent No. 5,648,260; U.S. Patent No. 5,624,821; and WO 94 / 29351 concerning other examples of Fc region valiants.

[0257] In some embodiments, an antibody is provided, wherein the isotype is human IgGl . In some embodiments, an antibody is provided, wherein the isotype is human IgG4. In some embodiments, an antibody is provided, wherein the isotype is human IgG4, wherein there is a single mutation at serine 228 to proline (S228P). In some embodiments, an antibody is provided, wherein the isotype is human IgG4, wherein there are two mutations at serine 228 to proline (S228P) and leucine 235 to glutamate (L235E). The S228P mutation occurs at position 228 in the literature, however the exact location of a mutation in an antibody may vary depending on how such antibody is produced.E. Chimeric Antigen Receptors (CAR) and T Cell Receptors (TCR)

[0258] Certain aspects of the present disclosure are directed to a chimeric antigen receptor (CAR) comprising an antigen-binding region that specifically binds the N-terminal extracellular domain of human CCR8. In some aspects, the antigen-binding region comprises an anti-CCR8 antibody disclosed herein or an antibody or antigen-binding fragment thereof that binds the same epitope as an anti-CCR8 antibody disclosed herein. In some aspects, the CAR further comprises a transmembrane domain. In some aspects, the CAR further comprises an intracellular signaling domain. In some aspects, the CAR further comprises a hinge region and / or a spacer region.

[0259] Certain aspects of the present disclosure are directed to a T cell receptor (TCT) comprising an antigen-binding region that specifically binds the N-tcrminal extracellular domain of human CCR8. In some aspects, the antigen-binding region comprises an anti-CCR8 antibody disclosed herein or an antibody or antigen-binding fragment thereof that binds the same epitope as an anti-CCR8 antibody disclosed herein. In some aspects, the TCR further comprises a transmembrane domain. In some aspects, the TCR further comprises an intracellular signaling domain.F. Nucleic Acid Molecules, Vectors, and Cells

[0260] Certain aspects of the present disclosure are directed to nucleic acid molecules that encode the anti-CCR8 antibodies disclosed herein. The nucleic acids can be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form. A nucleic acid is "isolated" or "rendered substantially pure" when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids (e.g., other chromosomal DNA, e.g., the chromosomal DNA that is linked to the isolated DNA in nature) or proteins, by standard techniques, including alkaline / SDS treatment, CsCl banding, column chromatography, restriction enzymes, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et al., ed. (1987) Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York. A nucleic acid described herein can be, for example, DNA or RNA and can or cannot contain intronic sequences. In some embodiments, the nucleic acid is a cDNA molecule.

[0261] Nucleic acids described herein can be obtained using standard molecular' biology techniques. For antibodies expressed by hybridomas (e.g., hybridomas prepared from transgenic mice carrying human immunoglobulin genes as described further below), cDNAs encoding the light and heavy chains of the antibody made by the hybridoma can be obtained by standard PCR amplification or cDNA cloning techniques. For antibodies obtained from an immunoglobulin gene library (e.g., using phage display techniques), nucleic acid encoding the antibody can be recovered from the library.

[0262] In some aspects, the nucleic acids can further encode a signal peptide.

[0263] The nucleic acid molecules described herein may be modified to delete specific sequences, e.g., restriction enzyme recognition sequences, or to optimize codons.

[0264] A method for making the anti-CCR8 antibody disclosed herein can comprise expressing the heavy chain and the light chains in a cell line comprising the nucleotide sequencesencoding the heavy and light chains with a signal peptide. Host cells comprising these nucleotide sequences arc encompassed herein.

[0265] Once DNA fragments encoding VH and VL segments arc obtained, these DNA fragments can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full-length antibody chain genes, to Fab fragment genes or to a scFv gene. In these manipulations, a VL- or VH-encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as an antibody constant region or a flexible linker. The term "operatively linked," as used in this context, is intended to mean that the two DNA fragments are joined such that the amino acid sequences encoded by the two DNA fragments remain in-frame.

[0266] The isolated DNA encoding the VH region can be converted to a full-length heavy chain gene by operatively linking the VH-encoding DNA to another DNA molecule encoding heavy chain constant regions (hinge, CHI, CH2, and / or CH3). The sequences of human heavy chain constant region genes are known in the ail (see, e.g., Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification. The heavy chain constant region can be an IgGl, IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD constant region, for example, an IgGl region. For a Fab fragment heavy chain gene, the VH-encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CHI constant region.

[0267] The isolated DNA encoding the VL region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the VL-encoding DNA to another DNA molecule encoding the light chain constant region, CL. The sequences of human light chain constant region genes are known in the art (see, e.g., Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification. The light chain constant region can be a kappa or lambda constant region.

[0268] To create a scFv gene, the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly4-Ser)3, such that the VH and VL sequences can be expressed as a contiguous single-chainprotein, with the VL and VH regions joined by the flexible linker (see, e.g., Bird et al., (1988) Science 242:423-426; Huston ct al., (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., (1990) Nature 348:552-554).

[0269] Also provided herein are nucleic acid molecules encoding VH and VL sequences that are homologous to those of the anti-CCR8 antibodies disclosed herein. Exemplary nucleic acid molecules encode VH and VL sequences that are at least 70% identical, for example, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical, to nucleic acid molecules encoding the VH and VL sequences disclosed herein. Also provided herein are nucleic acid molecules with conservative substitutions (i.e., substitutions that do not alter the resulting amino acid sequence upon translation of nucleic acid molecule), e.g., for codon optimization.

[0270] Also provided are nucleic acids encoding the VH and / or VL regions of anti-CCR8 antibodies, such as the anti-CCR8 antibodies described herein, which nucleic acids comprise a nucleotide sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to any of the nucleotide sequences encoding the VH and / or VL regions of anti-CCR8 antibodies described herein.

[0271] Also provided are nucleic acids encoding the heavy chain and / or the light chain of anti-CCR8 antibodies, such as the anti-CCR8 antibodies described herein, which nucleic acids comprise a nucleotide sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to any of the nucleotide sequences encoding the heavy and / or light chains of anti- CCR8 antibodies described herein.

[0272] Certain aspects of the present disclosure are directed to vectors comprising a nucleic acid molecule disclosed herein. In some aspects, the vector is selected from a viral vector, a mammalian vector, and a bacterial vector. In some aspects, the vector is a viral particle or a virus. In some aspects, the vector is a mammalian vector. In some aspects, the vector is a bacterial vector.

[0273] In certain aspects, the viral vector is a retroviral vector. In some aspects, the viral vector is selected from the group consisting of an adenoviral vector, a lentivirus, a Sendai virus, a baculoviral vector, an Epstein Barr viral vector, a papovaviral vector, a vaccinia viral vector, a herpes simplex viral vector, and an adeno associated virus (AAV) vector. In particular aspects, the vector is an AAV vector. In some aspects, the vector is a lentivirus. In particular aspects, the vector is an AAV vector. In some aspects, the vector is a Sendai virus. In some aspects, the vector is ahybrid vector. Examples of hybrid vectors that can be used in the present disclosure can be found in Huang and Kamihira, Biotechnol. Adv. 31(2):208-23 (2103), which is incorporated by reference herein in its entirety.

[0274] In some aspects, the vector further comprises one or more regulatory elements, including but not limited to one or more enhancers, promoters, miRNA binding sequences, polyA sequences, intronic sequences, splice acceptor sites, and any combination thereof. In some aspects, the vector comprises a tissue specific enhancer. In some aspects, the vector comprises a tissue specific promoter.

[0275] Certain aspects of the present disclosure are directed to cells, e.g., host cells, comprising an anti-CCR8 antibody disclosed herein, a bispecific antibody disclosed herein, a TCE disclosed herein, a BiTE disclosed herein, a multispecific antibody disclosed herein, a biparatopic antibody disclosed herein, a CAR disclosed herein, a TCR disclosed herein, a nucleic acid molecule disclosed herein, or a vector disclosed herein. The cell can be any type of cell. In some aspects, the cell is selected from a mammalian cell, a bacterial cell, an insect cell, a plant cell, and a yeast cell. In some aspects, the cell is selected from the group consisting of an E. coli cell, a fungi such as Saccharomyces cerevisiae and Pichia pastoris, an insect cell such as SF9, a mammalian cell lines (e.g., human cell lines), and a primary cell line.

[0276] In some aspects, the cell is an immune cell. In some aspects, the cell is a T cell. As such, certain aspects of the present disclosure are directed to an immune cell, e.g., a T cell, comprising a CAR or a TCR disclosed herein.G. Pharmaceutical Compositions

[0277] In certain aspects, the disclosure provides for a pharmaceutical composition comprising an anti-CCR8 antibody with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and / or adjuvant.

[0278] In certain aspects, acceptable formulation materials preferably are nontoxic to recipients at the dosages and concentrations employed. In certain aspects, the formulation material(s) are for s.c. and / or I.V. administration. In certain aspects, the pharmaceutical composition can contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolality, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition. In certain aspects, suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine,asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen- sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta- cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents; hydrophilic polymers (such as polyvinylpyrrolidone); low molecular weight polypeptides; salt-forming counterions (such as sodium); preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); solvents (such as glycerin, propylene glycol or polyethylene glycol); sugar alcohols (such as mannitol or sorbitol); suspending agents; surfactants or wetting agents (such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate 80, triton, tromethamine, lecithin, cholesterol, tyloxapal); stability enhancing agents (such as sucrose or sorbitol); tonicity enhancing agents (such as alkali metal halides, preferably sodium or potassium chloride, mannitol sorbitol); delivery vehicles; diluents; excipients and / or pharmaceutical adjuvants. (Remington's Pharmaceutical Sciences, 18th Edition, A. R. Gennaro, ed., Mack Publishing Company (1995). In certain aspects, the formulation comprises PBS; 20 mM NaOAC, pH 5.2, 50 mM NaCl; and / or 10 mM NAOAC, pH 5.2, 9% Sucrose. In certain aspects, the optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, Remington's Pharmaceutical Sciences, supra. In certain aspects, such compositions may influence the physical state, stability, rate of in vivo release and / or rate of in vivo clearance of the anti-CCR8 antibody.

[0279] In certain aspects, the primary vehicle or carrier in a pharmaceutical composition can be either aqueous or non-aqueous in nature. For example, in certain aspects, a suitable vehicle or carrier can be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration. In certain aspects, the saline comprises isotonic phosphate-buffered saline. In certain aspects, neutral buffered saline or saline mixed with senrm albumin arc further exemplary vehicles. In certain aspects, pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5, which can further include sorbitol or a suitable substitute thereof. In certain aspects, a composition comprising an anti-CCR8 antibody can be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution. Further, in certain aspects, a composition comprising an anti-CCR8 antibody can be formulated as a lyophilizate using appropriate excipients such as sucrose.

[0280] In certain aspects, the pharmaceutical composition can be selected for parenteral delivery. In certain aspects, the compositions can be selected for inhalation or for delivery through the digestive tract, such as orally. The preparation of such pharmaceutically acceptable compositions is within the ability of one skilled in the art.

[0281] In certain aspects, the formulation components are present in concentrations that are acceptable to the site of administration. In certain aspects, buffers are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.

[0282] In certain aspects, when parenteral administration is contemplated, a therapeutic composition can be in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising an anti-CCR8 antibody, in a pharmaceutically acceptable vehicle. In certain aspects, a vehicle for parenteral injection is sterile distilled water in which an anti-CCR8 antibody is formulated as a sterile, isotonic solution, and properly preserved. In certain aspects, the preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection. In certain aspects, hyaluronic acid can also be used, and can have the effect of promoting sustained duration in the circulation. In certain aspects, implantable drug delivery devices can be used to introduce the desired molecule.

[0283] In certain aspects, a pharmaceutical composition can be formulated for inhalation. In certain aspects, an anti-CCR8 antibody can be formulated as a dry powder for inhalation. In certain aspects, an inhalation solution comprising an anti-CCR8 antibody can be formulated with a propellant for aerosol delivery. In certain aspects, solutions can be nebulized. Pulmonary administration is further described in PCT application No. PCT / US94 / 001875, which describes pulmonary delivery of chemically modified proteins.

[0284] In certain aspects, it is contemplated that formulations can be administered orally. In certain aspects, an anti-CCR8 antibody that is administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules. In certain aspects, a capsule can be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and presystemic degradation is minimized. In certain aspects, at least one additional agent can be included to facilitate absorption of an anti-CCR8 antibody. In certain aspects, diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders can also be employed.

[0285] In certain aspects, a pharmaceutical composition can involve an effective quantity of an anti-CCR8 antibody in a mixture with non-toxic excipients that are suitable for the manufacture of tablets. In certain aspects, by dissolving the tablets in sterile water, or another appropriate vehicle, solutions can be prepared in unit-dose form. In certain aspects, suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.

[0286] Additional pharmaceutical compositions will be evident to those skilled in the art, including formulations involving an anti-CCR8 antibody in sustained- or controlled-delivery formulations. In certain aspects, techniques for formulating a variety of other sustained- or controlled-delivery means, such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art. See for example, PCT Application No. PCT / US93 / 00829, which describes the controlled release of porous polymeric microparticles for the delivery of pharmaceutical compositions. In certain aspects, sustained-release preparations can include semipermeable polymer matrices in the form of shaped articles, e.g. films, or microcapsules. Sustained release matrices can include polyesters, hydrogels, polylactides (U.S. Pat. No. 3,773,919 and EP 058,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., Biopolymers, 22:547-556 (1983)), poly (2-hydroxyethyl-methacrylate) (Langer et al., J. Biomed. Mater. Res., 15: 167-277 (1981) and Langer, Chem. Tech., 12:98- 105 (1982)), ethylene vinyl acetate (Langer et al., supra) or poly-D(-)-3-hydroxybutyric acid (EP 133,988). In certain aspects, sustained release compositions can also include liposomes, which can be preparedby any of several methods known in the art. See, e.g., Eppstein et al, Proc. Natl. Acad. Sci. USA, 82:3688-3692 (1985); EP 036,676; EP 088,046 and EP 143,949.

