Functionalization of ace-trna encoding synthetic linear picovectors

WO2026006151A3PCT designated stage Publication Date: 2026-02-12UNIVERSITY OF ROCHESTER
View PDF 8 Cites 0 Cited by

Patent Information

Application Number
PCT/US2025/034736
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-11-12
Filing Date
2025-06-23
Publication Date
2026-02-12

AI Technical Summary

Technical Problem

Existing technologies fail to effectively suppress premature termination codons (PTCs) caused by nonsense mutations, leading to the production of truncated and nonfunctional proteins, which are associated with a range of severe genetic disorders.

Method used

Development of ACE-tRNA constructs, including oligonucleotide sets and CEDT molecules, functionalized with nuclear targeting moieties such as NLS and DTS, to enhance nuclear delivery and translation readthrough of full-length proteins.

Benefits of technology

The ACE-tRNA constructs significantly enhance PTC suppression, restoring functional protein expression and improving therapeutic outcomes for genetic disorders by increasing nuclear localization and translation efficiency.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader

Abstract

The present disclosure relates to compositions and methods for treating genetic disorders caused by nonsense mutations using anticodon-engineered transfer RNA (ACE-tRNA) constructs. These DNA-based ACE-tRNA constructs are designed to suppress premature termination codons (PTCs) and restore the expression of full-length, functional proteins. The disclosure further provides formulations of ACE-tRNA constructs with poly(amine-co-ester) (PACE) polymeric nanoparticles to improve stability, protect nucleic acids, and enhance delivery to airway epithelial cells. Also described are functionalized ACE-tRNA Picovectors (sLPVs) incorporating targeting elements such as nuclear localization signals (NLSs), nucleolar localization sequences (NoLSs), and DNA nuclear targeting sequences (DTSs) to improve nuclear import and localization.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] FUNCTIONALIZATION OF ACE-TRNA ENCODING SYNTHETIC LINEAR PICOVECTORS

[0002] REFERENCE TO A SEQUENCE LISTING

[0003] This application incorporates by reference the Sequence Listing submitted in Computer Readable Form as a xml file named “Sequence Listing_161118.08302. xml” created on May 29, 2025 and containing 9,779 bytes. The information in the electronic format of the sequence listing is incorporated herein by reference in its entirety.

[0004] CROSS-REFERENCE TO RELATED APPLICATIONS

[0005] This application claims priority under 35 U.S.C. §119(e) to U.S. Provisional Patent Application No. 63 / 663,222, filed June 24, 2024 and U.S. Provisional Patent Application No. 63 / 719,360, filed November 12, 2024. The foregoing applications are incorporated by reference herein in their entireties.

[0006] GOVERNMENT INTERESTS

[0007] This invention was made with government support under HL153988 awarded by the National Institutes of Health. The government has certain rights in the invention.

[0008] FIELD OF THE INVENTION

[0009] This invention relates to vectors, such as synthetic linear picovectors, that encode anticodon-edited transfer RNAs (ACE-tRNAs), as well as to agents and methods for producing such vectors. This invention also relates to ACE-tRNAs and related agents and methods for treating disorders associated with premature termination codons (PTCs).

[0010] BACKGROUND OF THE INVENTION

[0011] The genetic code is comprised of nucleotide triplets, referred to as codons, each of which corresponds to a specific amino acid incorporated during the process of protein synthesis. Of the 64 possible codon combinations, 61 codons specify the insertion of an amino acid into a nascent polypeptide chain during translation by the ribosome. The remaining three codons (TAA, TAG, and TGA) function as stop codons, signaling the termination of translation.

[0012] A point mutation, particularly a single-nucleotide substitution that converts an amino acid-encoding codon into one of the three stop codons, is referred to as a nonsense mutation. Such mutations introduce a premature termination codon (PTC) into the protein-coding sequence of a gene. The presence of a PTC frequently results in the production of a truncated protein product, which is typically nonfunctional or exhibits significantly impaired biological activity. In many cases, the presence of a PTC also triggers nonsense-mediated mRNA decay (NMD), thereby reducing the overall level of the mutated transcript.

[0013] Nonsense mutations represent a substantial proportion of pathogenic genetic alterations, accounting for approximately 10% to 15% of all mutations associated with inherited diseases. These mutations have been implicated in nearly 1,000 severe genetic disorders, including but not limited to cystic fibrosis, Duchenne muscular dystrophy, and certain cancers.

[0014] Given the prevalence and clinical impact of nonsense mutations, there exists a significant and unmet medical need for compositions, compounds, and therapeutic methods capable of suppressing PTCs or otherwise restoring the expression and function of full-length proteins encoded by genes harboring nonsense mutations. The present disclosure addresses this need by providing agents and methods for the treatment or prevention of diseases or disorders associated with, or resulting from, nonsense mutations.

[0015] SUMMARY OF THE INVENTION

[0016] This disclosure addresses the need mentioned above in a number of aspects.

[0017] In one aspect, the disclosure provides an oligonucleotide set comprising: (a) a first hairpin oligonucleotide comprising from 5’ end to 3’ end: a first antisense strand, a first loop, and a first sense strand that is complementary to the first antisense strand; and (b) a second hairpin oligonucleotide comprising from 5’ end to 3’ end: a second sense strand, a second loop, and a second antisense strand that is complementary to the second sense strand. The first sense strand and the second sense strand are adapted to be joined together to form a nucleic acid sequence encoding a RNA molecule. The first loop or the second loop or another part of the oligonucleotide is directly or indirectly linked with a nuclear targeting moiety.

[0018] In some embodiments, when the first sense strand and the second sense strand are joined, the first hairpin oligonucleotide and the second hairpin oligonucleotide form a closed- end DNA thread (CEDT) molecule, which is also called a picovector in some cases.

[0019] In some embodiments, the first hairpin oligonucleotide comprises a nucleic acid sequence encoding a tRNA leader. In some embodiments, the second hairpin oligonucleotide comprises a nucleic acid sequence encoding a RNA polymerase III termination signal. In some embodiments, the oligonucleotide set further comprises a third sense strand and a third antisense strand having a sequence complementary to the third sense strand. In some embodiments, the first sense strand, the third sense strand, and the second sense strand are adapted to be joined together in order to form a second nucleic acid sequence encoding the RNA molecule.

[0020] In another aspect, the disclosure provides an oligonucleotide set comprising: (a) a first hairpin oligonucleotide comprising from 5’ end to 3’ end: a first antisense strand, a first loop, and a first sense strand that is complementary to the first antisense strand; (b) a second hairpin oligonucleotide comprising from 5’ end to 3’ end: a second sense strand, a second loop, and a second antisense strand that is complementary to the second sense strand; and (c) a third sense strand and a third antisense strand having a sequence complementary to the third sense strand. The first sense strand, the third sense strand, and the second sense strand are adapted to be joined together in an order to form a second nucleic acid sequence encoding a RNA molecule. The first loop or the second loop or another part of the oligonucleotide is directly or indirectly linked with a nuclear targeting moiety.

[0021] In some embodiments, when the first sense strand, the third sense strand, and the second sense strand are joined, the first hairpin oligonucleotide, the third sense and antisense strands, and the second hairpin oligonucleotide form a CEDT molecule.

[0022] In some embodiments, the third sense strand comprises a nucleic sequence encoding a tRNA leader. In some embodiments, the third sense strand comprises a nucleic sequence encoding a RNA polymerase III termination signal.

[0023] In some embodiments, the RNA molecule comprises tRNA. In some embodiments, the tRNA comprises an anti-codon edited-tRNA (ACE-tRNA). In some embodiments, the ACE- tRNA causes a ribosome to read through one or more stop codons during translation. In some embodiments, the one or more stop codons comprise a premature termination codon (PTC). Examples of the PTC include PTCs that result in disease or PTCs that result in nonsense- associated diseases. In some embodiments, the PTC is present in a nucleic acid sequence encoding cystic fibrosis transmembrane conductance regulator (CFTR).

[0024] In some embodiments, the tRNA is selected from the group consisting of Arg-tRNA- UGA, Gln-tRNA-UAA, Gln-tRNA-UAG, Trp-tRNA-UGA, Trp-tRNA-UAG, Glu-tRNA- UAA, Glu-tRNA-UAG, Cys-tRNA-UGA, Tyr-tRNA-UAG, Tyr-tRNA-UAA, Leu-tRNA- UGA, Leu-tRNA-UAG, Leu-tRNA-UAA, Lys-tRNA-UAG, Lys-tRNA-UGA, Ser-tRNA- UGA, Ser-tRNA-UAG, and Ser-tRNA-UAA.

[0025] In some embodiments, the nucleic acid sequence has a size of from 200 nucleotides to 1,000 nucleotides.

[0026] In some embodiments, the first loop or the second loop or another part of the oligonucleotide is linked with an agent such as the nuclear targeting moiety. In some embodiments, the agent or the nuclear targeting moiety comprises a labeling agent, a peptide, a bioactive agent, or a combination thereof. In some embodiments, the labeling agent comprises any one of N-hydroxysuccinimide (NHS), thiol-maleimide, and azidedibenzocyclooctyne (DBCO). Such an agent can be linked to the oligonucleotide via any suitable methods known in the art, such as bioorthogonal chemistry and click chemistry. Exemplary reactions may include native chemical ligation and the Staudinger ligation, copper- catalyzed azide-alkyne cycloaddition, strain-promoted [3 + 2] reactions, tetrazine ligation, metal-catalyzed coupling reactions, oxime and hydrazone ligations as well as photoinducible bioorthogonal reactions.

[0027] In some embodiments, the first hairpin oligonucleotide or the second hairpin oligonucleotide comprises one or more chemically modified nucleotides. In some embodiments, the one or more chemically modified nucleotides comprise a 2’-O-methyl- modified sugar moiety. In some embodiments, the one or more chemically modified nucleotides comprise a modified intemucleoside linkage.

[0028] In some embodiments, the nuclear targeting moiety comprises a peptide or a protein having a nuclear localization signal or sequence (NLS). In some embodiments, the peptide or protein is linked to the first loop or the second loop or another part of the oligonucleotide via a linker. In some embodiments, the protein is a transcription factor or a nuclear protein. In some embodiments, the linker is a small molecule compound, a polypeptide, or a oligonucleotide.