[0287] The pharmaceutical composition to be used for in vivo administration typically is sterile. In certain aspects, this can be accomplished by filtration through sterile filtration membranes. In certain aspects, where the composition is lyophilized, sterilization using this method can be conducted either prior to or following lyophilization and reconstitution. In certain aspects, the composition for parenteral administration can be stored in lyophilized form or in a solution. In certain aspects, parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.

[0288] In certain aspects, once the pharmaceutical composition has been formulated, it can be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder. In certain aspects, such formulations can be stored either in a ready-to-use form or in a form (e.g., lyophilized) that is reconstituted prior to administration.

[0289] In certain aspects, kits are provided for producing a single-dose administration unit. In certain aspects, the kit can contain both a first container having a dried protein and a second container having an aqueous formulation. In certain aspects, kits containing single and multichambered pre-filled syringes (e.g., liquid syringes and lyosyringes) are included.

[0290] In certain aspects, the effective amount of a pharmaceutical composition comprising an anti-CCR8 antibody to be employed therapeutically will depend, for example, upon the therapeutic context and objectives. One skilled in the art will appreciate that the appropriate dosage levels for treatment, according to certain aspects, will thus vary depending, in pail, upon the molecule delivered, the indication for which an anti-CCR8 antibody is being used, the route of administration, and the size (body weight, body surface or organ size) and / or condition (the age and general health) of the patient. In certain aspects, the clinician can titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.

[0291] In certain aspects, the frequency of dosing will take into account the pharmacokinetic parameters of an anti-CCR8 antibody in the formulation used. In certain aspects, a clinician will administer the composition until a dosage is reached that achieves the desired effect. In certain aspects, the composition can therefore be administered as a single dose or as two or more doses (which may or may not contain the same amount of the desired molecule) over time,or as a continuous infusion via an implantation device or catheter. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them. In certain aspects, appropriate dosages can be ascertained through use of appropriate dose-response data.

[0292] In certain aspects, the route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, subcutaneously, intraocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices. In certain aspects, the compositions can be administered by bolus injection or continuously by infusion, or by implantation device. In certain aspects, individual elements of the combination therapy may be administered by different routes.

[0293] In certain aspects, the composition can be administered locally via implantation of a membrane, sponge or another appropriate material onto which the desired molecule has been absorbed or encapsulated. In certain aspects, where an implantation device is used, the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration. In certain aspects, it can be desirable to use a pharmaceutical composition comprising an anti-CCR8 antibody in an ex vivo manner. In such instances, cells, tissues and / or organs that have been removed from the patient are exposed to a pharmaceutical composition comprising an anti-CCR8 antibody after which the cells, tissues and / or organs are subsequently implanted back into the patient.

[0294] In certain aspects, an anti-CCR8 antibody can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptides. In certain aspects, such cells can be animal or human cells, and can be autologous, heterologous, or xenogeneic. In certain aspects, the cells can be immortalized. In certain aspects, in order to decrease the chance of an immunological response, the cells can be encapsulated to avoid infiltration of surrounding tissues. In certain aspects, the encapsulation materials a e typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.III. Methods of the Disclosure

[0295] Certain aspects of the present disclosure are directed to methods of making and / or using the anti-CCR8 antibodies disclosed herein.A. Methods of Use

[0296] In some aspects, the present disclosure includes a method of increasing a concentration of one or more cytokines in a subject comprising administering to the subject a first treatment regimen comprising an anti-CCR8 antibody, or an antigen-binding portion thereof, or a second treatment regimen comprising the anti-CCR8 antibody or antigen-binding portion thereof and toripalimab.

[0297] In some aspects, the method increases a concentration of one or more cytokines in a subject relative to the concentration of the one or more cytokines prior to administration of the first treatment regimen. In some aspects, the method increases a concentration of one or more cytokines by at least about 5%, at least about 10%, at least about 12%, at least about 15%, at least about 18%, at least about 20%, at least about 23%, at least about 25%, at least about 27%, at least about 30%, at least about 32%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, or at least about 75%, relative to the concentration of the one or more cytokines prior to the administration. In some aspects, the method increases a concentration of one or more cytokines by at least about 1.1 fold, at least about 1.2 fold, at least about 1.3 fold, at least about 1.4 fold, at least about 1.5 fold, at least about 2 fold, at least about 2.5 fold, at least about 3 fold, at least about 3.5 fold, at least about 4 fold, at least about 4.5 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, at least about 10 fold, at least about 15 fold, or at least about 20 fold, relative to the concentration of the one or more cytokines prior to administration of the first treatment regimen. In some aspects, the one or more cytokines are selected from IFN-y, TNFa, CXCL10, IL- 12 / IL-23p40, M-CSF- 1 , IL- 1 a, IL-27, VCAM-1 , IL-lp, MlP-ly, IL-2, Eotaxin, IL- 18, Granzyme B, and MIPIb.

[0298] In some aspects, the present disclosure includes a method for treating a subject having a tumor or a cancer comprising a) collecting a baseline blood sample from the subject prior to administering a dose of an anti-CCR8 antibody, or antigen-binding portion thereof, to the subject, b) administering at least one dose of the anti-CCR8 antibody, or antigen-binding portion thereof, to the subject for a treatment cycle, c) collecting a post-dose blood sample from the subjectduring or after the treatment cycle of the at least one dose of the anti-CCR8 antibody, or antigenbinding portion thereof, d) measuring a concentration for one or more cytokines in each of the baseline and post-dose blood samples, and e) treating the subject with a first treatment regimen comprising administering the anti-CCR8 antibody or antigen-binding portion thereof, if the postdose concentration is greater than the baseline concentration or treating the subject with a second treatment regimen comprising the anti-CCR8 antibody, or antigen-binding portion thereof, and toripalimab, if the post-dose concentration is equal to or less than the baseline concentration.

[0299] Cytokine concentration can be determined by any method known in the art. In some aspects, the concentration is measured by ELISA.

[0300] In some aspects, the present disclosure includes a method of increasing a frequency of one or more cell surface markers in a tumor or a cell population of a subject comprising administering to the subject a first treatment regimen comprising an anti-CCR8 antibody, or an antigen-binding portion thereof, or a second treatment regimen comprising the anti-CCR8 antibody or antigen-binding portion thereof and toripalimab. In certain aspects, the method increases the frequency of one or more cell surface markers among a specified cell population.

[0301] In some aspects, the method increases a frequency of one or more cell surface markers in a subject relative to the frequency of the one or more cell surface markers prior to administration of the first treatment regimen. In some aspects, the method increases a frequency of one or more cell surface markers by at least about 5%, at least about 10%, at least about 12%, at least about 15%, at least about 18%, at least about 20%, at least about 23%, at least about 25%, at least about 27%, at least about 30%, at least about 32%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, or at least about 75%, relative to the frequency of the one or more cell surface markers prior to the administration. In some aspects, the method increases a frequency of one or more cell surface markers by at least about 1.1 fold, at least about 1.2 fold, at least about 1.3 fold, at least about 1.4 fold, at least about 1.5 fold, at least about 2 fold, at least about 2.5 fold, at least about 3 fold, at least about 3.5 fold, at least about 4 fold, at least about 4.5 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, at least about 10 fold, at least about 15 fold, or at least about 20 fold, relative to the frequency of the one or more cell surface markers prior to administration of the first treatment regimen. In some aspects,the one or more cell surface markers are selected from 4-1BB, CD25, CD107A, B7-H3, CD83, CD86, HLA-DR, CD40, and a combination thereof.

[0302] In some aspects, the specified cell population is NK cells. In some aspects, the method increases a frequency of 4- IBB, CD25, CD107A, or a combination thereof on the surface of NK cells.

[0303] In some aspects, the specified cell population is monocytes. In some aspects, the method increases a frequency of B7-H3, CD83, CD86, HLA-DR, CD40, or a combination thereof on the surface of monocytes.

[0304] In some aspects, the present disclosure includes a method for treating a subject having a tumor or a cancer comprising a) collecting a baseline sample (e.g. tumor tissue, blood, or other suitable biological sample for detection of cell surface markers) from the subject prior to administering a dose of an anti-CCR8 antibody, or antigen-binding portion thereof, to the subject, b) administering at least one dose of the anti-CCR8 antibody, or antigen-binding portion thereof, to the subject for a treatment cycle, c) collecting a post-dose sample from the subject during or after the treatment cycle of the at least one dose of the anti-CCR8 antibody, or antigen-binding portion thereof, d) measuring a frequency for one or more cell surface markers in each of the baseline and post-dose samples, and e) treating the subject with a first treatment regimen comprising administering the anti-CCR8 antibody or antigen-binding portion thereof, if the postdose frequency is greater than the baseline frequency or treating the subject with a second treatment regimen comprising the anti-CCR8 antibody, or antigen-binding portion thereof, and toripalimab, if the post-dose frequency is equal to or less than the baseline frequency.

[0305] The frequency of cell surface markers can be measured by any method known in the art. In some aspects, the frequency is measured by flow cytometry. In some aspects, the frequency is measured by immunofluorescence. In some aspects, the frequency is measured by immunohistochemistry.

[0306] In some aspects, the antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

[0307] In some aspects, the present disclosure includes a method of treating a subject having a tumor or a cancer, the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50. In some aspects, the tumor is a head and neck cancer. In some aspects, the cancer is a gastric cancer or a gastroesophageal junction (GEJ) cancer. In some aspects, the tumor expresses HPV pl6. In some aspects, the tumor expresses HPV p 18. In some aspects, the cancer is HPV negative. In some aspects, the subject has an oropharyngeal cancer that expresses HPV pl 6 and / or pl 8. In some aspects, the tumor has high microsatellite instability (MSI-H) and / or deficient mismatch repair (dMMR). In some aspects, the subject has an endometrial cancer with MSI-H and / or dMMR. In some aspects, the subject has a colorectal cancer with MSI-H and / or dMMR. In some aspects, the subject has a prostate cancer with MSI-H and / or dMMR. In some aspects, the subject has a breast cancer with MSI-H and / or dMMR. In some aspects, the subject has a pancreatic cancer with MSI-H and / or dMMR. In some aspects, the subject has a gastric cancer with MSI-H and / or dMMR. In some aspects, the tumor has microsatellite stability (MSS) and / or proficient mismatch repair (pMMR). In some aspects, the subject has gastric cancer that has MSS and / or pMMR. In some aspects, the subject has a colorectal cancer (CRC) that has MSS and / or pMMR. In some aspects, the subject has a pancreatic cancer that has MSS and / or pMMR. In some aspects, the subject has a pancreatic ductal adenocarcinoma (PDAC) that has MSS and / or pMMR. In some aspects, the tumor is a squamous cell carcinoma (SCC). In some aspects, the tumor expresses PD-L1. In some aspects, the tumor has a combined positive score (CPS) for PD-L1 of > 1. In some aspects, the subject has been previously treated with a PD- 1 inhibitor. In some aspects, the PD-L1+tumor is a NSCLC, a gastric cancer, or a SCC. In some aspects, the method comprises treating the subject without inducing one or more treatment emergent adverse events (TEAEs). In some aspects, the one or more TEAEs is hypokalaemia, abdominal pain, cough, embolism, tumor pain, anemia, increased aspartate aminotransferase, constipation, urinary retention, hypomagnesaemia, or hyponatremia. In some aspects, the method further comprises administering toripalimab to the subject.

[0308] In some aspects, the present disclosure provides a method of increasing anti-tumor efficacy, therapeutic window, half-life, or exposure of an anti-PDl antibody comprising administering to a subject an anti-CCR8 antibody, or antigen-binding portion thereof, in combination with the anti-PDl antibody. In some aspects, the anti-PDl antibody is toripalimab. In some aspects, the method increases anti-tumor efficacy, therapeutic window, half-life, or exposure of the anti-PDl antibody without increasing adverse events in the subject. In some aspects, the adverse events comprise one or more of increase in alanine aminotransferase, increase in aspartate aminotransferase, infusion-related reaction, increase in lipase, diarrhea, decrease in white blood cell count, fatigue, pain, decrease in platelet count, oropharyngeal fistula, acute respiratory failure, increase in amylase, anemia, increase in blood alkaline phosphatase, hypoxia, wound infection, increase in blood bilirubin, increase in blood thyroid stimulating hormone, dysgeusia, dyspnea, hypernatremia, musculoskeletal chest pain, decrease in neutrophil count, aspiration pneumonia, pyrexia, maculopapular rash, COVID-19, acneiform dermatitis, dry eye, food intolerance, headache, hyponatremia, mouth hemorrhage, nausea, oral pain, and rash.

[0309] In some aspects, the VH chain comprises the amino acid sequence set forth in SEQ ID NO: 41. In some aspects, the VL chain comprises the amino acid sequence set forth in SEQ ID NO: 43. In some aspects, the antibody or antigen-binding portion thereof comprises: a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 41 and a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 43.