[0029] In some embodiments, the nuclear targeting moiety comprises a nucleic acid having a DNA targeting sequence (DTS).

[0030] In some embodiments, the nuclear targeting moiety comprises a binding pair having (i) a first member that is linked to the first loop or the second loop or another part of the oligonucleotide, and (ii) a second member that contains to a NLS or a DTS or is linked to the NLS or DTS. The first member and the second member are designed to bind to each other. Also within the scope of this disclosure is a composition comprising the oligonucleotide set described herein. In one embodiment, the composition is formulated as a nanoparticle formulation.

[0031] In another aspect, this disclosure also provides a kit comprising the oligonucleotide set described herein and, optionally, a ligase. In some embodiments, the ligase is a T4 DNA ligase.

[0032] In yet another aspect, this disclosure further provides a method for making a CEDT molecule. In some embodiments, the method comprises: providing an oligonucleotide set described herein; and ligating components of the oligonucleotide set, thereby obtaining the CEDT molecule.

[0033] In some embodiments, the oligonucleotide set is synthesized chemically. In some embodiments, the oligonucleotide set is synthesized with chemically modified nucleotides.

[0034] In some embodiments, the CEDT molecule is further linked to a labeling agent, a peptide, a bioactive agent, or a combination thereof.

[0035] In another aspect, this disclosure provides a CEDT molecule comprising the components described above. Such a CEDT molecule can be made according to the method described herein.

[0036] In yet another aspect, this disclosure additionally provides a method of treating a disease associated with a PTC in a subject in need thereof. In some embodiments, the method comprises administering to the subject the CEDT molecule described herein or a pharmaceutical composition thereof. In some embodiments, the disease is selected from the group consisting of cystic fibrosis, Duchenne and Becker muscular dystrophies, retinoblastoma, neurofibromatosis, ataxia- telangiectasia, Tay-Sachs disease, Wilm’s tumor, hemophilia A, hemophilia B, Menkes disease, Ullrich’s disease, b-Thalassemia, type 2A and type 3 von Willebrand disease, Robinow syndrome, brachydactyly type B (shortening of digits and metacarpals), inherited susceptibility to mycobacterial infection, inherited retinal disease, inherited bleeding tendency, inherited blindness, congenital neurosensory deafness and colonic agangliosis and inherited neural develop-mental defect including neurosensory deafness, colonic agangliosis, peripheral neuropathy and central dysmyelinating leukodystrophy, Liddle’s syndrome, xeroderma pigmentosum, Fanconi’s anemia, anemia, hypothyroidism, p53-associated cancers, esophageal carcinoma, osteocarcinoma, ovarian carcinoma, hepatocellular carcinoma, breast cancer, hepatocellular carcinoma, fibrous histiocytoma, ovarian carcinoma, SRY sex reversal, triosephosphate isomerase-anemia, diabetes, rickets, Hurler Syndrome, Dravet Syndrome, Spinal Muscular Dystrophy, Usher Syndrome, Aniridia, Choroideremia, Ocular Coloboma, Retinitis pigmentosa, dystrophic epidermolysis bullosa, Pseudoxanthoma elasticum, Alagille Snydrome, Waardenburg-Shah, infantile neuronal ceroid lipofuscinosis, Cystinosis, X- linked nephrogenic diabetes insipidus, McArdle’s disease and Polycystic kidney disease.

[0037] The foregoing summary is not intended to define every aspect of the disclosure, and additional aspects are described in other sections, such as the following detailed description. The entire document is intended to be related as a unified disclosure, and it should be understood that all combinations of features described herein are contemplated, even if combinations of features are not found together in the same sentence, or paragraph, or section of this document. Other features and advantages of the invention will become apparent from the following detailed description. It should be understood, however, that the detailed description and the specific examples, while indicating specific embodiments of the disclosure, are given by way of illustration only, because various changes and modifications within the spirit and scope of the disclosure will become apparent to those skilled in the art from this detailed description.

[0038] BRIEF DESCRIPTION OF THE DRAWINGS

[0039] FIG. 1 shows a representative schematic of a process for ACE-tRNA targeting. The diagram depicts key steps in the preparation of ACE-tRNA constructs for site-specific incorporation of materials with chemi cal / biologi cal functionalities.

[0040] FIG. 2A shows an alternate labeling strategy referred to as Alternate Labeling Method 1. This method facilitates combinatorial screening of nuclear localization signal (NLS) sequences using a single ACE-tRNA picovector scaffold. Instead of synthesizing a large variety of NLS peptides, NLS sequences were appended to the ALFA tag nanobody through high-throughput cloning and expression in Escherichia coli. While strain-promoted azidealkyne cycloaddition (SPAAC) chemistry was previously used for labeling due to its biocompatibility in aqueous systems, it required extended reaction times exceeding 48 hours at the concentrations employed. In contrast, the high-affinity interaction (~26 pM) between the ALFA nanobody and ALFA tag enabled rapid and stable labeling within minutes under physiological conditions. This approach significantly enhanced labeling efficiency and throughput. FIG. 2B shows ACE-tRNA LPV (linear picovector; equivalent to synthetic linear picovector, sLPV) constructs used in experiments involving ALFA-Nb-NLS fusions. These constructs were tested for their capacity to restore expression in systems bearing premature termination codons (PTCs).

[0041] FIG. 3 shows ACE-tRNA LPV functionalized with nuclear localization signal peptides (NLS) through strain-promoted azide-alkyne cycloaddition (SPAAC) coupling chemistry, which were employed in functional rescue assays. HEK293T cells harboring a stably integrated nanoluciferase reporter containing a PTC were cultured in black 96-well plates and treated with either vehicle control (0.1% DMSO) or aphidicolin (to a final concentration of 5 pg / mL, dissolved in DMSO), a compound known to arrest the cell cycle in early S-phase without disrupting transcriptional or translational machinery. This approach simulated the conditions of non-dividing cells encountered in vivo. Following a 16-hour pre-treatment, the cells were transfected with dual-labeled ACE-tRNA LPVs (5’ and 3’ ends). Nanoluciferase activity was quantified 24 hours post-transfection using the Nano-Gio assay (PROMEGA). While constructs lacking NLS showed modest PTC suppression in proliferating cells, significant enhancement — up to a 4-fold increase — was observed in arrested cells when NLS sequences were appended, particularly the hLa-derived NLS peptide from the human La protein. These results underscore the importance of nuclear localization for efficient ACE-tRNA function under cell-cycle-arrested conditions.

[0042] FIG. 4 shows that the experiment shown in FIG. 3 can be extended to multiple ACE- tRNAs encoded as sLPV (ArgUGA and OptLeuUGA) with NLS conjugates to enhance rescue in functional PTC suppression assays. Further, this is demonstrated in two cell models (HEK293T a.k.a. 293 T, and 16HBE14o- a.k.a. HBE) harboring a stably integrated nanoluciferase reporter containing a PTC. As demonstrated in FIG. 3, while constructs lacking NLS showed modest PTC suppression in proliferating cells (vehicle), significant enhancement was observed in arrested cells (aphidicolin) cells when NLS sequences were appended. Taken together, the results shown here extend the findings demonstrated in FIG. 3.

[0043] FIG. 5 shows results obtained from HeLa cells transfected with the ACE-tRNA LPV constructs described above, using Lipofectamine 2000 as the transfection reagent. Six hours post-transfection, cells were lysed in a custom buffer (20 mM HEPES, pH 7.2, 150 mM NaCl, and 10 mM EDTA), followed by sonication and heat treatment at 95 °C for 5 minutes. Lysates were then centrifuged at 20,000 x g for 5 minutes to remove debris. The resulting supernatant was analyzed using a 2’,3’-cyclic GMP-AMP (cGAMP) ELISA Kit (INVITROGEN) to quantify intracellular levels of cGAMP. The cGAMP-activated cGAS-STING innate immunity pathway is triggered by the presence of DNA in the cytoplasm, providing a host defense against microbial pathogens. This pathway has impacts on autophagy, cellular senescence, and antitumor immunity, while overactivity results in autoimmune and inflammatory diseases. Given the intracellular route of nonviral delivery of DNA vectors, this pathway may be triggered spuriously, resulting in unintended cellular damage. Larger plasmid DNA results in the highest cGAMP levels demonstrated here, with the smaller LPVs displaying significantly lower amounts of cGAMP production. Simply appending an NLS to the LPV lowers the intracellular cGAMP burden, while optimizing the ACE-tRNA expression cassette allows for lower amounts of DNA to be delivered, further decreasing the cGAMP to nearly undetectable levels. These findings allay concerns that LPV may trigger an aberrant immune response simply through delivery of the therapeutic vector.

[0044] FIG. 6 shows a second alternate labeling strategy (Alternate Labeling Method 2), wherein an all-DNA ACE-tRNA LPV construct is engineered to include a DNA targeting sequence (DTS). The DTS is recognized by transcription factors or other DNA-binding proteins that are actively transported into the nucleus. By leveraging endogenous nuclear import machinery through the DTS-protein interaction, this method facilitates efficient nuclear localization of the ACE-tRNA, thereby improving its intracellular delivery and functional efficacy.

[0045] FIG. 7 shows the ACE-tRNA LPV constructs utilized in conjunction with DTS elements, further demonstrating modular design flexibility for nuclear targeting applications.

[0046] FIG. 8 shows a third alternate labeling strategy (Alternate Labeling Method 3), which involves the site-specific incorporation of para-azido-phenylalanine (pAzF) into proteins via genetic code expansion in cell culture. This method enables conjugation of full-length proteins, such as transcription factors, which inherently contain nuclear targeting domains that may not be fully functional when isolated as peptides. The use of intact proteins preserves subnuclear localization properties that are critical for biological activity and specificity in nuclear compartments.

[0047] FIG. 9 shows a comparison of LPV functionalized with nuclear localization signal peptides (NLS) through strain-promoted azide-alkyne cycloaddition (SPAAC) coupling chemistry, to that of LPV functionalized with NbALFA-NLS fusion proteins. In both cases these LPV conjugates were tested in aphidicolin treated 293T and HBE cells harboring a stably integrated nanoluciferase reporter containing a PTC. In principle the specific method of NLS- LPV conjugation should not matter for function, which is in general supported by these data shown here.

[0048] FIG. 10 shows exemplary ACE-tRNA LPV (linear picovector) constructs utilized in experiments evaluating NLS functionality through through strain-promoted azide-alkyne cycloaddition (SPAAC) coupling chemistry to proteins containing para-azido-phenylalanine (pAzF). These constructs were designed to assess intracellular delivery and nuclear targeting efficiency.

[0049] FIG. 11 shows a representative chemical synthesis scheme for the generation of DTS- labeled ACE-tRNA synthetic LPV (sLPV) wherein an all-DNA ACE-tRNA LPV construct is engineered to include a DNA targeting sequence (DTS). The DTS in this approach is composed of a covalently-closed-end linear DNA fragment, in contrast to the scheme presented in FIG. 6. The covalently-closed-end DTS moiety increases ease of production and in vivo stability of the sLPV conjugate.

[0050] FIG. 12 shows a synthetic scheme for the preparation of sLPV constructs labeled with NbALFA-NLS. This conjugation enables targeted delivery of the ACE-tRNA sLPV construct to the nucleus via nanobody-mediated localization.

[0051] FIGS. 13A, 13B, and 13C shows that NbALFA-NLS-labeled sLPV constructs exhibit biological behavior comparable to those directly conjugated to synthetic NLS peptides. Specifically, FIG. 13A shows a Coomassie Blue-stained SDS-PAGE gel confirming expression and purification of the NbALFA-NLS fusion proteins. FIG. 13B shows results from a gel mobility shift assay, indicating that the NbALFA-NLS effectively binds to and alters the electrophoretic mobility of ptLeu-sLPV-ALFA peptide. FIG. 13C shows data demonstrating successful suppression of premature termination codons (PTCs) in non-dividing 16HBE14o- cells harboring a stably integrated nanoluciferase reporter containing a PTC, following transfection with the [ ptLeu-sLPV-ALFA-peptide]-[NbALFA-hLa-NLS] conjugate.

[0052] FIGS. 14A and 14B depict functional measurements of cystic fibrosis transmembrane conductance regulator (CFTR) activity in ex vivo wild-type mouse trachea. FIG. 14A shows a representative transepithelial short-circuit current (Lc) trace demonstrating CFTR-mediated chloride transport. FIG. 14B quantifies the peak forskolin and IB MX (F&I) responses as mean ± standard error of the mean (SEM), confirming CFTR functionality. FIG. 15 shows that nucleotide optimization of ACE-tRNALeuresulted in a significant enhancement of PTC suppression efficiency in 16HBE14o- cells, with observed translational readthrough activity increasing by approximately 6.5-fold relative to the unoptimized construct.

[0053] FIG. 16 shows that the inclusion of appended NLS sequences significantly increased the efficiency of ptLeu-sLPV-mediated PTC suppression in non-dividing 16HBE14o- reporter cells. Statistical analysis by one-way ANOVA indicated a highly significant effect (****p < 0.0001), highlighting the importance of nuclear targeting for therapeutic efficacy.

[0054] FIG. 17 shows that conjugation of the ptLeu-sLPV with human La (hLa) NLS peptide led to a substantial reduction in cyclic GMP-AMP (cGAMP) production in HeLa cells via lessened activation of the cyclic GMP-AMP synthase (cGAS)-stimulator of interferon genes (STING) pathway. One-way ANOVA confirmed statistical significance of the observed reduction (****p<0.0001), supporting reduced immunostimulatory activity of the modified construct.

[0055] DETAILED DESCRIPTION OF THE INVENTION

[0056] The present disclosure relates to the field of nucleic acid therapeutics and delivery systems. More specifically, it concerns engineered transfer RNA constructs and their use in gene therapy applications, including compositions and methods for efficient delivery to target cells.

[0057] This disclosure provides compositions and methods for the development, optimization, and delivery of DNA-based anticodon-engineered transfer RNA (ACE-tRNA) therapeutic constructs. These ACE-tRNA constructs are designed to suppress premature termination codons (PTCs) and thereby restore translation of full-length, functional proteins in genetic disorders caused by nonsense mutations. This disclosure also describes the formulation of ACE-tRNA constructs with poly(amine-co-ester) (PACE) polymeric nanoparticles (NPs) to enhance stability, protect the nucleic acid cargo, and facilitate efficient transfection and gene delivery to airway epithelial cells. The PACE NP formulations have been evaluated for in vivo biocompatibility and safety, including assessments in murine models to determine toxicity, biodistribution, and therapeutic efficacy.

[0058] Furthermore, the disclosure describes the design and application of functionalized ACE-tRNA Picovectors (sLPVs), which incorporate targeting elements to improve nuclear delivery efficiency. In particular, the sLPVs have been functionalized with nuclear localization signals (NLSs), nucleolar localization sequences (NoLSs), and DNA nuclear targeting sequences (DTSs) to enhance intracellular trafficking, nuclear import, and localization of the ACE-tRNA cargo. These modifications facilitate improved therapeutic outcomes by increasing the accumulation of ACE-tRNA constructs at their site of transcription within the nucleus. Enhanced transcription of ACE-tRNA constructs ultimately leads to enhanced PTC suppression efficacy and rescue of PTC-associated disease phenotypes.

[0059] Together, this disclosure provides an advanced platform for targeted gene therapy using ACE-tRNA constructs, addressing challenges associated with delivery, expression, and therapeutic performance in the treatment of genetic diseases caused by nonsense mutations.

[0060] Oligonucleotides and Methods for Making CEPT Molecules

[0061] Oligonucleotide Sets

[0062] In one aspect, this disclosure provides an oligonucleotide set. In some embodiments, the oligonucleotide set comprises: (a) a first hairpin oligonucleotide comprising from 5’ end to 3’ end: a first antisense strand, a first loop, and a first sense strand that is complementary to the first antisense strand; and (b) a second hairpin oligonucleotide comprising from 5’ end to 3’ end: a second sense strand, a second loop, and a second antisense strand that is complementary to the second sense strand, wherein the first sense strand and the second sense strand are adapted to be joined together to form a nucleic acid sequence encoding a RNA molecule, and wherein the first loop or the second loop or another part of the oligonucleotide is directly or indirectly linked with a nuclear targeting moiety.

[0063] In one aspect, this disclosure provides an oligonucleotide set comprising: (i) a first hairpin oligonucleotide comprising from 5’ end to 3’ end: a first antisense strand, a first loop, and a first sense strand that is complementary to the first antisense strand; (ii) a second hairpin oligonucleotide comprising from 5’ end to 3’ end: a second sense strand, a second loop, and a second antisense strand that is complementary to the second sense strand; and (iii) a third sense strand and a third antisense strand having a sequence complementary to the third sense strand, wherein the first sense strand, the third sense strand, and the second sense strand are adapted to be joined together in an order to form a second nucleic acid sequence encoding a RNA molecule, and wherein the first loop or the second loop or another part of the oligonucleotide is directly or indirectly linked with a nuclear targeting moiety.

[0064] As used herein, the phrase “nuclear targeting moiety” refers to a molecule, structure, domain, or complex that is capable of directing a substance (e.g., a nucleic acid or polypeptide) associated with it to the nucleus of a host cell. Such a nuclear targeting moiety enhances nuclear binding and / or uptake and facilitates the entry of the substance through the nuclear membrane into the nucleus of the host cell. Examples of nuclear targeting moi eties include, but are not limited to, peptides, polypeptides, proteins, nucleic acids, complexes of peptides / polypeptides / proteins, complexes of nucleic acids, and complexes comprising both peptides / polypeptides / proteins and nucleic acids.

[0065] In some embodiments, the nuclear targeting moiety comprises a peptide or a protein having a nuclear localization signal or sequence (NLS).

[0066] In some embodiments, nuclear targeting is achieved by incorporating a nuclear membrane transport peptide, a NLS peptide, or a small molecule that provides equivalent NLS functionality. Examples of suitable NLS peptides include those described herein, such as hLa NLS (GGPVKRAREETDKEEPASKQQKTENGAGDQ) (SEQ ID NO: 1), Tyl NLS (GGPNSKKRSLEDNETEIKVSRDTWNTKNMRSLEPPRSKKRIH) (SEQ ID NO: 2), and SV40 NLS (GGGPKKKRKVED) (SEQ ID NO: 3).

[0067] In some embodiments, nuclear targeting may alternatively be achieved by incorporating a DNA nuclear targeting sequence (DTS). Non-limiting examples include SV40 DTS (e.g., tggttgctgactaattgagatgcatgctttgcatacttctgcctgctggggagcctggggactttccacacc) (SEQ ID NO: 4); TGT SV40 DTS (e.g., TGTtggttgctgactaattgagatgcatgctttgcatac ttctgcctgctggggagcctggggac tttccacaccGAACG) (SEQ ID NO: 5); and NFKB DTS and 3XNFKB DTS (e.g., TACGGGAAATTCCACCTCGGGAAATTCCTGATCGGGA AATTCCGAACG) (SEQ ID NO: 6).

[0068] Typically, an NLS consists of one or more short sequences of positively charged amino acids, such as lysines or arginines, that are exposed on the surface of the protein. The best- characterized transport signal is the classical NLS (cNLS) for nuclear protein import, which consists of either one (monopartite) or two (bipartite) stretches of basic amino acids. Monopartite cNLSs are exemplified by the SV40 large T antigen NLS (PKKKRRV) (SEQ ID NO: 7) or (KKKRKVE) (SEQ ID NO: 8), while bipartite cNLSs are exemplified by the nucleoplasmin NLS (KRPAATKKAGQAKKKK) (SEQ ID NO: 9).

[0069] In some embodiments, the nuclear targeting moiety is selected from the group consisting of a nuclear localization signal peptide, a nuclear membrane transport peptide, and a steroid receptor-binding moiety. Alternatively, the nuclear targeting moiety may be a protein interaction domain that mediates signaling to an NLS-containing protein. The nuclear targeting moiety may be covalently or noncovalently attached to the substance (e.g. , a vector as described herein), or may be recombinantly expressed as a fusion with the substance.