[0310] In some aspects, the one or more cytokines are selected from IFN-y, TNFa, CXCL10, IL-12 / IL-23p40, M-CSF-1, IL- la, IL-27, VCAM-1, IL- 1 , MIP-ly, IL-2, Eotaxin, IL- 18, Granzyme B, and MIPIb. In some aspects, the one or more cytokines is IFN-y. In some aspects, the one or more cytokines is TNFa. In some aspects, the one or more cytokines is CXCL10. In some aspects, the one or more cytokines is IL-12 / IL-23p40. In some aspects, the one or more cytokines is M-CSF-1. In some aspects, the one or more cytokines is IL-la. In some aspects, the one or more cytokines is IL-27. In some aspects, the one or more cytokines is VCAM-1. In some aspects, the one or more cytokines is IL-10. In some aspects, the one or more cytokines is MIP- ly. In some aspects, the one or more cytokines is IL-2. In some aspects, the one or more cytokines is Eotaxin. In some aspects, the one or more cytokines is IL-18. In some aspects, the one or more cytokines is Granzyme B. In some aspects, the one or more cytokines is MIPIb.

[0311] In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof is administered to the subject at a dose of about 100 to about 3,000 mg, about 100 to about 1,500 mg, or about 200 to about 1,000 mg. In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof is administered to the subject at a dose of about 100 mg, about 300 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, or about 1600 mg.

[0312] In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof is administered weekly (QW), bi-weekly (Q2W), every 3 weeks (Q3W), or every 4 weeks (Q4W). In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof is administered every 3 weeks (Q3W).

[0313] In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof is administered at a dose of about 300 mg Q3W.

[0314] In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof is administered at a dose of about 700 mg Q3W.

[0315] In some aspects, the PD-1 inhibitor is toripalimab. In some aspects, toripalimab is administered at a dose of about 120 mg to about 720 mg, or about 240 mg to about 480 mg, or about 240 mg to about 360 mg. In some aspects, toripalimab is administered at a dose of about 120 mg, about 240 mg, about 340 mg, about 360 mg, or about 480 mg.

[0316] In some aspects, toripalimab is administered weekly (QW), bi-weekly (Q2W), every 3 weeks (Q3W), or every 4 weeks (Q4W) or every 6 weeks (Q6W).

[0317] In some aspects, toripalimab is administered at a dose of 240 mg Q3W. In some aspects, toripalimab is administered at a dose of about 340 mg Q4W. In some aspects, toripalimab is administered at a dose of about 480 mg Q6W.

[0318] In some aspects, the present disclosure provides methods of maintaining a serum concentration of an anti-CCR8 antibody, or antigen-binding portion thereof, at or above a target trough concentration in a subject, comprising administering the anti-CCR8 antibody, or antigenbinding portion thereof, to the subject at a dose of about 100 mg to about 3000 mg, for example about 200 mg to about 2000 mg, or about 200 mg to about 1000 mg. In some aspects, the target trough concentration is about 10 pg / mL to about 50 pg / mL. In some aspects, the target trough concentration is about 10 pg / mL to about 35 pg / mL. In some aspects, the target trough concentration is about 10 pg / mL, about 12 pg / mL, about 14 pg / mL, about 15 pg / mL, about 16pg / mL, about 18 pg / mL, about 20 pg / mL, about 22 pg / mL, about 24 pg / mL, about 25 pg / mL, about 26 pg / mL, about 28 pg / mL, about 30 pg / mL, about 32 pg / mL, about 34 pg / mL, about 35 pg / mL, about 36 pg / mL, about 38 pg / mL, about 40 pg / mL, about 42 pg / mL, about 44 pg / mL, about 45 pg / mL, about 46 pg / mL, about 48 pg / mL, or about 50 pg / mL.

[0319] Certain aspects of the present disclosure are directed to methods of reducing, depleting, or killing tumor infiltrating Tregs, comprising administering to the subject an anti-CCR8 antibody disclosed herein. Some aspects of the present disclosure are directed to methods of reducing, depleting, or killing tumor infiltrating Tregs, comprising administering a bispecific antibody, a T cell engager (TCE), a BiTE, a multispecific antibody, a biparatopic antibody, an immunoconjugate, a CAR, a TCR, a nucleic acid molecule or a set of nucleic acid molecules, a vector or a set of vectors, a cell, or a pharmaceutical composition disclosed herein.

[0320] Certain aspects of the present disclosure are directed to methods of activating NK cells or inducing NK cell mediated killing of tumor infiltrating regulatory Tregs, comprising administering to the subject an anti-CCR8 antibody disclosed herein. Some aspects of the present disclosure are directed to methods of activating NK cells or inducing NK cell mediated killing of tumor infiltrating regulatory Tregs, comprising administering a bispecific antibody, a TCE, a BiTE, a multispecific antibody, a biparatopic antibody, an immunoconjugate, a NK cell therapy, a CAR, a TCR, a nucleic acid molecule or a set of nucleic acid molecules, a vector or a set of vectors, a cell, or a pharmaceutical composition disclosed herein. In some aspects, the method increases the frequency of 4-lBB+NK cells in a tumor, TME, biopsy sample, or tumor sample. In some aspects, the method increases the frequency of CD25+NK cells in a tumor, TME, biopsy sample, or tumor sample. In some aspects, the method increases the frequency of CD 107 a+cells in a tumor, TME, biopsy sample or tumor sample. In some aspects, the method decreases the frequency of CD16+NK cells in a tumor, TME, biopsy sample, or tumor sample.

[0321] Certain aspects of the present disclosure are directed to methods of activating monocytes, comprising administering to a subject an anti-CCR8 antibody disclosed herein. Some aspects of the present disclosure are directed to methods of activating monocytes, comprising administering a bispecific antibody, a TCE, a BiTE, a multispecific antibody, a biparatopic antibody, an immunoconjugate, a CAR, a TCR, a nucleic acid molecule or a set of nucleic acid molecules, a vector or a set of vectors, a cell, or a pharmaceutical composition disclosed herein. In some aspects, the method increases the frequency of B7-H3+monocytes in a tumor, TME, biopsysample, or tumor sample. In some aspects, the method increases the frequency of CD83+monocytes in a tumor, TME, biopsy sample, or tumor sample. In some aspects, the method increases the frequency of CD86+monocytes in a tumor, TME, biopsy sample, or tumor sample. In some aspects, the method increases the frequency of HLA-DR+monocytes in a tumor, TME, biopsy sample, or tumor sample. In some aspects, the method increases the frequency of CD40+monocytes in a tumor, TME, biopsy sample, or tumor sample.

[0322] In certain aspects, the present disclosure provides a method of increasing the efficacy of an immunotherapy agent in a subject with a tumor administered the immunotherapy agent, comprising administering an anti-CCR8 antibody, or antigen-binding portion thereof, of the present disclosure to the subject at a dose of about 100 mg to about 3000 mg, for example about 200 mg to about 2000 mg, or about 200 mg to about 1000 mg. In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof is administered so as to increase a ratio of CD8+T cells to Tregs in the tumor microenvironment (TME) compared to a baseline ratio.

[0323] In some aspects, the immunotherapy agent is an immune checkpoint inhibitor. In some aspects, the immune checkpoint inhibitor is selected from the group consisting of: atezolizumab, avelumab, cemiplimab, cosibelimab, dostarlimab, durvalamab, nivolumab, pembrolizumab, tislelizumab, toripalimab, rilatimab, ipilimumab, tremelimumab, and a combination thereof. In some aspects, the immunotherapy agent is a T cell engager. In some aspects, the T-cell engager is selected from the group consisting of blinatumomab, tarlatamab, tebentafusp, mosunetuzumab, glofitamab, epcoritamab, talquetamab, teclistamab, and elranatamab. In some aspects, the immunotherapy agent is a chimeric antigen receptor (CAR)-T cell therapy. In some aspects, the CAR-T cell therapy is selected from the group consisting of tisagenlecleucel, axicabtagene ciloleucel, brexueabtagene autoleucel, lisocabtagene maraleucel, idecabtagene vicleucel, ciltacabtagene autoleucel, and obecabtagene autoleucel.

[0324] In some aspects, the anti-CCR8 antibody or antigen-binding portion thereof causes an increase in CD8+T cells in the TME. In some aspects, the step of administering the anti-CCR8 antibody or antigen-binding portion thereof causes a decrease in Tregs in the TME. Without being bound by theory or any particular mechanism, it is thought that administering the anti-CCR8 antibody at a dose of about 100 mg to about 3,000 mg, preferably about 200 mg to about 1,000 mg, or more preferably about 300 mg to about 700 mg causes a shift in the TME from a more immunosuppressive phenotype to a more inflamed and / or cytotoxic phenotype. In some aspects,this shift in TME phenotype is measured as an increase in a ratio of CD8+T cells to Tregs in the TME compared to a baseline ratio. In some aspects, this shift in TME phenotype creates a TME in which the efficacy of an immunotherapy agent is increased.

[0325] In some aspects, the method comprises administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose such that the ratio of CD8+T cells to Tregs in the TME increases about 5-fold, about 10-fold, about 15-fold, about 20-fold, about 25-fold, about 30-fold, about 35-fold, about 40-fold, about 45-fold, or about 50-fold compared to the baseline ratio. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 5-fold. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 10-fold. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 15-fold. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 20-fold. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 25-fold. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 30-fold. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 35-fold. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 40-fold. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 45-fold. In some aspects, the ratio of CD8+T cells to Tregs in the TME increases about 50- fold. The ratio of CD8+T cells to Tregs may be determined by any method known in the art. In some aspects, the ratio is determined by flow cytometry. In some aspects, the ratio is determined by immunohistochemistry.

[0326] In some aspects, the contacting is in vitro. In some aspects the contacting is in vivo. In some aspects, the contacting treats a disease or condition in a subject in need thereof. In some aspects, the contacting promotes an immune response in a subject. In some aspects, the subject has a tumor, and the contacting enhances an immune response to the tumor.

[0327] Certain aspects of the present disclosure are directed to methods of treating a tumor in a subject in need thereof, comprising administering to the subject an anti-CCR8 antibody disclosed herein. Some aspects of the present disclosure are directed to methods of treating a tumor in a subject in need thereof comprising administering a bispecific antibody, a TCE, a BiTE, a multispecific antibody, a biparatopic antibody, an immunoconjugate, a CAR, a TCR, a nucleic acid molecule or a set of nucleic acid molecules, a vector or a set of vectors, a cell, or a pharmaceutical composition disclosed herein.

[0328] In some aspects, the subject has a tumor. In some aspects, the tumor is selected form the group consisting of Kaposi's sarcoma, leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, myeloblasts promyelocyte myelomonocytic monocytic erythroleukemia, chronic leukemia, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt’s lymphoma and marginal zone B cell lymphoma, Polycythemia vera Lymphoma, Hodgkin's disease, nonHodgkin's disease, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, solid tumors, sarcomas, and carcinomas, soft tissue sarcoma, fibrosarcoma, myxosarcoma, liposarcoma, chrondrosarcoma, osteogenic sarcoma, osteosarcoma, chordoma, angiosarcoma, endothelio sarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon sarcoma, colorectal carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatocellular carcinoma (HCC), hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, uterine cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, nonsmall cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma, retinoblastoma, nasopharyngeal carcinoma, esophageal carcinoma, basal cell carcinoma, biliary tract cancer, bladder cancer, bone cancer, brain and central nervous system (CNS) cancer, cervical cancer, choriocarcinoma, colorectal cancers, connective tissue cancer, cancer of the digestive system, endometrial cancer, esophageal cancer, eye cancer, head and neck cancer, gastric cancer, gastroesophageal junction (GEJ) cancer, intraepithelial neoplasm, kidney cancer, larynx cancer, liver cancer, lung cancer (small cell, large cell), melanoma, neuroblastoma; oral cavity cancer (for example lip, tongue, mouth and pharynx), ovarian cancer, pancreatic cancer, retinoblastoma, rhabdomyosarcoma, rectal cancer; cancer of the respiratory system, sarcoma, skin cancer, stomach cancer, testicular cancer, thyroid cancer, uterine cancer, and cancer of the urinary system, or any combination thereof.

[0329] In some aspects, the tumor is recurrent or refractory to a prior therapy. In some aspects, the tumor is recurrent or refractory to a prior standard of care therapy. In some aspects, the prior therapy comprises an immunotherapy, a chemotherapy, a surgery, a radiotherapy, or any combination thereof. In some aspects, the tumor is refractory to a prior chemotherapy. In some aspects, the tumor is recurrent or refractory to a prior immunotherapy. In some aspects, the tumor is relapsed. In some aspects, the tumor is not curable by local therapy.

[0330] In some aspects, the tumor is advanced. In some aspects, the tumor is locally advanced. In some aspects, the tumor is metastatic. In some aspects, the tumor expresses HPV p!6. In some aspects, the tumor expresses HPV p 18. In some aspects, the cancer is HPV negative. In some aspects, the tumor has MSI-H and / or dMMR. In some aspects, the tumor has MSS and / or pMMR.

[0331] In some aspects, the anti-CCR8 antibody is administered in combination with an additional anticancer agent. In some aspects, the additional anticancer agent is selected from a small molecule, a polypeptide, a radiation therapy, a surgery, and a combination thereof.

[0332] In some aspects, the anti-CCR8 antibody is administered prior to the additional anticancer agent. In some aspects, the anti-CCR8 antibody is administered after the additional anticancer agent. In some aspects, the anti-CCR8 antibody is administered at the same time as the additional anticancer agent. In some aspects, the anti-CCR8 antibody and the additional anticancer agent are formulated in a single composition.

[0333] In some aspects, the additional anticancer agent comprises a chemotherapy. The chemotherapy can be any chemotherapy known in the art. In some aspects, the chemotherapy is a standard of care treatment for the particular cancer type. In some aspects, the chemotherapy is a platinum-based chemotherapy. In some aspects, the chemotherapy is selected from the group consisting of doxorubicin (ADRIAMYCIN®), cisplatin, carboplatin, bleomycin sulfate, carmustine, chlorambucil (LEUKERAN®), cyclophosphamide (CYTOXAN®; NEOSAR®), lenalidomide (REVLIMID®), bortezomib (VELCADE®), dexamethasone, mitoxantrone, etoposide, cytarabine, bendamustine (TREANDA®), rituximab (RITUXAN®), ifosfamide, vincristine (ONCOVIN®), fludarabine (FLUDARA®), thalidomide (THALOMID®), alemtuzumab (CAMPATH®), ofatumumab (ARZERRA®), everolimus (AFINITOR®, ZORTRESS®), carfilzomib (KYPROLISTM), and any combination thereof.

[0334] In some aspects, the additional anticancer agent comprises an immunotherapy. In some aspects, the immunotherapy is selected from a PD-1 antagonist, a PD-L1 inhibitor, a TIM-3 inhibitor, a LAG-3 inhibitor, a TIGIT inhibitor, a CD112R inhibitor, a TAM inhibitor, a STING agonist, a 4- IBB agonist, a CCL22 inhibitor, an agent that induces NK cell activation, and any combination thereof.

[0335] In some aspects, the additional anticancer therapy comprises a PD-1 antagonist. Any PD- 1 antagonist known in the art can be used in combination with the anti-CCR8 antibodies disclosed herein. In some aspects, the PD-1 antagonist is an antibody or antigen-binding portion thereof that specifically binds PD-1. Nonlimiting examples of PD-1 antagonists that can be used in combination with the anti-CCR8 antibodies disclosed herein include toripalimab, PDR001, nivolumab, pembrolizumab, pidilizumab, MEDI0680, REGN2810, TSR-042, PF-06801591, and AMP-224.

[0336] In some aspects, the additional anticancer therapy comprises toripalimab (JS001) as described in U.S. Pat. No. 10,066,013, which is incorporated herein by reference in its entirety for all purposes.

[0337] In some aspects, the additional anticancer therapy comprises a PD-L1 inhibitor. Any PD-L1 inhibitor known in the ail can be used in combination with the anti-CCR8 antibodies disclosed herein. In some aspects, the PD-L1 inhibitor is an antibody or antigen-binding portion thereof that specifically binds PD-L1. Nonlimiting examples of PD-L1 inhibitors that can be used in combination with the anti-CCR8 antibodies disclosed herein include FAZ053, Atezolizumab, Avelumab, Durvalumab, and BMS-936559.

[0338] In some aspects, the additional anticancer therapy comprises a TIM-3 inhibitor. Any TIM-3 inhibitor known in the art can be used in combination with the anti-CCR8 antibodies disclosed herein. In some aspects, the TIM-3 inhibitor is an antibody or antigen-binding portion thereof that specifically binds TIM-3. Nonlimiting examples of TIM-3 inhibitors that can be used in combination with the anti-CCR8 antibodies disclosed herein include MGB453 and TSR-022.

[0339] In some aspects, the additional anticancer therapy comprises a LAG-3 inhibitor. Any LAG-3 inhibitor known in the art can be used in combination with the anti-CCR8 antibodies disclosed herein. In some aspects, the LAG-3 inhibitor is an antibody or antigen-binding portion thereof that specifically binds LAG-3. Nonlimiting examples of LAG-3 inhibitors that can be usedin combination with the anti-CCR8 antibodies disclosed herein include LAG525, BMS-986016, and TSR-033.

[0340] In some aspects, the additional anticancer therapy comprises a TIGIT inhibitor. Any TIGIT inhibitor known in the art can be used in combination with the anti-CCR8 antibodies disclosed herein. In some aspects, the TIGIT inhibitor is an antibody or antigen-binding portion thereof that specifically binds TIGIT.

[0341] In some aspects, the additional anticancer therapy comprises a CD112R inhibitor. Any CD112R inhibitor known in the art can be used in combination with the anti-CCR8 antibodies disclosed herein. In some aspects, the CD112R inhibitor is an antibody or antigen-binding portion thereof that specifically binds CD112R.

[0342] In some aspects, the additional anticancer therapy comprises a CCL22 inhibitor. Any CCL22 inhibitor known in the art can be used in combination with the anti-CCR8 antibodies disclosed herein. In some aspects, the CCL22 inhibitor is an antibody or antigen-binding portion thereof that specifically binds CCL22.

[0343] In some aspects, the additional anticancer therapy is an agent that induces NK cell activation, and therefore enhances ADCC activity of the CCR8 antibody. In some aspects, the agent that induces NK cell activation is an antibody or antigen-binding portion thereof, a small molecule, a cytokine, or a cytokine fusion.

[0344] In certain aspects, the additional anticancer agent comprises an anticancer agent selected from the group consisting of Toripalimab (LOQTORZI®), Sunitinib (SUTENT®), Cabozantinib (CABOMETYX®), Axitinib (INLYTA®), Lenvatinib (LENVIMA®), Everolimus (AFINITOR®), Bevacizumab (AVASTIN®), epacadostat, NKTR-214 (CD-122-biased agonist), Tivozanib (FOTIVDA®), abexinostat, Ipilimumab (YERVOY®), tremelimumab, Pazopanib (VOTRIENT®), Sorafenib (NEXAVAR®), Temsirolimus (TORISEL®), Ramucirumab (CYRAMZA®), niraparib, savolitinib, vorolanib (X-82), Regorafenib (STIVARGO®), Donafenib (multikinase inhibitor), Camrelizumab (SHR-1210), pexastimogene devacirepvec (JX-594), Ramucirumab (CYRAMZA®), apatinib (YN968D1), encapsulated doxorubicin (THERMODOX®), Tivantinib (ARQ197), ADI-PEG 20, binimetinib, apatinib mesylate, nintedanib, lirilumab, Nivolumab (OPDIVO®), Pembrolizumab (KEYTRUDA®), Atezolizumab (TECENTRIQ®), Avelumab (BAVENCIO®), Durvalumab (IMFIMZI®), Cemiplimab-rwlc (LIBTAYO®), tislelizumab, spartalizumab, and any combination thereof.

[0345] In some aspects, the additional anticancer agent comprises a TAM (Axl, Mer, Tyro) inhibitor. In some aspects, the additional anticanccr agent comprises a 4- IBB agonist. In some aspects, the additional anticancer agent comprises a Tyrosine Kinase Inhibitor (TKI). Nonlimiting examples of TKIs that can be used in combination with the anti-CCR8 antibodies disclosed herein include imatinib mesylate, dasatinib, nilotinib, and bosutinib.

[0346] The anti-CCR8 antibodies of the present disclosure can be administered by any suitable route. In some aspects, the anti-CCR8 antibody is administered intravenously. In some aspects, the anti-CCR8 antibody is subcutaneously. In some aspects, the anti-CCR8 antibody is administered intramuscularly. In some aspects, the anti-CCR8 antibody is administered intraperitoneally. In some aspects, the anti-CCR8 antibody is administered orally.B. Methods for Producing Anti-CCR8 Antibodies

[0347] The disclosure also features methods for producing any of the anti-CCR8 antibodies described herein. In some aspects, methods for preparing an antibody described herein can include immunizing a subject (e.g., a non-human mammal) with an appropriate immunogen. Suitable immunogens for generating any of the antibodies described herein are set forth herein. For example, to generate an antibody that binds to the N-terminal extracellular domain of human CCR8, a skilled artisan can immunize a suitable subject (e.g., a non-human mammal such as a rat, a mouse, a gerbil, a hamster, a dog, a cat, a pig, a goat, a horse, or a non-human primate) with a fragment of human CCR8 comprising the N-terminal extracellular domain. In some aspects, a fragment polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 172 is used as the immunogen.

[0348] A suitable subject (e.g., a non-human mammal) can be immunized with the appropriate antigen along with subsequent booster immunizations a number of times sufficient to elicit the production of an antibody by the mammal. The immunogen can be administered to a subject (e.g., a non-human mammal) with an adjuvant. Adjuvants useful in producing an antibody in a subject include, but are not limited to, protein adjuvants; bacterial adjuvants, e.g., whole bacteria (BCG, Corynebacterium parvum or Salmonella minnesota) and bacterial components including cell wall skeleton, trehalose dimycolate, monophosphoryl lipid A, methanol extractable residue (MER) of tubercle bacillus, complete or incomplete Freund’s adjuvant; viral adjuvants; chemical adjuvants, e.g., aluminum hydroxide, and iodoacetate and cholesteryl hemisuccinate.Other adjuvants that can he used in the methods for inducing an immune response include, e.g., cholera toxin and parapoxvirus proteins. Sec also Bieg ct al. (1999) Autoimmunity 31(1): 15-24. See also, e.g., Lodmell et al. (2000) Vaccine 18:1059-1066; Johnson et al. (1999) J Med Chem 42:4640-4649; Baldridge et al. (1999) Methods 19:103-107; and Gupta et al. (1995) Vaccine 13(14): 1263-1276.

[0349] In some aspects, the methods include preparing a hybridoma cell line that secretes a monoclonal antibody that binds to the immunogen. For example, a suitable mammal such as a laboratory mouse is immunized with a CCR8 polypeptide as described above. Antibodyproducing cells (e.g., B cells of the spleen) of the immunized mammal can be isolated two to four days after at least one booster immunization of the immunogen and then grown briefly in culture before fusion with cells of a suitable myeloma cell line. The cells can be fused in the presence of a fusion promoter such as, e.g., vaccinia virus or polyethylene glycol. The hybrid cells obtained in the fusion are cloned, and cell clones secreting the desired antibodies are selected. For example, spleen cells of Balb / c mice immunized with a suitable immunogen can be fused with cells of the myeloma cell line PAI or the myeloma cell line Sp2 / 0-Ag 14. After the fusion, the cells are expanded in suitable culture medium, which is supplemented with a selection medium, for example HAT medium, at regular intervals in order to prevent normal myeloma cells from overgrowing the desired hybridoma cells. The obtained hybrid cells are then screened for secretion of the desired antibodies, e.g., an antibody that binds to human CCR8. In some aspects, a skilled artisan can identify an anti- CCR8 antibody from a non-immune biased library as described in, e.g., U.S. patent no. 6,300,064 (to Knappik et al.; Morphosys AG) and Schoonbroodt et al. (2005) Nucleic Acids Res 33(9) :e81.

[0350] In some aspects, the methods described herein can involve, or be used in conjunction with, e.g., phage display technologies, bacterial display, yeast surface display, eukaryotic viral display, mammalian cell display, and cell-free (e.g., ribosomal display) antibody screening techniques (see, e.g., Etz et al. (2001) J Bacterial 183:6924-6935; Comelis (2000) Curr Opin Biotechnol 11:450-454; Klemm et al. (2000) Microbiology 146:3025-3032; Kieke et al. (1997) Protein Eng 10:1303-1310; Yeung et al. (2002) Biotechnol Prog 18:212-220; Boder et al. (2000) Methods Enzymology 328:430-444; Grabherr et al. (2001) Comb Chem High Throughput Screen 4:185-192; Michael et al. (1995) Gene Ther 2:660-668; Pereboev et al. (2001) J Virol75:7107-7113; Schaffitzel et al. (1999) J Immunol Methods 231 : 1 19-135; and Hanes et al. (2000) Nat Biotechnol 18:1287-1292).

[0351] Methods for identifying antibodies using various phage display methods are known in the art. In phage display methods, functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them. Such phage can be utilized to display antigen-binding domains of antibodies, such as Fab, Fv, or disulfide-bond stabilized Fv antibody fragments, expressed from a repertoire or combinatorial antibody library (e.g., human or murine). Phage used in these methods are typically filamentous phage such as fd and M13. The antigen binding domains are expressed as a recombinantly fused protein to any of the phage coat proteins pill, pVIII, or pIX. See, e.g., Shi et al. (2010) JMB 397:385-396. Examples of phage display methods that can be used to make the immunoglobulins, or fragments thereof, described herein include those disclosed in Brinkman et al. (1995) J Immunol Methods 182:41-50; Ames et al. (1995) J Immunol Methods 184:177-186; Kettleborough et al. (1994) Eur J Immunol 24:952-958; Persic et al. (1997) Gene 187:9-18; Burton et al. (1994) Advances in Immunology 57:191-280; and PCT publication nos. WO 90 / 02809, WO 91 / 10737, WO 92 / 01047, WO 92 / 18619, WO 93 / 11236, WO 95 / 15982, and WO 95 / 20401. Suitable methods are also described in, e.g., U.S. patent nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108.

[0352] In some aspects, the phage display antibody libraries can be generated using mRNA collected from B cells from the immunized mammals. For example, a splenic cell sample comprising B cells can be isolated from mice immunized with a CCR8 polypeptide as described above. mRNA can be isolated from the cells and converted to cDNA using standard molecular biology techniques. See, e.g., Sambrook et al. (1989) "Molecular Cloning: A Laboratory Manual, 2lldEdition," Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane (1988), supra', Benny K. C. Lo (2004), supra; and Borrebaek (1995), supra. The cDNA coding for the variable regions of the heavy chain and light chain polypeptides of immunoglobulins a e used to construct the phage display library. Methods for generating such a library are described in, e.g., Merz et al. (1995) J Neurosci Methods 62(l-2):213-9; Di Niro et al. (2005) Biochem J 388(Pt 3):889-894; and Engberg et al. (1995) Methods Mol Biol 51:355-376.

[0353] In some aspects, a combination of selection and screening can be employed to identify an antibody of interest from, e.g., a population of hybridoma-dcrivcd antibodies or a phage display antibody library. Suitable methods are known in the art and are described in, e.g., Hoogenboom (1997) Trends in Biotechnology 15:62-70; Brinkman et al. (1995), supra', Ames et al. (1995), supra; Kettleborough et al. (1994), supra; Persic et al. (1997), supra; and Burton et al. (1994), supra. For example, a plurality of phagemid vectors, each encoding a fusion protein of a bacteriophage coat protein (e.g., pill, pVIII, or pIX of M13 phage) and a different antigencombining region are produced using standard molecular biology techniques and then introduced into a population of bacteria (e.g., E. coU). Expression of the bacteriophage in bacteria can, in some aspects, require use of a helper phage. In some aspects, no helper phage is required (see, e.g., Chasteen et al., (2006) Nucleic Acids Res 34(21):el45). Phage produced from the bacteria are recovered and then contacted to, e.g., a target antigen bound to a solid support (immobilized). Phage may also be contacted to antigen in solution, and the complex is subsequently bound to a solid support.