[0070] Additional examples of nuclear targeting moieties include Lamin A / C, nucleoporins (e.g, NUP), ASHL2, ESET, histones, LSD1, DNA repair enzymes such as PARP, and P84 / THOC1, as well as the respective NLS sequences thereof. Suitable peptides are described, for example, in U.S. Pat. Nos. 5,795,587 and 5,670,347, and in WO 98 / 58955, each of which is incorporated herein by reference in its entirety. (See also Aronsohn et al.. J. Drug Targeting 1 : 163 (1997); Zanta et al., Proc. Nat’l Acad. Sci. USA 96:91-96 (1999); Ciolina et al. Cold Spring Harbor Laboratory Meeting Abstracts (1999), p. 20; and Saphire et al., J. Biol. Chem. 273:29764 (1999)).

[0071] A nuclear targeting peptide may be a NLS peptide or a nuclear membrane transport peptide, and may comprise natural or non-natural amino acids, including D-amino acids and chemical analogues such as peptoids. The NLS may be composed of amino acids or their analogues arranged in a natural or reverse sequence.

[0072] In some embodiments, the peptide or protein is operably linked to the first loop, the second loop, or an alternative region of the oligonucleotide through a suitable linker. The linker may be selected to provide appropriate spatial orientation, flexibility, or functional separation between the peptide or protein and the oligonucleotide component.

[0073] In certain embodiments, the protein comprises a transcription factor or another nuclear- localized protein, such as a chromatin-modifying enzyme, a nuclear receptor, or a DNA- binding regulatory protein. Such proteins may facilitate nuclear localization, gene regulation, or interaction with chromosomal DNA.

[0074] In some embodiments, the linker comprises a small molecule compound, a polypeptide (e.g, a flexible or rigid peptide linker), or an oligonucleotide segment. The linker may be chemically or enzymatically cleavable, or otherwise designed to permit controlled release or separation under specific cellular conditions.

[0075] In certain embodiments, the nuclear targeting moiety includes a nucleic acid comprising a DNA targeting sequence (DTS), which facilitates the localization of the oligonucleotide construct to the nucleus and promotes interaction with chromosomal DNA. The DTS may be derived from a naturally occurring sequence known to mediate nuclear localization or may be a synthetic sequence optimized for enhanced nuclear delivery. In some embodiments, the nuclear targeting moiety comprises a binding pair comprising: (i) a first member that is linked to the first loop, the second loop, or another region of the oligonucleotide; and (ii) a second member that contains or is linked to an NLS or a DTS, wherein the first member and the second member are designed to bind specifically to each other.

[0076] As used herein, the term “oligonucleotide” refers to a compound comprising a plurality of linked nucleosides joined together by phosphodiester or other intemucleosidic linkages. The term encompasses naturally occurring oligonucleotides (e.g., unmodified RNA or DNA) as well as synthetic or chemically modified oligonucleotides, including but not limited to those comprising modified sugars, bases, or backbone structures. In certain embodiments, an oligonucleotide may include one or more unmodified RNA and / or DNA nucleosides and / or one or more modified nucleosides.

[0077] As used herein, the term “hairpin,” “hairpin loop,” or “terminal hairpin” refers to a secondary structure formed within a single nucleic acid strand when two regions of the strand, typically complementary when read in reverse orientation, undergo intramolecular base pairing to form a double-stranded stem ending in a single-stranded loop. Such structures are commonly observed in both natural and synthetic nucleic acid sequences and may play structural or functional roles, including in gene regulation and nucleic acid stability.

[0078] As used herein, terms such as “first,” “second,” “third,” and the like are employed as labels for distinguishing among elements or features and are not intended to denote or imply any particular order or hierarchy unless explicitly stated otherwise in the context in which the terms are used.

[0079] As used herein, the term “antisense strand” refers to a nucleic acid strand that is complementary to the corresponding “sense” strand. The antisense strand typically hybridizes to the sense strand according to Watson-Crick base pairing. In some contexts, the antisense strand may be referred to by the symbol (-), whereas the sense strand may be referred to by the symbol (+). The antisense strand may be used in various applications, including antisense therapeutics, RNA interference (RNAi), and hybridization assays.

[0080] As used herein, the terms “complementary” or “complementarity” refer to the relationship between two nucleic acid sequences that can form a stable duplex through Watson- Crick or other recognized base-pairing interactions. For example, the DNA sequence 5’-C-A- G-T-3’ is complementary to 5’-A-C-T-G-3’. Complementarity may be complete (z.e., each nucleotide in a first strand pairs with its corresponding complementary base in a second strand) or partial (z.e., one or more mismatches are present). The degree of complementarity influences hybridization stability and specificity, which are critical factors in techniques such as polymerase chain reaction (PCR), molecular probes, and nucleic acid-based therapeutics.

[0081] As used herein, the term “self-complementary sequence” refers to a nucleic acid sequence that is capable of forming intramolecular or intermolecular base pairs with a complementary sequence that is its reverse complement. For example, a self-complementary sequence on a first oligonucleotide may be designed such that a second oligonucleotide includes the reverse complement, enabling hybridization between the two. Such self- complementary sequences are useful for generating duplexes, hairpins, or other structured motifs relevant in structural biology, nanotechnology, and nucleic acid therapeutics.

[0082] CEDT Molecules

[0083] In some embodiments, when the first sense strand and the second sense strand are joined, the first hairpin oligonucleotide and the second hairpin oligonucleotide form a closed- end DNA thread (CEDT) molecule.

[0084] As used herein, the terms “closed-end DNA thread,” “CEDT,” “CEDT molecule,” “CEDT minivector,” and “picovector” are used interchangeably to refer to a unique class of synthetic or naturally inspired DNA molecules characterized by a closed linear structure. Specifically, a CEDT molecule comprises a linear double-stranded DNA segment in which the terminal ends are covalently linked to form hairpin loop structures, thereby eliminating free ends. Due to these covalently closed termini, the structure may functionally and topologically resemble a circular single-stranded DNA molecule upon denaturation.

[0085] Each CEDT molecule includes two covalently closed hairpin termini that physically join the 5’ and 3’ ends of each complementary strand. These hairpins are typically formed through self-annealing or enzymatic ligation of palindromic or complementary sequences and may lack complete base pairing at the apex due to torsional or conformational strain inherent in the loop structure. The unpaired bases at the apex (typically 1-4 nucleotides) are permissible and may vary depending on environmental conditions or flanking sequence composition. In some embodiments, the hairpin sequences are entirely self-complementary; in others, one or more base mismatches (“wobbles”) are tolerated without compromising structural integrity.

[0086] When denatured, a CEDT molecule can be visualized as a circular single-stranded DNA composed of forward (sense or plus) and reverse (antisense or minus) sequences positioned adjacently within the same strand. This contrasts with traditional plasmid or minicircle DNA vectors, in which complementary sequences are distributed between separate circular strands.

[0087] The CEDT molecule is preferably at least 75% complementary over its length, and may be at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% complementary in certain embodiments. The term “complementary,” as used herein, refers to the conventional base pairing of nucleotides (adenine (A) with thymine (T) or uracil (U), and cytosine (C) with guanine (G)) and applies to both inter- and intramolecular interactions in either antiparallel or palindromic arrangements.

[0088] The CEDT molecule may comprise a wide variety of nucleotide sequences, including naturally derived, synthetic, or chimeric segments. In some embodiments, the CEDT molecule includes one or more processing enzyme target sites that facilitate post-synthetic modification or functionalization of the vector. These target sites may be recognized by: restriction endonucleases, which bind and cleave DNA at specific palindromic recognition sequences; site-specific recombinases (e.g., Cre, FLP), which mediate directional DNA exchange at their respective recognition sites such as loxP or FRT; integrases (e.g., phiC31), which catalyze insertion of genetic material at specific attP / attB sequences; or RNA polymerases, wherein the target sequence corresponds to a promoter element, enabling transcription initiation. Suitable promoters may include eukaryotic, viral, or synthetic promoters (e.g., CMV, EFla, SV40, or T7 promoters), optionally in combination with a eukaryotic transcriptional terminator.

[0089] In some embodiments, the CEDT comprises an expression cassette, which may consist of a promoter operably linked to a coding sequence (e.g., for a therapeutic RNA such as tRNA or mRNA, or for a polypeptide), and optionally a polyadenylation or transcription termination sequence. The phrase “operably linked” refers to the functional arrangement of a regulatory element (e.g., a promoter) and a coding sequence such that transcription of the coding sequence is initiated under appropriate biological conditions.

[0090] The length of a CEDT molecule may vary depending on the application. In some embodiments, the total size of the molecule ranges from about 100 base pairs (bp) to about 4 kilobases (kb), more typically from 200 bp to 2 kb, or 200 bp to 800 bp. The modularity of the CEDT structure permits the inclusion of multiple coding or regulatory elements. For example, CEDTs of 200 bp or greater may accommodate multiple ACE-tRNA cassettes, thereby facilitating enhanced expression of engineered tRNAs from a single vector. In a particular embodiment, a CEDT comprises both a Leucine ACE-tRNA and a Tryptophan ACE-tRNA, designed to suppress the W1282X nonsense mutation in the CFTR gene associated with cystic fibrosis. The dual inclusion of ACE-tRNAs that utilize distinct aminoacyl tRNA synthetases is anticipated to provide synergistic or additive effects in nonsense suppression efficiency, offering a novel therapeutic strategy for diseases characterized by PTCs.

[0091] The CEDT molecule described herein represents a structurally distinct and functionally versatile DNA construct comprising a linear, double-stranded sequence flanked by covalently closed ends in the form of hairpin loops. The CEDT molecule may include internal coding and regulatory sequences, enzyme recognition sites, or other modular genetic elements, and offers a robust platform for use in gene therapy, RNA expression, genome editing, and other nucleic acid-based applications.

[0092] In some embodiments, the first hairpin oligonucleotide comprises a nucleic acid sequence encoding a tRNA leader sequence. The tRNA leader may facilitate transcription initiation or enhance transcript stability when expressed in a eukaryotic or prokaryotic host cell.