[0354] A subpopulation of antibodies screened using the above methods can be characterized for their specificity and binding affinity for a particular antigen (e.g., human CCR8) using any immunological or biochemical based method known in the art. For example, specific binding of an antibody to CCR8, may be determined for example using immunological or biochemical based methods such as, but not limited to, an ELISA assay, SPR assays, immunoprecipitation assay, affinity chromatography, and equilibrium dialysis as described above. Immunoassays which can be used to analyze immuno specific binding and cross-reactivity of the antibodies include, but are not limited to, competitive and non-competitive assay systems using techniques such as Western blots, RIA, ELISA (enzyme linked immunosorbent assay), "sandwich" immunoassays, immunoprecipitation assays, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays. Such assays are routine and well known in the art.

[0355] In aspects where the selected CDR amino acid sequences are short sequences (e.g., fewer than 10-15 amino acids in length), nucleic acids encoding the CDRs can be chemically synthesized as described in, e.g., Shiraishi et al. (2007) Nucleic Acids Symposium Series 51(1): 129- 130 and U.S. Patent No. 6,995,259. For a given nucleic acid sequence encoding an acceptor antibody, the region of the nucleic acid sequence encoding the CDRs can be replaced with thechemically synthesized nucleic acids using standard molecular biology techniques. The 5’ and 3’ ends of the chemically synthesized nucleic acids can be synthesized to comprise sticky end restriction enzyme sites for use in cloning the nucleic acids into the nucleic acid encoding the variable region of the donor antibody.C. Recombinant Antibody Expression and Purification

[0356] The antibodies or antigen-binding fragments thereof described herein can be produced using a variety of techniques known in the art of molecular biology and protein chemistry. For example, a nucleic acid encoding one or both of the heavy and light chain polypeptides of an antibody can be inserted into an expression vector that contains transcriptional and translational regulatory sequences, which include, e.g., promoter sequences, ribosomal binding sites, transcriptional staid and stop sequences, translational start and stop sequences, transcription terminator signals, polyadenylation signals, and enhancer or activator sequences. The regulatory sequences include a promoter and transcriptional start and stop sequences. In addition, the expression vector can include more than one replication system such that it can be maintained in two different organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification.

[0357] Several possible vector systems are available for the expression of cloned heavy chain and light chain polypeptides from nucleic acids in mammalian cells. One class of vectors relies upon the integration of the desired gene sequences into the host cell genome. Cells which have stably integrated DNA can be selected by simultaneously introducing drug resistance genes such as E. coli gpt (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) or Tn5 neo (Southern and Berg (1982) Mol Appl Genet 1:327). The selectable marker gene can be either linked to the DNA gene sequences to be expressed, or introduced into the same cell by cotransfection (Wigler et al. (1979) CellA second class of vectors utilizes DNA elements which confer autonomously replicating capabilities to an extrachromosomal plasmid. These vectors can be derived from animal viruses, such as bovine papillomavirus (Sarver et al. (1982) Proc Natl Acad Sci USA, 79:7147), cytomegalovirus, polyoma virus (Deans et al. (1984) Proc Natl Acad Sci USA 81:1292), or SV40 virus (Lusky and Botchan (1981) Nature 293:79).

[0358] The expression vectors can be introduced into cells in a manner suitable for subsequent expression of the nucleic acid. The method of introduction is largely dictated by thetargeted cell type, discussed below. Exemplary methods include CaPCL precipitation, liposome fusion, cationic liposomes, electroporation, viral infection, dextran-mediated transfection, polybrene-mediated transfection, protoplast fusion, and direct microinjection.

[0359] Appropriate host cells for the expression of antibodies or antigen-binding fragments thereof include yeast, bacteria, insect, plant, and mammalian cells. Of particular interest are bacteria such as E. coli, fungi such as Saccharomyces cerevisiae and Pichia pastoris, insect cells such as SF9, mammalian cell lines (e.g., human cell lines), as well as primary cell lines.

[0360] In some aspects, an antibody or fragment thereof can be expressed in, and purified from, transgenic animals (e.g., transgenic mammals). For example, an antibody can be produced in transgenic non-human mammals (e.g., rodents) and isolated from milk as described in, e.g., Houdebine (2002) Curr Opin Biotechnol 13(6):625-629; van Kuik-Romeijn et al. (2000) Transgenic Res 9(2): 155- 159; and Pollock et al. (1999) J Immunol Methods 231(1-2): 147-157.

[0361] The antibodies and fragments thereof can be produced from the cells by culturing a host cell transformed with the expression vector containing nucleic acid encoding the antibodies or fragments, under conditions, and for an amount of time, sufficient to allow expression of the proteins. Such conditions for protein expression will vary with the choice of the expression vector and the host cell, and will be easily ascertained by one skilled in the art through routine experimentation. For example, antibodies expressed in E. coli can be refolded from inclusion bodies (see, e.g., Hou et al. (1998) Cytokine 10:319-30). Bacterial expression systems and methods for their use are well known in the art (see Current Protocols in Molecular Biology, Wiley & Sons, and Molecular Cloning— A Laboratory Manual —3rd Ed., Cold Spring Harbor Laboratory Press, New York (2001)). The choice of codons, suitable expression vectors and suitable host cells will vary depending on a number of factors, and may be easily optimized as needed. An antibody (or fragment thereof) described herein can be expressed in mammalian cells or in other expression systems including but not limited to yeast, baculovirus, and in vitro expression systems (see, e.g., Kaszubska et al. (2000) Protein Expression and Purification 18:213-220).

[0362] Following expression, the antibodies and fragments thereof can be isolated. An antibody or fragment thereof can be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample. Standard purification methods include electrophoretic, molecular, immunological, and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse-phase HPLC chromatography. Forexample, an antibody can be purified using a standard anti-antibody column (e.g., a protein-A or protcin-G column). Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. See, e.g., Scopes (1994) "Protein Purification, 3rdedition," Springer- Verlag, New York City, New York. The degree of purification necessary will vary depending on the desired use. In some instances, no purification of the expressed antibody or fragments thereof will be necessary.

[0363] Methods for determining the yield or purity of a purified antibody or fragment thereof are known in the art and include, e.g., Bradford assay, UV spectroscopy, Biuret protein assay, Lowry protein assay, amido black protein assay, high pressure liquid chromatography (HPLC), mass spectrometry (MS), and gel electrophoretic methods (e.g., using a protein stain such as Coomassie Blue or colloidal silver stain).D. Modification of the Antibodies or Antigen-Binding Fragments Thereof

[0364] The antibodies or antigen-binding fragments thereof can be modified following their expression and purification. The modifications can be covalent or non-covalent modifications. Such modifications can be introduced into the antibodies or fragments by, e.g., reacting targeted amino acid residues of the polypeptide with an organic derivatizing agent that is capable of reacting with selected side chains or terminal residues. Suitable sites for modification can be chosen using any of a variety of criteria including, e.g., structural analysis or amino acid sequence analysis of the antibodies or fragments.

[0365] In some aspects, the antibodies or antigen-binding fragments thereof can be conjugated to a heterologous moiety. The heterologous moiety can be, e.g., a heterologous polypeptide, a therapeutic agent (e.g., a toxin or a drug), or a detectable label such as, but not limited to, a radioactive label, an enzymatic label, a fluorescent label, a heavy metal label, a luminescent label, or an affinity tag such as biotin or streptavidin. Suitable heterologous polypeptides include, e.g., an antigenic tag (FLAG (DYKDDDDK (SEQ ID NO: 241)), polyhistidine (6-His; HHHHHH (SEQ ID NO: 142), hemagglutinin (HA; YPYDVPDYA (SEQ ID NO: 242)), glutathione-S-transferase (GST), or maltose-binding protein (MBP)) for use in purifying the antibodies or fragments. Heterologous polypeptides also include polypeptides (e.g., enzymes) that are useful as diagnostic or detectable markers, for example, luciferase, a fluorescent protein (e.g., green fluorescent protein (GFP)), or chloramphenicol acetyl transferase (CAT).Suitable radioactive labels include, e.g.,32P,33P,14C,125I,1311,35S, and3H. Suitable fluorescent labels include, without limitation, fluorescein, fluorescein isothiocyanate (FITC), green fluorescent protein (GFP), DyLight™ 488, phycoerythrin (PE), propidium iodide (PI), PerCP, PE- Alexa Fluor® 700, Cy5, allophycocyanin, and Cy7. Luminescent labels include, e.g., any of a variety of luminescent lanthanide (e.g., europium or terbium) chelates. For example, suitable europium chelates include the europium chelate of diethylene triamine pentaacetic acid (DTPA) or tetraazacyclododecane- 1,4, 7, 10-tetraacetic acid (DOTA). Enzymatic labels include, e.g., alkaline phosphatase, CAT, luciferase, and horseradish peroxidase.

[0366] Two proteins (e.g., an antibody and a heterologous moiety) can be cross-linked using any of a number of known chemical cross linkers. Examples of such cross linkers are those which link two amino acid residues via a linkage that includes a "hindered" disulfide bond. In these linkages, a disulfide bond within the cross-linking unit is protected (by hindering groups on either side of the disulfide bond) from reduction by the action, for example, of reduced glutathione or the enzyme disulfide reductase. One suitable reagent, 4-succinimidyloxycarbonyl- > -methyl- (2-pyridyldithio) toluene (SMPT), forms such a linkage between two proteins utilizing a terminal lysine on one of the proteins and a terminal cysteine on the other. Heterobifunctional reagents that cross-link by a different coupling moiety on each protein can also be used. Other useful crosslinkers include, without limitation, reagents which link two amino groups (e.g., N-5-azido-2- nitrobenzoyloxy succinimide), two sulfhydryl groups (e.g., 1,4-bis-maleimidobutane), an amino group and a sulfhydryl group (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester), an amino group and a carboxyl group (e.g., 4-[p-azidosalicylamido]butylamine), and an amino group and a guanidinium group that is present in the side chain of arginine (e.g., p-azidophenyl glyoxal monohydrate).

[0367] In some aspects, a radioactive label can be directly conjugated to the amino acid backbone of the antibody. Alternatively, the radioactive label can be included as part of a larger molecule (e.g.,125I in meta-[125I]iodophenyl-N-hydroxysuccinimide ([125I]mIPNHS) which binds to free amino groups to form meta-iodophenyl (mIP) derivatives of relevant proteins (see, e.g., Rogers et al. (1997) J Nucl Med 38:1221-1229) or chelate (e.g., to DOTA or DTPA) which is in turn bound to the protein backbone. Methods of conjugating the radioactive labels or larger molecules / chelates containing them to the antibodies or antigen-binding fragments described herein are known in the art. Such methods involve incubating the proteins with the radioactivelabel under conditions (e.g., pH, salt concentration, and / or temperature) that facilitate binding of the radioactive label or chelate to the protein (sec, e.g., U.S. Patent No. 6,001,329).

[0368] Methods for conjugating a fluorescent label (sometimes referred to as a "fluorophore") to a protein (e.g., an antibody) are known in the art of protein chemistry. For example, fluorophores can be conjugated to free amino groups (e.g., of lysines) or sulfhydryl groups (e.g., cysteines) of proteins using succinimidyl (NHS) ester or tetrafluorophenyl (TFP) ester moieties attached to the fluorophores. In some aspects, the fluorophores can be conjugated to a heterobifunctional cross-linker moiety such as sulfo-SMCC. Suitable conjugation methods involve incubating an antibody protein, or fragment thereof, with the fluorophore under conditions that facilitate binding of the fluorophore to the protein. See, e.g., Welch and Redvanly (2003) "Handbook of Radiopharmaceuticals: Radiochemistry and Applications," John Wiley and Sons (ISBN 0471495603).

[0369] In some aspects, the antibodies or fragments can be modified, e.g., with a moiety that improves the stabilization and / or retention of the antibodies in circulation, e.g., in blood, serum, or other tissues. For example, the antibody or fragment can be PEGylated as described in, e.g., Lee et al. (1999) Bioconjug Chem 10(6): 973-8; Kinstler et al. (2002) Advanced Drug Deliveries Reviews 54:477-485; and Roberts et al. (2002) Advanced Drug Delivery Reviews 54:459-476 or HESylated (Fresenius Kabi, Germany; see, e.g., Pavisic et al. (2010) Int J Pharm 387(1-2): 110- 119). The stabilization moiety can improve the stability, or retention of, the antibody (or fragment) by at least 1.5 (e.g., at least 2, 5, 10, 15, 20, 25, 30, 40, or 50 or more) fold.In some aspects, the antibodies or antigen-binding fragments thereof described herein can be glycosylated. In some aspects, an antibody or antigen-binding fragment thereof described herein can be subjected to enzymatic or chemical treatment, or produced from a cell, such that the antibody or fragment has reduced or absent glycosylation. Methods for producing antibodies with reduced glycosylation are known in the ail and described in, e.g., U.S. patent no. 6,933,368; Wright et al. (1991) EMBO J 10(10):2717-2723; and Co et al. (1993) Mol Immunol 30:1361.EXAMPLESExample 1: CCR8 Expression in Tumors

[0370] To characterize CCR8 expression in tumors and specifically on Treg cells, transcriptomic and flow cytometry-based approaches were used. Analysis of transcriptomic datafrom The Cancer Genome Atlas (TCGA) revealed differential expression of CCR8 across 17 tumors analyzed (FIG. 1A). Of these, the tumor types with a high median CCR8 expression were head and neck squamous cell carcinoma (HNSCC) (0.5 FPKM), testicular (0.5 FPKM), non-small cell lung cancer (NSCLC) (0.4 FPKM), gastric (0.4 FPKM), breast cancer (0.3 FPKM) and pancreatic cancer (0.3 FPKM), and the tumors with low or negligible CCR8 expression were melanoma (0.1 FPKM), hepatocellular carcinoma (HCC; 0 FPKM) and glioblastoma (GBM; 0 FPKM). Upon testing the top 7 CCR8 expressing tumor types (Fig. 1A), a strong positive correlation between CCR8 and FOXP3 expression in HNSCC, gastric, NSCLC, Pancreatic and breast cancer (FIG. IB) was observed, while the testicular germ cell tumors (TGCT) showed a weak correlation. Thus, CCR8 expression is useful to identify an enrichment of the Treg signature within tumors.

[0371] To confirm CCR8 protein expression on intratumoral Tregs (CD4+FOXP3+), 69 human samples including 14 healthy donor PBMC and 55 dissociated primary tumor cells (DTCs) were analyzed by flow cytometry. CCR8 expressing cells were highly enriched on intratumoral Tregs (62 ± 19%) compared to peripheral Tregs (19 ± 5%) or other immune cell types, including intratumoral and peripheral conventional CD4+ T cells (9 ± 7% and 4 ± 2%, respectively), CD8+ T cells (3 ± 3% and 4 ± 3%, respectively), NK cells (7 ± 5% and 0 ± 0%, respectively), NKT cells (31 ± 13% and 2 ± 1%, respectively), B cells (1 ± 1% and 1 ± 0%, respectively), and CDl lb+ cells (2 ± 2% and 0 ± 0%, respectively) (FIG. 1C). Intratumoral Tregs expressed the highest density of CCR8 when compared to peripheral Tregs or to all other immune cell types except intratumoral NKT cells (FIG. ID). Interestingly, intratumoral NKT cells, which are a small immune cell subset in the tumors (< 1% of immune cells), expressed a high frequency (~ 2-fold lower than intratumor Tregs) and density of CCR8 (similar to intratumoral Tregs). These data support that CCR8 is enriched on intratumoral Treg cells in various solid tumor types.

[0372] Antibody mediated depletion of intratumoral Tregs requires the co-expression of both the target CCR8+ Tregs and effector NK cells and / or macrophages within the tumors. In order to evaluate the frequency and density of CCR8+ Tregs in a range of solid tumors (n = 12) multiplex immunofluorescence (mIF) was performed. Individual tumor microarrays were stained with a mIF panel, including anti-CCR8 and anti-FOXP3 antibodies, and images were processed by HALO analysis. Tumors expressing CCR8+ Tregs were ranked by the presence of CCR8+ Tregs and the percentage of CCR8+ Tregs in the Treg population. Eleven out of 12 of the tumors showed thepresence of CCR8+ Tregs, with RCC having a relatively low density in the tumor. Gastric cancer, cervical SCC, and HNSCC had the highest density of CCR8+ Tregs (FIG. 2A), and frequency of Tregs that are CCR8+ (FIG. 2B). To identify tumors that are enriched for both target and effector cells, NK cell density was determined by NKp46 staining and monocyte / macrophage abundance was determined by CD64 H-index. Amongst the analyzed tumor types, gastric cancer, cervical SCC and HNSCC had the highest co-enrichment of CCR8 and NK cells (FIG. 2C) or CCR8 and macrophages (FIG. 2D).Example 2: Co-expression of CCR8 and PD-L1 in Tumors

[0373] To evaluate the association of CCR8+ Tregs in tumors with PD-L1, a known marker associated with PD-1 inhibitor benefit, immunohistochemistry (IHC) for PD-L1 and mIF for FOXP3 and CCR8 expression were employed to examine HNSCC samples. The density of CCR8+ Tregs was higher in HNSCC tumors with a combined positive score (CPS) > 1 (FIG. 3A) but was not related to disease stage or HPV status in HNSCC (FIG. 3B). The CPS of PD-L1 is calculated: CPS = 100 x (PD-L1+ tumor cells / total number of viable tumor cells). In addition, IHC analysis demonstrated that PD-L1 expression was associated with higher levels of CCR8+ cells in NSCLC, gastric cancer and cervical SCC (FIG. 3C). PD-1 blockade increases the presence of Tregs in various tumors. In an ex vivo experiment where dissociated tumor cells (DTCs) from 16 treatment naive NSCLC tumors were treated with the anti-PD-1 antibody toripalimab, a significant increase in a Treg signature was observed (FIG. 4). Collectively, these findings demonstrate that CHS- 114 in combination with toripalimab improves immunotherapy treatment for cancer patients.Example 3: Generation of anti-CCR8 Antibodies

[0374] Monoclonal antibodies specific to human CCR8 were generated against an N- terminal fragment of CCR8.

[0375] Antibody Phage Panning, Cloning and Transfection

[0376] Recombinant proteins expressing either the N-terminal extracellular domain of human or cynomolgus CCR8 fused to a 6X His tag followed by mouse IgG2a-Fc (CCR8-Fc) were cloned into mammalian expression vectors (SEQ ID NOs: 173 and 174, respectively; Table 4). For the Human protein, the free cysteine as position 25 was mutated to a serine to prevent disulfide bonding. The resulting secreted proteins were expressed by transfection in CHO cells and were purified using Protein A and used as antigen for phage panning using Fab display library. For panning, the purified protein was coupled to M280 Tosyl beads or to ELISA plate and panningI l ldone using standard methods. Successive rounds of panning were performed on Human CCR8- ECD-Fc or in alternating rounds with cynomolgus CCR8-ECD-Fc, with unbound phage being removed by washing each round. The DNA from the resulting bound phage pool was isolated and the heavy and light chain sequences were cloned into a mammalian expression vector. Individual transformed colonies were grown separately in wells of a 96-well bacterial culture plate and the DNA was purified using Qiagen Turbo Miniprep Kit. The 96-well DNA mini-libraries were used to transfect CHO cells in the same 96 well format and the secreted antibody supernatants were harvested after three days incubation at 37°C, 7% CO2 incubator.Table 4: CCR8-ECD-Fc Sequences (signal peptide', CCR8 extracellular domain; 6X His tag and linker; and mouse IgG2a-Fc)

[0377] Flow cytometry of CHO supernatants

[0378] 293T cells expressing human CCR8, cynomolgus CCR8 , mouse CCR8 and humanCCR2 were harvested using Accutase® and 100,000 cells were dispensed to each well of a 96 well v-bottom plate. In some instances, the native human CCR8 expressing cell line Hut78 was also tested. The mini-library CHO supernatants were then added at a 1:2 final dilution to each cell type and allowed to incubate at 4°C for 1 hour. After pelleting, the cells were incubated with anti- human-Fc-biotin followed by streptavidin- APC or with anti-human-Fc-APC at 4°C for 30 minutes. After washing and fixation, the cells were ran on the FACS Canto II with propidium iodide for live / dead discrimination. The live cells were analyzed and clones that showed specific binding to CCR8 (human and / or cynomologus) but not CCR2 were sent for DNA sequencing and further testing.I 0379] Development of Anti-CCR8- 1

[0380] The parental antibody, anti-CCR8-parental-l, was developed by phage panning as outlined above on the human CCR8 N-terminal protein and had an affinity of 1 nM on the 293T- Human CCR8 cell line. To improve affinity, a library was created in Vaccinia Virus where the CDR3 of the heavy chain was randomized. A library of 12,000 CDR3 variants was created in vaccinia. Upon overnight infection with the heavy chain CDR3 library (one clone per cell) and the parental light chain virus construct, full-length human IgG antibody is expressed on the cell surface (reference). Infected A431 cells were incubated with the human CCR8-N-terminal protein at a final concentration of 0.1 pg / ml, washed and stained with anti-Fc-Dylight649 to detect CCR8 protein binding and anti-Hu-Fab-FITC to detect antibody expression on the cell surface. Two thousand cells with high antibody expression and high CCR8 binding were sorted and the virus was amplified. DNA was extracted from the virus pool and the new heavy chain V genes were cloned into the mammalian cell expression vector containing a signal sequence and the human IgGl constant domain (resulting in full length IgGl) and co-transfected along with the parental light chain in CHO cells for clone evaluation as outlined above. The anti-CCR8-l antibody (comprising a variable heavy chain having the amino acid sequence set forth in SEQ ID NO: 41 and a variable light chain having the amino acid sequence set forth in SEQ ID NO: 43) was found to have three amino acid mutations in the CDR3 as compared to the parental heavy chain and anaffinity of 0.4 nM on the 293T-Human CCR8 cell line. The anti-CCR8-l antibody was found to bind huCCR8-ECD-Fc but not CyCCR8-ECD-Fc, and the antibody preferentially bound 293T cells expressing HuCCR8 but not cyno CCR8, human CCR2, or mouse CCR8.

[0381] Development of Anti-CCR8-1-1, Anti-CCR8-l-2, Anti-CCR8-l-3, Anti-CCR8-1- 4, and Anti-CCR8-l-5

[0382] The heavy chain of the parental antibody (anti-CCR8-parental-l) was cloned into Vaccinia Virus to facilitate light chain shuffle panning with Vaccinex’s Vaccinia Display human IgG libraries. Briefly, 6xl08BHK cells were infected with the heavy chain form the anti-CCR8- parental-1 antibody (H23188) and a pool of lambda light chains from naive sources. After two days incubation at 37°C, 7% CO2, the supernatant was harvested and the vaccinia vims particles expressing a library of human IgG on their surface were pelleted by centrifugation. The pellet was resuspended and incubated with the purified Human CCR8-Fc protein coupled to M280 Tosyl beads. The unbound virus was washed away, and the bound virus was amplified for subsequent rounds. After performing two rounds on human CCR8-Fc protein followed by two rounds on cyno CCR8-Fc protein, the DNA from the bound pool was extracted and the new light chains cloned into a mammalian expression vector for CHO transfection along with the parental heavy chain and flow cytometry analysis as detailed above. The anti-CCR8-l-l, anti-CCR8-l-2, anti-CCR8-l-3, anti-CCR8-l-4, and anti-CCR8-l...

Claims

CLAIMSWe claim:

1. A method for treating a subject having a tumor or a cancer comprising administering to the subject a pharmaceutical composition comprising about 100 mg to about 3,000 mg of an anti-CCR8 antibody or an antigen-binding portion thereof that specifically binds to one or more amino acids within the N-terminal extracellular domain of human CCR8, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

2. A method of treating a subject having a tumor or a cancer comprising: a) collecting a baseline blood sample from the subject prior to administering a dose of an anti-CCR8 antibody or antigen-binding portion thereof to the subject; b) measuring a baseline concentration of each of one or more cytokines in the baseline blood sample; c) administering at least one dose of the anti-CCR8 antibody or antigen-binding portion thereof to the subject for a treatment cycle; d) collecting a post-dose blood sample from the subject during or after the treatment cycle, e) measuring a post-dose concentration of each of the one or more cytokines in the post-dose blood sample; and f) treating the subject with a first treatment regimen comprising administering the anti-CCR8 antibody or antigen-binding portion thereof if the post-dose concentration is greater than the baseline concentration, or treating the subject with a second treatment regimen comprising administering toripalimab and the anti-CCR8 antibody or antigen-binding portion thereof if the post-dose concentration is equal to or less than the baseline concentration.

3. The method of claim 2, wherein the anti-CCR8 antibody or antigen binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

4. The method of claim 2 or 3, wherein step c) comprises administering the anti-CCR8 antibody or antigen-binding portion thereof to the subject on day 1 of the treatment cycle, and step d) comprises collecting the post-dose blood sample on the eighth day of the treatment cycle or on the first day of a second treatment cycle.

5. The method of any one of claims 2-4, wherein the one or more cytokines are selected from IFN-y, TNFa, CXCL10, IL-12 / IL-23p40, M-CSF-1, IL-la, IL-27, VCAM-1, IL-10, MlP-ly, IL-2, Eotaxin, IL-18, Granzyme B, and MIPIb.

6. The method of claim 5, wherein the one or more cytokines comprise IFN-y.

7. The method of claim 5, wherein the one or more cytokines comprise TNFa.

8. The method of claim 5, wherein the one or more cytokines comprise CXCL10.

9. The method of claim 5, wherein the one or more cytokines comprise IL-12 / IL-23p40.

10. The method of claim 5, wherein the one or more cytokines comprise M-CSF-1.

11. The method of claim 5, wherein the one or more cytokines comprise IL-l .

12. The method of claim 5, wherein the one or more cytokines comprise IL-27.

13. The method of claim 5, wherein the one or more cytokines comprise VCAM-1.

14. The method of claim 5, wherein the one or more cytokines compriseIL-10.

15. The method of claim 5, wherein the one or more cytokines comprise MlP-ly.

16. The method of claim 5, wherein the one or more cytokines comprise IL-2.

17. The method of claim 5, wherein the one or more cytokines comprise Eotaxin.

18. The method of claim 5, wherein the one or more cytokines comprise IL- 18.

19. The method of claim 5, wherein the one or more cytokines comprise Granzyme B.

20. The method of claim 5, wherein the one or more cytokines comprise MIPIb.

21. A method of treating a subject having a tumor or a cancer comprising:a) collecting a baseline sample from the subject prior to administering a dose of an anti-CCR8 antibody or antigen-binding portion thereof to the subject; b) measuring a baseline frequency of each of one or more cell surface markers in the baseline sample; c) administering at least one dose of the anti-CCR8 antibody or antigen-binding portion thereof to the subject for a treatment cycle; d) collecting a post-dose sample from the subject during or after the treatment cycle, e) measuring a post-dose frequency of each of the one or more cell surface markers in the post-dose sample; and f) treating the subject with a first treatment regimen comprising administering the anti-CCR8 antibody or antigen-binding portion thereof if the post-dose frequency is greater than the baseline frequency, or treating the subject with a second treatment regimen comprising administering toripalimab and the anti-CCR8 antibody or antigen-binding portion thereof if the post-dose frequency is equal to or less than the baseline frequency.