[0093] In some embodiments, the second hairpin oligonucleotide comprises a nucleic acid sequence encoding a transcriptional termination signal recognized by RNA polymerase III. Such termination signals typically include a stretch of thymidine residues (e.g., TTTTT) and are effective in terminating RNA polymerase Ill-mediated transcription in mammalian and other eukaryotic cells.

[0094] In some embodiments, the oligonucleotide set further comprises a third sense strand and a third antisense strand, wherein the third antisense strand is at least partially complementary to the third sense strand. The third sense and antisense strands may hybridize to form a double-stranded region, which may encode a functional RNA sequence, such as an siRNA, shRNA, or other regulatory RNA molecule.

[0095] In some embodiments, the first sense strand, third sense strand, and second sense strand are adapted to be sequentially ligated, assembled, or otherwise joined together in a defined order to generate a composite or contiguous nucleic acid molecule. The resulting sequence may encode a full-length RNA molecule comprising functional domains derived from the first, third, and second sense strands. In some embodiments, when the first, third, and second sense strands are joined together, and the corresponding first hairpin oligonucleotide, third sense and antisense strands, and second hairpin oligonucleotide are incorporated, the resulting construct forms a CEDT molecule. The CEDT molecule may adopt a dumbbell-like structure and may be resistant to exonuclease degradation, making it particularly suitable for use in therapeutic or diagnostic applications.

[0096] In some embodiments, the third sense strand comprises a nucleic acid sequence encoding a tRNA leader sequence, which may facilitate efficient transcription or translation of the associated RNA product.

[0097] In some embodiments, the third sense strand comprises a nucleic acid sequence encoding an RNA polymerase III transcription termination signal, thereby contributing to efficient and precise termination of transcription when the CEDT molecule is transcribed in a host cell.

[0098] ACE-tRNAs

[0099] In some embodiments, the RNA molecule comprises tRNA. In some embodiments, the tRNA comprises an ACE-tRNA.

[0100] An ACE-tRNA is an engineered tRNA molecule capable of reverting a PTC into the originally lost amino acid or a different amino acid. Such engineered tRNAs allow for “re- editing” of a disease-causing nonsense codon to a specific amino acid. The small size of these tRNA molecules makes them amenable to ready expression, as the tRNA and the promoter together can be only about 300 bp. To that end, an oligonucleotide can be synthesized to include the structural component of a tRNA gene that is functional in human cells. The sequence of this oligonucleotide can be designed based on a known sequence with substitutions made in the anticodon region of the tRNA, causing the specific tRNA to recognize nonsense or other specific mutations. Examples of ACE-tRNAs include those described in WO2019090154, WO 2019090169, WO2021252354A1, and Lueck, J. D. et al. Nature communications 10, 822 (2019), the contents of which are incorporated herein by reference.

[0101] Generally, an ACE-tRNA has a four-arm structure comprising a T-arm, a D-arm, an anticodon-arm, and an acceptor arm (see, e.g., Figure 2 of WO2019090169). The T-arm is made up of a “T-stem” and a “TYE loop.” In some embodiments, the T-stem is modified to increase the stability of the tRNA. In some embodiments, the ACE-tRNA has a modified T- stem that increases the biological activity to suppress stop sites relative to the endogenous T- stem sequence.

[0102] ACE-tRNAs can be used for suppression of PTCs. This ACE-tRNA approach offers several significant benefits over other readthrough strategies, including (1) codon specificity; (2) ACE-tRNAs suppression of PTCs resulting in seamless rescue, thus negating spurious effects on protein stability, folding, trafficking, and function; and (3) in vitro delivery of these of ACE-tRNA resulting in significant functional rescue of affected protein, such as CFTR channels with p.G542X or p.W1282X CF mutations. The ACE-tRNAs have shown to be efficient at PTC suppression in several cDNA genes with varied PTC positions in multiple cell types. Because ACE-tRNAs exhibit high efficiency in PTC suppression with no known detrimental effects, they can be used as therapeutics.

[0103] ACE-tRNAs can be made according to the methods described in WO2019090154, W02019090169, WO2021252354A1, and Lueck, J. D. et al.. Nature communications 10, 822 (2019). Using the described methods, an extensive library of ACE-tRNAs for effective rescue of PTCs in cell culture can be generated. Other engineered human tRNA sequences to suppress disease-causing PTCs include those described in W02019090154, W02019090169, WO2021252354A1, and Lueck, J. D. et al., Nature communications 10, 822 (2019), the contents of which are incorporated herein by reference.

[0104] In some embodiments, the tRNA is selected from the group consisting of Arg-tRNA- UGA, Gln-tRNA-UAA, Gln-tRNA-UAG, Trp-tRNA-UGA, Trp-tRNA-UAG, Glu-tRNA- UAA, Glu-tRNA-UAG, Cys-tRNA-UGA, Tyr-tRNA-UAG, Tyr-tRNA-UAA, Leu-tRNA- UGA, Leu-tRNA-UAG, Leu-tRNA-UAA, Lys-tRNA-UAG, Lys-tRNA-UGA, Ser-tRNA- UGA, Ser-tRNA-UAG, and Ser-tRNA-UAA.

[0105] In some embodiments, the ACE-tRNA causes a ribosome to read through one or more stop codons during translation by the ribosome. Such readthrough may occur during protein synthesis and results in continued elongation of the polypeptide chain beyond the canonical stop site.

[0106] In some embodiments, the one or more stop codons comprise a premature termination codon (PTC), which may arise from a genetic mutation. The ACE-tRNA may be specifically designed to recognize and suppress the PTC, thereby restoring expression of a full-length functional protein. In some embodiments, the PTC is located within a nucleic acid sequence encoding the CFTR protein. Restoration of full-length CFTR protein expression by suppression of the PTC may be beneficial in treating cystic fibrosis or related disorders.

[0107] In some embodiments, the nucleic acid sequence harboring the PTC may have a length ranging from approximately 200 nucleotides to approximately 1,000 nucleotides (e.g., 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 550, 575, 600, 625, 650, 675, 700, 725, 750, 775, 800, 825, 850, 875, 900, 925, 950, 975, 1000 nucleotides or any intermediate number therebetween), although sequences outside of this range may also be suitable depending on the context and intended application.

[0108] In some embodiments, the ACE-tRNA molecule comprises one or more structural elements, such as a first loop, a second loop, or another region of the oligonucleotide, which is linked to an agent.

[0109] In some embodiments, the agent comprises a labeling moiety, a peptide, a bioactive agent, or any combination thereof. Such agents may be used, for example, to facilitate detection, purification, cellular targeting, or therapeutic modulation of the ACE-tRNA molecule.

[0110] In some embodiments, the labeling moiety includes, but is not limited to, N- hydroxysuccinimide (NHS) esters, thiol-maleimide conjugates, or azide-dibenzocyclooctyne (DBCO) click chemistry reagents. Combinations of such labeling moieties may also be employed to provide multifunctionality or enhanced detection capabilities.

[0111] In some embodiments, the nucleic acid molecules, such as the first hairpin oligonucleotide, the second hairpin oligonucleotide, or the CEDT molecules described herein, may include one or more chemically modified nucleotides, such as a 2’-O-methyl modified sugar moiety. For example, chemically modified nucleotides may include a modified internucleoside linkage. As used herein, a “modified oligonucleotide” refers to an oligonucleotide comprising at least one modified nucleoside and / or at least one modified internucleoside linkage. Examples of modified oligonucleotides include single-stranded and double-stranded compounds, such as antisense compounds, siRNAs, shRNAs, ssRNAs, and occupancy-based compounds.

[0112] As used herein, a “nucleoside” refers to a compound comprising a nucleobase moiety and a sugar moiety. Nucleosides include, but are not limited to, naturally occurring nucleosides (as found in DNA and RNA) and modified nucleosides. Nucleosides may be linked to a phosphate moiety.

[0113] As used herein, a “chemical modification” refers to a chemical difference in a compound when compared to a naturally occurring counterpart. Chemical modifications of oligonucleotides may include nucleoside modifications (such as sugar moiety modifications and nucleobase modifications) and internucleoside linkage modifications. As used herein, an “internucleoside linkage” refers to a covalent linkage between adjacent nucleosides in an oligonucleotide. In reference to an oligonucleotide, a chemical modification does not include differences only in nucleobase sequence.

[0114] As used herein, a “sugar moiety” refers to a naturally occurring sugar moiety or a modified sugar moiety of a nucleoside. As used herein, a “modified sugar moiety” refers to a substituted sugar moiety or a sugar surrogate. As used herein, a “substituted sugar moiety” refers to a furanosyl that is not a naturally occurring sugar moiety. Substituted sugar moieties include, but are not limited to furanosyls comprising substituents at the 2’ -position, the 3’- position, the 5’-position and / or the deposition. Certain substituted sugar moieties are bicyclic sugar moieties. As used herein, a “2’-substituted sugar moiety” refers to a furanosyl comprising a substituent at the 2’-position other than H or OH. Unless otherwise indicated, a 2’-substituted sugar moiety is not a bicyclic sugar moiety (z.e., the 2 ’-substituent of a 2 ’-substituted sugar moiety does not form a bridge to another atom of the furanosyl ring.

[0115] In some embodiments, chemical modifications may provide certain desirable properties, such as enhanced nuclease stability or increased binding affinity with a target nucleic acid relative to molecules having only nucleosides comprising naturally occurring sugar moieties. In some embodiments, modified sugar moieties are substituted sugar moieties. In some embodiments, modified sugar moieties are bicyclic or tricyclic sugar moieties. In some embodiments, modified sugar moieties are sugar surrogates. Such sugar surrogates may include one or more substitutions corresponding to those of substituted sugar moieties.