22. The method of claim 21, wherein the anti-CCR8 antibody or antigen binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

23. The method of claim 21 or 22, wherein step c) comprises administering the anti-CCR8 antibody or antigen-binding portion thereof to the subject on day 1 of the treatment cycle, and step d) comprises collecting the post-dose sample on the eighth day of the treatment cycle or on the first day of a second treatment cycle.

24. The method of any one of claims 21-23, wherein the one or more cell surface markers are selected from 4-1BB, CD25, CD107A, B7-H3, CD83, CD86, HLA-DR, CD40, PD-L1, and a combination thereof.

25. The method of any one of claims 21-24, comprising measuring the baseline frequency and the post-dose frequency for a specified cell population.

26. The method of claim 25, wherein the one or more cell surface markers are selected from 4-1BB, CD25, CD107A, and a combination thereof, and wherein the specified cell population is NK cells.

27. The method of claim 26, wherein the one or more cell surface markers comprise 4- IBB.

28. The method of claim 26, wherein the one or more cell surface markers comprise CD25.

29. The method of claim 26, wherein the one or more cell surface markers comprise CD 107a.

30. The method of claim 25, wherein the one or more cell surface markers are selected from B7-H3, CD83, CD86, HLA-DR, CD40, and a combination thereof, and wherein the specified cell population is monocytes.

31. The method of claim 30, wherein the one or more cell surface markers comprise B7-H3.

32. The method of claim 30, wherein the one or more cell surface markers comprise CD83.

33. The method of claim 30, wherein the one or more cell surface markers comprise CD86.

34. The method of claim 30, wherein the one or more cell surface markers comprise HLA- DR.

35. The method of claim 30, wherein the one or more cell surface markers comprise CD40.

36. The method of any preceding claim, wherein the subject has Kaposi's sarcoma, leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, myeloblasts promyelocyte myelomonocytic monocytic erythroleukemia, chronic leukemia, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt’s lymphoma and marginal zone B cell lymphoma, Polycythemia vera Lymphoma, Hodgkin's disease, non-Hodgkin's disease, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, a solid tumor, a sarcoma, a carcinoma, soft tissue sarcoma, fibrosarcoma, myxosarcoma, liposarcoma, chrondro sarcoma, osteogenic sarcoma, osteosarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon sarcoma, colorectal carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatocellular carcinoma (HCC), hepatoma, bile duct carcinoma,choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, uterine cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, non- small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma, retinoblastoma, nasopharyngeal carcinoma, esophageal carcinoma, basal cell carcinoma, biliary tract cancer, bladder cancer, bone cancer, brain and central nervous system (CNS) cancer, cervical cancer, choriocarcinoma, colorectal cancers, connective tissue cancer, cancer of the digestive system, endometrial cancer, esophageal cancer, eye cancer, head and neck cancer, gastric cancer, gastroesophageal junction (GEJ) cancer, intraepithelial neoplasm, kidney cancer, larynx cancer, liver cancer, lung cancer (small cell, large cell), melanoma, neuroblastoma; oral cavity cancer (for example lip, tongue, mouth and pharynx), ovarian cancer, pancreatic cancer, retinoblastoma, rhabdomyosarcoma, rectal cancer, a cancer of the respiratory system, sarcoma, skin cancer, stomach cancer, testicular cancer, thyroid cancer, uterine cancer, and cancer of the urinary system, ductal carcinoma, or a combination thereof.

37. The method of any preceding claim, wherein the subject has a solid tumor.

38. The method of any preceding claim, wherein the subject has a carcinoma.

39. A method of treating a subject having a head and neck cancer, the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

40. The method of any preceding claim, wherein the subject has a head and neck squamous cell carcinoma (HNSCC).

41. The method of any preceding claim, wherein the subject has a squamous cell carcinoma (SCC) of pharynx (oropharynx, hypopharynx, or nasopharynx), larynx, oral cavity, salivary gland, or paranasal sinus.

42. The method of any preceding claim, wherein the subject has an oropharyngeal cancer that expresses HPV pl6 and / or pl 8.

43. A method of treating a subject having a gastric cancer, the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

44. A method of treating a subject with a gastroesophageal junction (GEJ) cancer, the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

45. The method of any preceding claim, wherein the cancer is refractory or relapsed.

46. The method of any preceding claim, wherein the cancer is advanced, locally advanced, or metastatic.

47. The method of any preceding claim, wherein the tumor or cancer expresses HPV pl6 and / or pl 8.

48. The method of any preceding claim, wherein the tumor or cancer has micro satellite stability (MSS) and / or proficient mismatch repair (pMMR).

49. A method of treating a subject having a tumor without inducing one or more treatment emergent adverse effects (TEAEs), the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acidsequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

50. The method of claim 49, wherein the one or more TEAEs is hypokalaemia, abdominal pain, cough, embolism, tumor pain, anemia, increased aspartate aminotransferase, constipation, urinary retention, hypomagnesaemia, or hyponatremia.

51. A method of treating a subject having a PD-L1 positive tumor or cancer, the method comprising administering to the subject an anti-CCR8 antibody or antigen-binding portion thereof comprising a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

52. The method of claim 51, wherein the tumor or cancer has a combined positive score (CPS) of PD-Ll of > 1.

53. The method of claim 51 or 52, wherein the subject has previously been treated with a PD- 1 inhibitor.

54. The method of any one of claims 51-53, wherein the tumor or cancer is a non-small cell lung cancer (NSCLC).

55. The method of any one of claims 51-53, wherein the tumor or cancer is a gastric cancer.

56. The method of any one of claims 51-53, wherein the tumor or cancer is a cervical squamous cell carcinoma (SCC).

57. A method of increasing a concentration of one or more cytokines in a subject comprising administering to the subject a first treatment regimen comprising about 100 mg to about 3,000 mg of an anti-CCR8 antibody or an antigen-binding portion thereof, or a second treatment regimen comprising toripalimab and the anti-CCR8 antibody or antigenbinding portion thereof, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprisingthe amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

58. The method of claim 57, wherein the one or more cytokines are selected from IFN-y, TNFa, CXCL10, IL-12 / IL-23 / p40, M-CSF-1, IL-la, IL-27, VCAM-1, IL-1 , MIP-ly, IL-2, Eotaxin, IL-18, Granzyme B, and MIPIb.

59. The method of claim 58, wherein the one or more cytokines comprise IFN-y.

60. The method of claim 58, wherein the one or more cytokines comprise TNFa.

61. The method of claim 58, wherein the one or more cytokines comprise CXCL10.

62. The method of claim 58, wherein the one or more cytokines comprise IL-12 / IL-23p40.

63. The method of claim 58, wherein the one or more cytokines comprise M-CSF-1.

64. The method of claim 58, wherein the one or more cytokines comprise IL-l .

65. The method of claim 58, wherein the one or more cytokines comprise IL-27.

66. The method of claim 58, wherein the one or more cytokines comprise VCAM-1.

67. The method of claim 58, wherein the one or more cytokines compriseIL-10.

68. The method of claim 58, wherein the one or more cytokines comprise MIP-ly.

69. The method of claim 58, wherein the one or more cytokines comprise IL-2.

70. The method of claim 58, wherein the one or more cytokines comprise Eotaxin.

71. The method of claim 58, wherein the one or more cytokines comprise IL- 18.

72. The method of claim 58, wherein the one or more cytokines comprise Granzyme B.

73. The method of claim 58, wherein the one or more cytokines comprise MIPIb.

74. The method of any one of claims 57-73, wherein the concentration is increased by at least 1.05-fold, 1.1-fold, 1.15-fold, 1.2-fold, 1.25-fold, 1.3-fold, 1.35-fold, 1.4-fold, 1.45-fold, 1.5-fold, 1.55-fold, 1.6-fold, 1.65-fold, 1.7-fold, 1.75-fold, 1.8-fold, 1.85-fold, 1.9-fold, 1.95-fold, 2-fold, 2.25-fold, 2.5-fold, 2.75-fold, 3-fold, or any range between 1.05-fold and 3-fold.

75. A method of increasing a frequency of one or more cell surface markers in a tumor or a cell population of a subject comprising administering to the subject a first treatment regimen comprising about 100 mg to about 3,000 mg of an anti-CCR8 antibody or anantigen-binding portion thereof, or a second treatment regimen comprising toripalimab and the anti-CCR8 antibody or antigen-binding portion thereof, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

76. The method of claim 75, wherein the one or more cell surface markers are selected from 4-1BB, CD25, CD107A, B7-H3, CD83, CD86, HLA-DR, CD40, PD-L1, and a combination thereof.

77. The method of claim 76, wherein the one or more cell surface markers comprise 4- IBB.

78. The method of claim 76, wherein the one or more cell surface markers comprise CD25.

79. The method of claim 76, wherein the one or more cell surface markers compriseCD107a.

80. The method of claim 76, wherein the one or more cell surface markers comprise B7-H3.

81. The method of claim 76, wherein the one or more cell surface markers compriseCD83.

82. The method of claim 76, wherein the one or more cell surface markers comprise CD86.

83. The method of claim 76, wherein the one or more cell surface markers comprise HLA- DR.

84. The method of claim 76, wherein the one or more cell surface markers comprise CD40.

85. The method of claim 76, wherein the one or more cell surface markers comprise PD-L1.

86. The method of any one of claims 75-85, wherein the frequency is increased by at least about 5%, at least about 10%, at least about 12%, at least about 15%, at least about 18%, at least about 20%, at least about 23%, at least about 25%, at least about 27%, at least about 30%, at least about 32%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, or at least about 75%.

87. The method of any preceding claim, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 41.

88. The method of any preceding claim, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 43.

89. The method of any preceding claim, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises: a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 41 and a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 43.

90. The method of any preceding claim, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a single-chain variable fragment (scFv) of an antibody.

91. The method of any one of claims 1-90, wherein the anti-CCR8 antibody or antigenbinding portion thereof comprises a humanized antibody; or a chimeric antibody.

92. The method of any one of claims 1-90, wherein the anti-CCR8 antibody or antigenbinding portion thereof comprises a bispecific antibody, a T cell engager (TCE), a bispecific T cell engager (BiTE), a multispecific antibody, a biparatopic antibody, an immunoconjugate, an antibody drug conjugate, or a combination thereof.

93. The method of claim 92, wherein the bispecific antibody, the TCE, the BiTe, the multispecific antibody, or the biparatopic antibody comprises (i) a first VH domain, comprising a first VH CDR1, a first VH CDR2, and a first VH CDR3; (ii) a first VL domain, comprising a first VL CDR1, a first VL CDR2, and a first VL CDR3; (iii) a second VH domain, comprising a second VH CDR1, a second VH CDR2, and a second VH CDR3; and (iv) a second VL domain, comprising a second VL CDR1, a second VL CDR2, and a second VL CDR3; wherein the first VH CDR1 comprises the amino acid sequence set forth in SEQ ID NOs: 45, the first VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 46, the first VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 47, the first VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 48, the first VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 49, and the first VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 50; and wherein:(a) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NOs: 5, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 6,the second VH CDR3 comprises the amino acid sequence set forth in SEQ TD NO: 7, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 8, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 9, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 10;(b) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 15, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 16, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 17, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 18, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 19, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 20;(c) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 25, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 26, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 27, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 28, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 29, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 30;(d) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 35, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 36, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 37, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 38, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 39, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 40;(e) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 55, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 56, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 57, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 58, the second VL CDR2 comprises the amino acid sequence set forth in SEQID NO: 59, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 60;(f) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 65, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 66, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 67, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 68, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 69, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 70;(g) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 75, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 76, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 77, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 78, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 79, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 80;(h) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 85, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 86, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 87, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 88, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 89, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 90;(i) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 95, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 96, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 97, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 98, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 99, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 100;(j) the second VH CDR1 comprises the amino acid sequence set forth in SEQ TD NO: 125, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 126, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 127, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 128, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 129, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 130;(k) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 155, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 156, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 157, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 158, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 159, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 160; or(l) the second VH CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 165, the second VH CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 166, the second VH CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 167, the second VL CDR1 comprises the amino acid sequence set forth in SEQ ID NO: 168, the second VL CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 169, and the second VL CDR3 comprises the amino acid sequence set forth in SEQ ID NO: 170.

94. The method of any preceding claim, wherein the anti-CCR8 antibody or antigen-binding portion thereof is afucosylated.

95. The method of any preceding claim, wherein the anti-CCR8 antibody or the antigenbinding portion thereof comprises an IgGl Fc domain.

96. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose of about 100 to about 1,500 mg.

97. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose of about 100 mg, about 300 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, or about 1200 mg.

98. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose of about 300 mg.

99. The method of any one of claims 1-97, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose of about 700 mg.

100. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof weekly (QW), bi-weekly (Q2W), every 3 weeks (Q3W), or every 4 weeks (Q4W).

101. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof every 3 weeks (Q3W).

102. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof parenterally.

103. The method of claim 102, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof intravenously, subcutaneously, intramuscularly, or intraperitoneally.