[0116] In some embodiments, modified sugar moieties are substituted sugar moieties comprising one or more substituents, including but not limited to substituents at the 2’ and / or 5’ positions. Examples of sugar substituents suitable for the 2’-position, include but are not limited to: 2’-F, 2’-OCH3(“OMe” or “O-methyl”), and 2’-O(CH2)2OCH3 (“MOE”). In some embodiments, sugar substituents at the 2’ position are selected from allyl, amino, azido, thio, O-allyl, O — Ci-Cio alkyl, O — Ci-Cio substituted alkyl; O — Ci-Cio alkoxy; O — Ci-Cio substituted alkoxy, OCF3, O(CH2)2SCH3, O(CH2)2 — O — N(Rm)(Rn), and O — CH2 — C(=O) — N(Rm)(Rn), where each Rm and Rn is, independently, H or substituted or unsubstituted C1-C10 alkyl. Examples of sugar substituents at the 5 ’-position include but are not limited to: 5’-methyl (R or S), 5’-vinyl, and 5’-methoxy. In some embodiments, substituted sugars may include more than one non-bridging sugar substituent, for example, 2 ’-F-5’ -methyl sugar moi eties see, e.g., PCT International Application WO 2008 / 101157, for additional 5’,2’- bis substituted sugar moieties and nucleosides).

[0117] Nucleosides comprising 2 ’-substituted sugar moieties are herein referred to as 2’- substituted nucleosides. In some embodiments, a 2 ’-substituted nucleoside may include a 2’- substituent group selected from halo, allyl, amino, azido, O — C1-C10 alkoxy; O — C1-C10 substituted alkoxy, SH, CN, OCN, CF3, OCF3, O-alkyl, S-alkyl, N(Rm)-alkyl; O-alkenyl, S- alkenyl, or N(Rm)-alkenyl; O-alkynyl, S-alkynyl, N(Rm)-alkynyl; O-alkynyl-O-alkyl, alkynyl, alkaryl, aralkyl, O-alkaryl, O-aralkyl, O(CH2)2SCH3, O — (CH2)2 — O — N(Rm)(Rn) or O — CH2 — C(=O) — N(Rm)(Rn), where each Rmand Rn is, independently, H, an amino protecting group or substituted or unsubstituted C1-C10 alkyl. These 2 ’-substituent groups can be further substituted with one or more substituent groups independently selected from hydroxyl, amino, alkoxy, carboxy, benzyl, phenyl, nitro (NO2), thiol, thioalkoxy (S-alkyl), halogen, alkyl, aryl, alkenyl, and alkynyl.

[0118] In some embodiments, a 2 ’-substituted nucleoside may include a 2 ’-substituent group selected from F, NH2, N3, OCF3, O— CH3, O(CH2)3NH2, CEE— CH=CH2, O— CEE— CH=CH2, OCEECEEOCEE, O(CH2)2SCH3, O— (CH2)2— O— N(Rm)(Rn),

[0119] O(CH2)2O(CH2)2N(CH3)2, and N-substituted acetamide (O — CH2 — C(=O) — N(Rm)(Rn) where each Rmand Rn is, independently, H, an amino protecting group or substituted or unsubstituted C1-C10 alkyl. In some embodiments, a 2 ’-substituted nucleoside may include a sugar moiety comprising a 2 ’-substituent group selected from F, OCF3, O — CEE, OCEECEEOCEE, O(CH2)2SCH3, O— (CH2)2— O— N(CH3)2, — O(CH2)2O(CH2)2N(CH3)2, and O — CEE — C(=O) — N(H)CH3. In some embodiments, a 2’-substituted nucleoside may include a sugar moiety comprising a 2 ’-substituent group selected from F, O — CEE, and OCEECEEOCEE.

[0120] In some embodiments, modified sugar moieties may include a bridging sugar substituent that forms a second ring resulting in a bicyclic sugar moiety. In some embodiments, the bicyclic sugar moiety may include a bridge between the 4’ and the 2’ furanose ring atoms. Examples of such 4’ to 2’ sugar substituents, include, but are not limited to: — [C(Ra)(Rb)]n — , — [C(Ra)(Rb)]n— O— — C(RaRb)— N(R)— O— or, — C(RaRb)— O— N(R)— ; 4’-CH2-2’, 4’- (CH2)2-2’, 4’-(CH2)3-2’, 4’-(CH2)— 0-2’ (LNA); 4’-(CH2)— S-2; 4’-(CH2)2— 0-2’ (ENA); 4’- CH(CH3) — 0-2’ (cEt) and 4’-CH(CH2OCH3) — 0-2’, and analogs thereof (see, e.g., U.S. Pat. No. 7,399,845, issued on Jul. 15, 2008); 4’-C(CH3)(CH3) — 0-2’ and analogs thereof, (see, e.g., W02009 / 006478, published Jan. 8, 2009); 4’-CH2— N(OCH3)-2’ and analogs thereof (see, e.g., W02008 / 150729, published Dec. 11, 2008); 4’-CH2— O— N(CH3)-2’ (see, e.g., US2004 / 0171570, published Sep. 2, 2004); 4’-CH2— O— N(R)-2’, and 4’-CH2— N(R)-0-2’-, wherein each R is, independently, H, a protecting group, or C1-C12 alkyl; 4’-CH2— N(R) — O- 2’, wherein R is H, C1-C12 alkyl, or a protecting group (see, U.S. Pat. No. 7,427,672, issued on Sep. 23, 2008); 4’-CH2 — C(H)(CH3)-2’ (see, e.g., Chattopadhyaya, etal.,J. Org. Chem., 2009, 74, 118-134); and 4’-CH2— C(=CH2)-2’ and analogs thereof (see, published PCT International Application WO 2008 / 154401, published on Dec. 8, 2008).

[0121] Methods for Making CEDTs

[0122] In yet another aspect, this disclosure provides a method for making a CEDT molecule. In some embodiments, the method comprises: providing an oligonucleotide set as described herein; and ligating components of the oligonucleotide set to obtain the CEDT molecule.

[0123] In certain embodiments, ligation of components of the oligonucleotide set may be facilitated by an enzyme, such as a ligase. The ligase may be a eukaryotic ligase, a prokaryotic ligase, a single-stranded DNA ligase, or a double-stranded DNA ligase. Suitable examples of DNA ligases include, but are not limited to, T4 DNA ligase, Taq DNA ligase, T7 DNA ligase, T3 DNA ligase, 9°N™ DNA ligase, and E. coli DNA ligase.

[0124] In some embodiments, the oligonucleotide set is chemically synthesized. In certain embodiments, the oligonucleotide set comprises chemically modified nucleotides. For example, the first hairpin oligonucleotide, the second hairpin oligonucleotide, or the resulting CEDT molecules may each include one or more chemically modified nucleotides, such as a 2’- O-methyl modified sugar moiety. In some embodiments, the chemical modification includes a modified internucleoside linkage.

[0125] In further embodiments, the closed-end DNA thread molecule is conjugated to a labeling agent, a peptide, a bioactive agent, or a combination thereof.

[0126] As used herein, the terms “labeling agent,” “label,” or “detectable label” refer to any composition that can be detected by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical, or chemical means. Examples of labeling agents include, without limitation, biotin (for staining with labeled streptavidin conjugates), magnetic beads (e.g., Dynabeads®), fluorescent dyes (e.g., fluorescein, Texas Red, rhodamine, green fluorescent protein, and similar), radiolabels (e.g., tritium (3H), iodine-125 (125I), sulfur-35 (35S), carbon-14 (14C), or phosphorus-32 (32P)), enzymes (e.g., horseradish peroxidase, alkaline phosphatase, and other enzymes commonly used in ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic beads (e.g., polystyrene, polypropylene, latex, etc.). The use of such labels is described, for example, in U.S. Patent Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149; and 4,366,241, the relevant contents of which are hereby incorporated by reference in their entirety.

[0127] Various detection methods may be used depending on the label. Radiolabels can be detected using photographic film or scintillation counters; fluorescent labels can be detected using photodetectors to monitor emitted light; enzymatic labels may be detected by providing the enzyme with a substrate and measuring the resulting product; and colorimetric labels may be detected by direct visual inspection.

[0128] As demonstrated in Example 3 and FIGS. 8A-8C, labeling or chemical modification of the hairpin, CEDT, or picovector does not adversely affect PTC (premature termination codon) suppression. Accordingly, labeled hairpins or labeled CEDT / picovectors may be employed in various applications, including the identification of NLS sequences and / or cell-penetrating peptides (CPPs) that enhance picovector delivery and intracellular localization.

[0129] As used herein, the term “bioactive agent” refers to any substance suitable for use in therapeutic or diagnostic applications. Such agents may be used, for example, in methods for diagnosing the presence or absence of disease in a subject, or in methods for treating disease in a subject.

[0130] In another aspect, this disclosure provides a CEDT molecule produced according to the methods described herein.

[0131] Compositions and Kits

[0132] The nucleic acid molecules, such as oligonucleotide sets, hairpin oligonucleotides, or CEDT molecules generated from the disclosed oligonucleotide sets, can be provided in a composition (e.g., a pharmaceutical composition) or in a kit. In some embodiments, the composition may include an oligonucleotide set as described herein. In some embodiments, the composition may include the first hairpin oligonucleotide and / or the second hairpin oligonucleotide, as described herein. In some embodiments, the composition may include a CEDT molecule prepared from an oligonucleotide set as described herein.

[0133] In another aspect, this disclosure provides a kit comprising the oligonucleotide set described herein and, optionally, a ligase. In some embodiments, the ligase is T4 DNA ligase.

[0134] Formulation of nucleic acids (e.g., DNA) as a conventional pharmaceutical preparation may be accomplished using standard pharmaceutical formulation chemistries and methodologies known to those skilled in the art. Any pharmaceutically acceptable carrier or excipient may be used. Auxiliary substances, such as wetting or emulsifying agents, pH- buffering substances, and the like, may be included in the excipient or vehicle. These excipients, vehicles, and auxiliary substances are generally pharmaceutical agents that may be administered without undue toxicity and that, in the case of vaccine compositions, do not induce an immune response in the individual receiving the composition. A suitable carrier may include, for example, a liposome. Pharmaceutically acceptable excipients include, but are not limited to, liquids such as water, saline, polyethylene glycol, hyaluronic acid, glycerol, and ethanol.

[0135] Pharmaceutically acceptable salts may also be included, such as mineral acid salts (e.g., hydrochlorides, hydrobromides, phosphates, sulfates) and salts of organic acids (e.g., acetates, propionates, malonates, benzoates). The preparation may also include excipients that serve as stabilizers, particularly for peptides, proteins, or similar molecules. Examples of suitable carriers that act as stabilizers for peptides include, without limitation, pharmaceutical grades of dextrose, sucrose, lactose, trehalose, mannitol, sorbitol, inositol, dextran, and the like. Other suitable carriers include, without limitation, starch, cellulose, sodium or calcium phosphates, citric acid, tartaric acid, glycine, high molecular weight polyethylene glycols (PEGs), or combinations thereof. A comprehensive discussion of pharmaceutically acceptable excipients, vehicles, and auxiliary substances is available in Remington ’s Pharmaceutical Sciences (Mack Pub. Co., N.J., 1991), which is incorporated herein by reference.

[0136] Compositions containing active ingredients, such as oligonucleotides or CEDT molecules, can be prepared using known procedures and readily available components. For CEDT molecules, the compositions can also be formulated as solutions suitable for parenteral administration, such as intramuscular, subcutaneous, or intravenous injection. The compositions can be in the form of an aqueous or anhydrous solution or dispersion, or as an emulsion or suspension. Alternatively, the compositions may be in powder form, obtained via aseptic isolation of sterile solids or by lyophilization from solution, for constitution with a suitable vehicle e.g., sterile, pyrogen-free water) before use.

[0137] In some embodiments, the compositions disclosed herein may be formulated as lipid nanoparticles (LNPs), such as those described in WO2020263883, WO2013123523, W02012170930, WO2011127255, W02008103276, and US20130171646, each of which is incorporated herein by reference in its entirety. Accordingly, the present disclosure provides nanoparticle compositions comprising a lipid composition and at least one nucleic acid, such as a CEDT molecule, along with a delivery agent. In such compositions, the lipid composition may encapsulate the nucleic acid.

[0138] Nanoparticle compositions are typically sized on the order of micrometers or smaller and may include a lipid bilayer. Nanoparticle compositions include, for example, LNPs, liposomes (e.g., lipid vesicles), and lipoplexes. In some embodiments, the nanoparticle is a liposome with a lipid bilayer and a diameter of 500 nm or less.

[0139] In certain embodiments, the nanoparticle composition includes one or more lipid bilayers, optionally arranged as concentric bilayers separated by aqueous compartments. The lipid bilayers may be functionalized and / or crosslinked, and may include one or more ligands, proteins, or channels.

[0140] In one embodiment, a lipid nanoparticle may include an ionizable lipid, a structural lipid, a phospholipid, and a nucleic acid of interest. In some embodiments, the lipid nanoparticle includes an ionizable lipid, a PEG-modified lipid, a sterol, and a structural lipid. The molar ratio of the components may range from about 20-60% ionizable lipid, about 5- 25% structural lipid, about 25-55% sterol, and about 0.5-15% PEG-modified lipid. In some embodiments, the lipid nanoparticle has a poly dispersity index of less than 0.4 and exhibits a net neutral charge at physiological pH. The mean diameter of the lipid nanoparticle may range from 50-150 nm, or from 80-100 nm in certain embodiments.

[0141] As used herein, the term “lipid” refers to a small molecule with hydrophobic or amphiphilic properties. Lipids may be naturally occurring or synthetic. Classes of lipids include, but are not limited to, fats, waxes, sterol -containing metabolites, vitamins, fatty acids, glycerolipids, glycerophospholipids, sphingolipids, saccharolipids, polyketides, and prenol lipids. Due to their amphiphilic nature, some lipids can self-assemble into liposomes, vesicles, or membranes in aqueous media. In some embodiments, nucleic acids are formulated into lipid nanoparticles with diameters from about 10 to 100 nm, or alternatively, from about 10 to 500 nm. In some embodiments, the nanoparticle diameter exceeds 100 nm. The largest dimension of a nanoparticle composition may be 1 pm or smaller (e.g., 1 pm, 900 nm, 800 nm, 700 nm, 600 nm, 500 nm, 400 nm, 300 nm, 200 nm, 175 nm, 150 nm, 125 nm, 100 nm, 75 nm, or 50 nm).

[0142] Nanoparticle compositions can be relatively homogeneous. The polydispersity index, which reflects particle size distribution, may be used to characterize homogeneity. A value below 0.3 generally indicates a narrow size distribution. In some embodiments, the poly dispersity index is from about 0 to 0.25, for example, 0.01 to 0.25, or more specifically, from about 0.10 to 0.20.

[0143] In some embodiments, the nucleic acids described herein are formulated for controlled release and / or targeted delivery. As used herein, “controlled release” refers to the release of a pharmaceutical composition or compound in a predefined pattern over time to achieve a desired therapeutic effect. The nucleic acids may be encapsulated using delivery agents known in the art for such applications. The term “encapsulate” means to enclose, surround, or encase. Encapsulation may be complete, substantial, or partial. As used herein, “substantially encapsulated” means that more than 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more of the composition is enclosed within the delivery agent. “Partially encapsulated” means that less than 10%, 20%, 30%, 40%, or 50% of the composition is enclosed.

[0144] In some embodiments, the composition is formulated for sustained release. As used herein, “sustained release” refers to a formulation that releases its active ingredient over a prolonged period, such as hours, days, weeks, months, or years. For example, sustained release nanoparticle compositions may be formulated as disclosed in W02010075072, US20100216804, US20110217377, US20120201859, and US20130150295, each of which is incorporated herein by reference in its entirety.

[0145] In some embodiments, the nanoparticle compositions are formulated for tissue- or cellspecific targeting, as described in WO2008121949, W02010005726, W02010005725, WO201 1084521, WO2011084518, US20100069426, US20120004293, and US20100104655, each of which is incorporated herein by reference in its entirety.

[0146] The nucleic acid molecules e.g., oligonucleotide sets, hairpin oligonucleotides, CEDT molecules) or compositions described herein can be provided in a kit. In some embodiments, the kit includes a container comprising at least one nucleic acid molecule or a composition thereof, along with optional informational material. The informational material may include descriptive, instructional, or marketing content related to the methods and uses described herein, such as instructions for manufacturing, recommended dosage, or administration schedules.

[0147] In some embodiments, the kit includes an additional therapeutic agent. Multiple containers may be provided, for example, one containing the nucleic acid composition and another containing a separate therapeutic agent. The containers may hold unit dosages of the pharmaceutical composition. Additionally, the kit may include other components such as solvents, buffers, adjuvants, stabilizers, preservatives, or combinations thereof. A delivery device suitable for administration (e.g., a syringe) may also be included. The device may be pre-loaded or provided empty for loading prior to use.

[0148] Methods of Treatment

[0149] In yet another aspect, this disclosure provides a method for treating a disease associated with a PTC in a subject in need thereof. In some embodiments, the method comprises administering to the subject a CEDT molecule as described herein, or a pharmaceutical composition thereof.

[0150] The disclosed method offers several advantages. First, it provides improved stop codon suppression specificity. The therapeutic ACE-tRNAs of the present disclosure can selectively target a specific stop codon, such as TGA, thereby reducing off-target effects at stop codons unrelated to the disease. Second, the method enables amino acid specificity. The expressed tRNA is engineered to specifically restore the amino acid lost due to insertion of the disease- associated stop codon, thereby minimizing undesired effects on protein stability, folding, and trafficking.

[0151] Furthermore, the method is adaptable to “personalized” therapy to correct any disease- related PTC. For example, the human genome encodes nine distinct tryptophan (Trp) tRNAs that are recognized by Trp-tRNA synthetase and suppress the UGG codon. Each of these nine Trp tRNAs may be exploited for codon re-editing tolerance (e.g., for UGG to UGA). In addition, arginine codons frequently mutate to PTCs in PTC-associated diseases due to their proximity to stop codons in the genetic code. There are over thirty Arg tRNAs available for use, and ACE-tRNAs encoding arginine may serve as therapeutic agents for Arg^PTC mutations irrespective of the affected gene. For instance, approximately 35% of Leber congenital amaurosis (LCA) cases are caused by nonsense mutations, the majority of which involve arginine to stop codon transitions.

[0152] Another advantage of the disclosed method is its compact and modular design, which enables facile expression and cell-specific delivery. The complete expression system, including the tRNA and promoter sequence, is compact enough to facilitate delivery by various gene therapy vectors.

[0153] Diseases or disorders caused by or associated with PTCs include, but are not limited to, variants of Duchenne muscular dystrophy and Becker muscular dystrophy due to a PTC in dystrophin; retinoblastoma due to a PTC in RBI; neurofibromatosis due to a PTC in NF1 or NF2; ataxia-telangiectasia due to a PTC in ATM; Tay-Sachs disease due to a PTC in HEXA; cystic fibrosis due to a PTC in CFTR; Wilms’ tumor due to a PTC in WT1; hemophilia A due to a PTC in factor VIII; hemophilia B due to a PTC in factor IX; p53 -associated cancers due to a PTC in TP53; Menkes disease; Ullrich’s disease; P-thalassemia due to a PTC in P-globin; type 2A and type 3 von Willebrand disease due to a PTC in von Willebrand factor; Robinow syndrome; brachydactyly type B (shortening of digits and metacarpals); inherited susceptibility to mycobacterial infection due to a PTC in IFNGR1; inherited retinal disease due to a PTC in CRX; inherited bleeding tendency due to a PTC in coagulation factor X; inherited blindness due to a PTC in rhodopsin; congenital neurosensory deafness and colonic agangliosis due to a PTC in SOXIO; and inherited neural developmental defects including neurosensory deafness, colonic agangliosis, peripheral neuropathy, and central dysmyelinating leukodystrophy also due to a PTC in SOXIO.

[0154] Additional disorders that may be treated using the compositions and methods described herein include, but are not limited to, Liddle’s syndrome, xeroderma pigmentosum, Fanconi anemia, various forms of anemia, hypothyroidism, and cancers associated with mutations in the TP53 gene (e.g., squamous cell carcinoma, hepatocellular carcinoma, ovarian carcinoma). Other treatable conditions may include esophageal carcinoma, osteosarcoma, breast cancer, malignant fibrous histiocytoma, SRY-associated sex reversal, triosephosphate isomerase deficiency-related anemia, diabetes mellitus, and various forms of rickets, among others.