104. The method of claim 102, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof via intravenous infusion.

105. The method of any preceding claim, comprising:(a) enhancing an immune response to a tumor;(b) reducing, depleting, or killing tumor infiltrating regulatory T (“Treg”) cells;(c) inducing internalization of CCR8 in tumor infiltrating regulatory T (“Treg”) cells;(d) activating macrophages;(e) inducing antibody-dependent cellular phagocytosis (ADCP) in a subject following administration of the anti-CCR8 antibody;(f) activating NK cells,(g) inducing NK cell mediated killing of tumor infiltrating regulatory T (“Treg”) cells;(h) inducing antibody-dependent cellular cytotoxicity (ADCC) in a subject following administration of the anti-CCR8 antibody;(i) inducing upregulation of 4-1BB, CD25, CD107a, or a combination thereof on the surface of NK cells;(j) inducing down-regulation of CD16 on the surface of NK cells in the subject;(k) inducing upregulation of B7-H3, CD83, CD86, HLA-DR, CD40, or a combination thereof on the surface of monocytes;(l) inducing secretion of one or more cytokines; or(m)a combination thereof.

106. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose capable of inducing antibodydependent cellular phagocytosis (ADCP) in the subject.

107. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose capable of reducing, depleting, or killing tumor infiltrating regulatory T ("Treg") cells in the subject.

108. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose capable of depleting the number of tumor infiltrating Treg cells relative to the number of tumor infiltrating Treg cells in the absence of the antibody or antigen binding portion thereof.

109. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose effective for depleting the number of tumor infiltrating Treg cells by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, or at least about 50% relative to the number of tumor infiltrating Treg cells in the absence of the antibody or antigen binding portion thereof.

110. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof at a dose capable of inducing internalization of CCR8 by tumor infiltrating Treg cells.

111. The method of any preceding claim, comprising administering the anti-CCR8 antibody or antigen-binding portion thereof in combination with an additional anticancer agent.

112. The method of claim 111, wherein the additional anticancer agent is selected from a small molecule, an antibody or antigen binding fragment thereof, a polypeptide, a radiation therapy, a surgery, or a combination thereof.

113. The method of claim 111 or 112, wherein the additional anticancer agent comprises a chemotherapy.

114. The method of claim 113, wherein the chemotherapy comprises a platinum-based chemotherapy.

115. The method of claim 111 or 112, wherein the additional anticancer agent is an immune checkpoint inhibitor.

116. The method of claim 111 or 112, wherein the additional anticancer agent is selected from a PD-1 inhibitor, PD-L1 inhibitor, PD-L2 inhibitor, LAG-3 inhibitor, TIGIT inhibitor, CD112R inhibitor, TIM3 inhibitor, TAM inhibitor, STING agonist, 4- 1BB agonist, CL22 inhibitor, VISTA inhibitor, CD47 inhibitor, B7-H3 inhibitor, CTLA4 inhibitor, CCR4 inhibitor, 0X40 inhibitor, OX40L, IDO1 inhibitor, CD70 inhibitor, CD27 inhibitor, or A2AR inhibitor.

117. The method of claim 111 or 112, wherein the additional anticancer agent is selected from PDR001, nivolumab, pembrolizumab, pidilizumab, MEDI0680, REGN2810, TSR-042, PF-06801591, AMP-224, FAZ053, Atezolizumab, Avelumab, Durvalumab, and BMS-936559, Sunitinib, Cabozantinib, Axitinib, Lenvatinib, Everolimus, Bevacizumab, epacadostat, NKTR-214 (CD- 122-biased agonist), Tivozanib, abexinostat, Ipilimumab, tremelimumab, Pazopanib, Sorafenib, Temsirolimus, Ramucirumab, niraparib, savolitinib, vorolanib (X-82), Regorafenib, Donafenib, Camrelizumab (SHR- 1210), pexastimogene devacirepvec (JX-594), apatinib (YN968D1), encapsulated doxorubicin, Tivantinib (ARQ197), ADI- PEG 20, binimetinib, apatinib mesylate, nintedanib, lirilumab, Nivolumab, Pembrolizumab, Atezolizumab, Avelumab, Durvalumab, Cemiplimab-rwlc, tislelizumab, spartalizumab, cemiplimab, cetrelimab, toripalimab, sintilimab, SHR-1210, PDR001, MGA012, PDR001, AB122, JTX-4014, BGB-108, BCD-100, BAT1306, LZM009, AK105, HLX10, BMS-935559, MEDI4736, MPDL3280A, MSB0010718C, KN035, CS1001, SHR-1316, CBT-502, A167, STI-A101, CK-301, BGB-A333, MSB-2311, HLX20, LY3300054, tremelimumab, AGEN1884, CP-675,206, BMS-986016, LAG525, INCAGN2385, eftilagimod alpha, MEDI9447, OMP-31M32, JNJ-61610588, CA-170, enoblituzumab, MGD009, 8H9, CPI-444, BMS-936561, INCAGN2390, sabatolimab (MBG453), Hu5F9-G4, TTI-621, INCAGN2390, TSR-022, MEDI0562, MOXR-0916, PF-04518600, GSK3174998, BMS-986178, 9B12, obinutuzumab or rituximab.

118. The method of any one of claims 11 1 or 1 12 or 1 15, wherein the immune checkpoint inhibitor is a PD- 1 inhibitor.

119. The method of claim 118, wherein the PD-1 inhibitor is toripalimab.

120. The method of claim 119, comprising administering toripalimab at a dose of about 120 mg to about 720 mg, or about 240 mg to about 480 mg, or about 240 mg to about 360 mg.

121. The method of claim 120, comprising administering toripalimab at a dose of about 120 mg, about 240 mg, about 340 mg, about 360 mg, or about 480 mg.

122. The method of any one of claims 119-121, comprising administering toripalimab weekly (QW), bi-weekly (Q2W), every 3 weeks (Q3W), or every 4 weeks (Q4W).

123. The method of claim 121, wherein toripalimab is administered every 3 weeks (Q3W).

124. The method of any one of claims 119-123, comprising administering toripalimab concurrently with the anti-CCR8 antibody or antigen-binding portion thereof.

125. The method of any one of claims 119-123, comprising administering toripalimab sequentially before or after the anti-CCR8 antibody or antigen-binding portion thereof.

126. The method of any one of claims 111-125, comprising administering the additional anticancer agent orally or parenterally.

127. The method of claim 126, comprising administering the additional anticancer agent intravenously, subcutaneously, intramuscularly, or intraperitoneally.

128. The method of claim 126, comprising administering the pharmaceutical composition comprising the anti-CCR8 antibody or antigen-binding portion thereof and the anticancer agent via intravenous infusion.

129. A method of treating a subject having a tumor or a cancer comprising intravenously administering to the subject at least 100 mg of an anti-CCR8 antibody or an antigen-binding portion thereof comprising a VH chain comprising the amino acid sequence set forth in SEQ ID NO: 41 and comprising a VL chain comprising the amino acid sequence set forth in SEQ ID NO: 43 every 3 weeks (Q3W).

130. The method of claim 129, comprising administering about 100 mg to about 1,000 mg, 150 to 900 mg, 200 to 800 mg, or 300 to 700 mg of the anti-CCR8 antibody or antigen-binding portion thereof to the subject Q3W.

131. The method of claim 129 or 130, wherein the anti-CCR8 antibody or antigenbinding portion thereof is afucosylatcd.

132. The method of any one of claims 129-131, wherein the anti-CCR8 antibody or the antigen-binding portion thereof comprises an IgGl Fc domain.

133. The method of any one of claims 129-132, wherein the subject has head and neck squamous cell carcinoma.

134. The method of any one of claims 129-133, further comprising intravenously administering 120 mg to 720 mg toripalimab to the subject.

135. The method of any one of claims 129-134, further comprising intravenously administering 240 mg toripalimab to the subject.

136. The method of claim 134 or 135, comprising administering toripalimab Q3W.

137. A method of increasing anti-tumor efficacy, therapeutic window, half-life, or exposure of an anti-PDl antibody without increasing adverse events in a subject, comprising administering to the subject an anti-CCR8 antibody, or antigen-binding portion thereof, in combination with the anti-PDl antibody.

138. The method of claim 137, wherein the anti-PDl antibody is toripalimab.

139. The method of claim 137 or 138, wherein the adverse events comprise one or more of increase in alanine aminotransferase, increase in aspartate aminotransferase, infusion-related reaction, increase in lipase, diarrhea, decrease in white blood cell count, fatigue, pain, decrease in platelet count, oropharyngeal fistula, acute respiratory failure, increase in amylase, anemia, increase in blood alkaline phosphatase, hypoxia, wound infection, increase in blood bilirubin, increase in blood thyroid stimulating hormone, dysgeusia, dyspnea, hypernatremia, musculoskeletal chest pain, decrease in neutrophil count, aspiration pneumonia, pyrexia, maculopapular rash, COVID-19, acneiform dermatitis, dry eye, food intolerance, headache, hyponatremia, mouth hemorrhage, nausea, oral pain, and rash.

140. A method of increasing anti-tumor efficacy, therapeutic window, half-life, or exposure of toripalimab by administering toripalimab to a subject in combination with an anti-CCR8 antibody, or antigen-binding portion thereof.

141. The method of any one of claims 137-140, wherein the anti-CCR8 antibody or antigen -binding portion thereof comprises a VH CDR1 comprising the amino acidsequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50.

142. A method of maintaining a serum concentration of an anti-CCR8 antibody, or antigen-binding portion thereof, at or above a target trough concentration in a subject, comprising administering the anti-CCR8 antibody, or antigen-binding portion thereof, to the subject at a dose of about 100 mg to about 3000 mg, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50, wherein the target trough concentration is about 10 pg / mL to about 50 pg / mL.

143. The method of claim 142, wherein the target trough concentration is about 10 pg / mL, about 15 pg / mL, about 20 pg / mL, about 25 pg / mL, about 30 pg / mL, about 35 pg / mL, about 40 pg / mL, about 45 pg / mL, or about 50 pg / mL.

144. The method of claim 142, wherein the target trough concentration is about 10 pg / mL to about 35 pg / mL.

145. A method of increasing the efficacy of an immunotherapy agent in a subject with a tumor administered the immunotherapy agent, comprising administering an anti-CCR8 antibody, or antigen-binding portion thereof, to the subject at a dose of about 100 mg to about 3000 mg, wherein the anti-CCR8 antibody or antigen-binding portion thereof comprises a VH CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 45, a VH CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 46, a VH CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 47, a VL CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 48, a VL CDR2 comprising the amino acidsequence set forth in SEQ ID NO: 49, and a VL CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 50, wherein the step of administering the anti-CCR8 antibody or antigen-binding portion thereof causes an increase in a ratio of CD8+T cells to Tregs in the tumor microenvironment compared to a baseline ratio.

146. The method of claim 145, wherein the immunotherapy agent is an immune checkpoint inhibitor, a T cell engager, or a CAR-T cell therapy.

147. The method of claim 145 or 146, wherein the immunotherapy agent is an immune checkpoint inhibitor.

148. The method of claim 147, wherein the immune checkpoint inhibitor is selected from the group consisting of: atezolizumab, avelumab, cemiplimab, cosibelimab, dostarlimab, durvalamab, nivolumab, pembrolizumab, tislelizumab, toripalimab, rilatimab, ipilimumab, tremelimumab, and a combination thereof.

149. The method of claims 145 or 146, wherein the immunotherapy agent is a T cell engager.

150. The method of claim 145 or 146, wherein the immunotherapy agent is a CAR-T cell therapy.

151. The method of any one of claims 145-150, wherein the step of administering the anti-CCR8 antibody or antigen-binding portion thereof causes an increase in CD8+T cells in the tumor microenvironment.

152. The method of any one of claims 145-151, wherein the step of administering the anti-CCR8 antibody or antigen-binding portion thereof causes a decrease in Tregs in the tumor microenvironment.

153. The method of any one of claims 145-151, comprising administering the anti- CCR8 antibody or antigen-binding portion thereof at a dose such that the ratio of CD8+T cells to Tregs in the tumor microenvironment increases about 5-fold, about 10-fold, about 15-fold, about 20-fold, about 25-fold, about 30-fold, about 35-fold, about 40-fold, about 45-fold, or about 50-fold compared to the baseline ratio.

154. The method of any one of claims 142-153, comprising administering the anti- CCR8 antibody, or antigen-binding portion thereof, to the subject at a dose of about 200 mg to about 1000 mg.

155. The method of any one of claims 142- 153, comprising administering the anti- CCR8 antibody, or antigen-binding portion thereof Q2W, Q3W, Q4W, or Q6W.

156. The method of any one of claims 142-155, comprising administering the anti- CCR8 antibody, or antigen-binding portion thereof, to the subject at a dose of about 300 mg.

157. The method of any one of claims 142-156, comprising administering the anti- CCR8 antibody, or antigen-binding portion thereof, at a dose of about 300 mg Q3W.

158. The method of any one of claims 142-155, comprising administering the anti- CCR8 antibody, or antigen-binding portion thereof, to the subject at a dose of about 700 mg.

159. The method of any one of claims 142-155 or 158, comprising administering the anti-CCR8 antibody, or antigen-binding portion thereof, at a dose of about 700 mg Q3W.

160. The method of any one of claims 142-159, further comprising administering toripalimab to the subject.

161. The method of any one of claims 1-122, 124-134, and 137-157, wherein toripalimab is administered at a dosage of 340 mg Q4W.

Citation Information

Patent Citations

  • Method of making uniformly sized liposomes and liposomes so made

    EP0036676A1

  • Continuous release pharmaceutical compositions

    EP0058481A1

  • Lipids in the aqueous phase

    EP0088046A2

  • Regulating peptide-containing pharmaceutical preparations with retarded release, and process for their preparation

    EP0133988A2

  • Pharmaceutical composition containing urokinase

    EP0143949A1