[0155] In some embodiments, the method comprises treating a disease or disorder associated with a nonsense mutation by reversing or mitigating the effects of such mutation through administration of a CEDT molecule as described in this disclosure. In certain embodiments, the disease or disorder may be cystic fibrosis, wherein the CEDT molecule targets a specific nonsense mutation within the CFTR gene to restore functional protein expression.

[0156] Other diseases or disorders that may be addressed include, for example, Hurler syndrome, Dravet syndrome, spinal muscular atrophy, Usher syndrome, aniridia, choroideremia, ocular coloboma, retinitis pigmentosa, dystrophic epidermolysis bullosa, pseudoxanthoma elasticum, Alagille syndrome, Waardenburg-Shah syndrome, infantile neuronal ceroid lipofuscinosis, cystinosis, X-linked nephrogenic diabetes insipidus, and polycystic kidney disease.

[0157] Additional diseases or disorders associated with premature termination codons (PTCs) that may be treated using the disclosed methods include various ocular diseases. These eye diseases may involve one or more nonsense mutations in genes associated with inherited retinal or visual disorders. For example, cone dystrophies — including Stargardt’s disease (STGD1), cone-rod dystrophy, retinitis pigmentosa (RP), and increased susceptibility to age-related macular degeneration (AMD) — may be associated with PTCs in genes such as KCNV2 (e.g., Glu43X, Glu306X, Gln76X, Glul48X), CACNA2D4 (Tyr802X, Arg628X), RP2 (Argl20X), RHO (Ser334X), RPE65 (Arg44X), and PDE6A (Lys455X). Congenital stationary night blindness (CSNB) may also be amenable to treatment, with type 2 (CSNB2) linked to mutations in CACNA1F (Arg958X, Arg830X), and type 1 (CSNB1) associated with mutations in TRPM1 (Glnl lX, Lys294X, Arg977X, Ser882X) and NYX (Trp350X). Best disease (vitelliform macular dystrophy, BVMD) involves mutations in BEST1 (Tyr29X, Arg200X, Ser517X). Leber congenital amaurosis (LCA) may involve mutations in KCNJ13 (Trp53X, Argl66X), CEP290 (Argl51X, Glyl890X, Lysl575X, Argl271X, Argl782X), CRB1 (Cysl332X), GUCY2D (Ser448X, Arg4091X), LCA5 (Gln279X), RDH12 (Tyrl94X, Glu275X), SPATA7 (ArglO8X), and TULP1 (Gln301X). Usher syndrome type 1 may involve nonsense mutations in USH1C (Arg31X), PCDH15 (Arg3X, Arg245X, Arg643X, Arg929X), IQCB1 (Arg461X, Arg489X), PDE6A (Gln69X), and ALMS1 (Ser999X, Arg3804X). Additional treatable conditions may include aniridia (PAX6, Glyl94X), ocular coloboma (PAX2, Argl39X; IAMBI, Arg524X), and choroideremia (REP 1, CHM, Gln32X). These disorders are characterized by the presence of nonsense mutations that result in truncated, non-functional proteins, and may benefit from therapeutic methods that promote readthrough of PTCs or otherwise restore expression of full-length functional proteins.

[0158] In some embodiments, the compositions described herein can be administered in one or more doses using techniques well known to those skilled in the medical arts, taking into account factors such as the age, sex, weight, and general health condition of the subject, as well as the desired route of administration.

[0159] The dosage of the composition may range from about 1 picogram (pg) to about 10 milligrams (mg) of active component per kilogram (kg) of body weight per administration. In some embodiments, the dosage may be from about 20 pg to about 10 mg of active component per kg of body weight per administration. The compositions may be administered at intervals of every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 days, depending on the therapeutic protocol and the patient’s response. The total number of doses for an effective treatment regimen may be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 doses, or more.

[0160] The agent or composition may be administered either prophylactically to prevent disease or therapeutically to treat an existing condition. In therapeutic applications, the compositions are administered to a subject in need thereof in an amount sufficient to elicit a desired therapeutic response. Such an amount is referred to herein as a “therapeutically effective dose.” The precise dosage required will vary depending on factors such as the specific composition used, the formulation and route of administration, the stage and severity of the disease being treated, the overall health status of the subject, and the clinical judgment of the treating physician.

[0161] The compositions may be administered by any method known in the art. Examples of suitable methods are described, for instance, in Donnelly et al., Annual Review of Immunology 15:617-648 (1997), U.S. Patent Nos. 5,580,859, 5,703,055, and 5,679,647, the contents of each of which are incorporated herein by reference in their entirety.

[0162] In some embodiments, the DNA component of the composition may be complexed with particles or beads and delivered to a subject, for example, via a needle-free injection device such as a vaccine gun. One skilled in the art would appreciate that the selection of a pharmaceutically acceptable carrier, including a physiologically acceptable compound, may depend on the route of administration.

[0163] The compositions may be administered by a variety of routes, including but not limited to parenteral administration, such as intradermal, intramuscular, or subcutaneous injection. Additional administration routes include oral, intranasal, intravaginal, transdermal (e.g., via iontophoresis), or topical application to the skin or mucosal tissues. In certain embodiments, the composition may be administered to interstitial spaces of tissues, as described in U.S. Patent Nos. 5,580,859 and 5,703,055. Epidermal administration may also be employed, which can involve mechanical or chemical irritation of the outermost layer of the skin to stimulate an immune response (see, e.g., U.S. Patent No. 5,679,647).

[0164] In some embodiments, the compositions may be formulated for nasal administration. Suitable nasal formulations may include coarse powders having particle sizes ranging from about 10 to about 500 microns, administered by rapid inhalation (e.g., as snuff). Alternatively, the formulation may be delivered as a nasal spray, nasal drops, or as an aerosol using a nebulizer. Nasal formulations may include aqueous or oily solutions containing the active component.

[0165] The compositions may also be prepared as liquid formulations, such as suspensions, syrups, or elixirs. In other embodiments, the compositions are formulated for injectable administration, including subcutaneous, intradermal, intramuscular, or intravenous injection. Such formulations may be provided as sterile solutions, suspensions, or emulsions.

[0166] The composition described herein may be incorporated into liposomes, microspheres, or other polymeric matrices. Examples of such formulations are disclosed in U.S. Patent No. 5,703,055 and in Liposome Technology, Volumes I to III (2nd ed. 1993) by Gregoriadis, the contents of which are hereby incorporated by reference in their entirety. Liposomes may be composed of phospholipids or other biocompatible lipids and can serve as nontoxic, physiologically acceptable, and metabolizable carriers. Such carriers are generally straightforward to prepare and are amenable to various routes of administration.

[0167] The composition may be administered by any of a variety of routes, including, but not limited to, oral, parenteral, sublingual, transdermal, rectal, transmucosal, topical, inhalational, buccal, intrapleural, intravenous, intra-arterial, intraperitoneal, subcutaneous, intramuscular, intranasal, intrathecal, intra-articular, or any combination thereof. For veterinary applications, the composition may be formulated and administered in accordance with established veterinary standards and practices. The attending veterinarian may determine the appropriate dosage and route of administration based on the species, condition, and individual needs of the animal.

[0168] The composition may also be delivered using a variety of physical delivery systems, including but not limited to traditional syringes, needleless injection devices, microprojectile bombardment (e.g., “gene guns”), electroporation (EP), hydrodynamic injection, or ultrasound- mediated delivery. In some embodiments, the composition is administered to a mammal using one or more established nucleic acid delivery technologies. These may include direct DNA injection with or without in vivo electroporation, liposome-mediated delivery, nanoparticle-facilitated delivery, or delivery using recombinant vectors, such as recombinant adenovirus, recombinant adeno-associated virus (AAV), or recombinant vaccinia virus. The ACE-tRNA, or a nucleic acid molecule encoding the ACE-tRNA, may be introduced via direct DNA injection, optionally in conjunction with in vivo electroporation to enhance cellular uptake and expression.

[0169] Additional Definitions

[0170] To aid in understanding the detailed description of the compositions and methods according to the present disclosure, certain express definitions are provided to facilitate an unambiguous understanding of various aspects of the invention. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains.

[0171] A “nucleic acid” or “polynucleotide” refers to a DNA molecule (e.g. , cDNA or genomic DNA), an RNA molecule (e.g, mRNA), or a DNA or RNA analog. DNA or RNA analogs may be synthesized from nucleotide analogs. The nucleic acid molecule can be single-stranded or double-stranded. An “isolated nucleic acid” refers to a nucleic acid whose structure is not identical to that of any naturally occurring nucleic acid or fragment thereof. This term includes, for example: (a) a DNA molecule having a sequence identical to a portion of a naturally occurring genomic DNA but not flanked by both coding sequences that naturally flank that portion; (b) a nucleic acid incorporated into a vector or a genome in a manner such that the resulting molecule is not identical to any naturally occurring vector or genomic DNA; (c) a separate molecule such as a cDNA, genomic fragment, PCR product, or restriction fragment; and (d) a recombinant nucleotide sequence that is part of a hybrid gene encoding a fusion protein. The above-described nucleic acids may be used to express a tRNA according to this invention. For such expression, the nucleic acid can be operatively linked to appropriate regulatory sequences to form an expression vector.

[0172] As used herein, “translation” refers to the process by which a polypeptide (e.g, a protein) is synthesized from an mRNA template. In some embodiments, an increase in translation refers to an increase in the number of polypeptide molecules produced per mRNA molecule encoding said polypeptide. As used herein, “non-complementary” in reference to nucleobases means a pair of nucleobases that do not form hydrogen bonds with each other.

[0173] As used herein, “mismatch” means a nucleobase of a first oligomeric compound that cannot base pair with a corresponding nucleobase of a second oligomeric compound when aligned. One or both of the oligomeric compounds may be oligonucleotides.

[0174] As used herein, a “vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it is linked. The vector may or may not be capable of autonomous replication or genomic integration. Examples include plasmids, cosmids, and viral vectors. The vector typically comprises a nucleic acid in a form suitable for expression in a host cell and may include one or more regulatory sequences operatively linked to a nucleic acid of interest.

[0175] A “regulatory sequence,” as used herein, includes promoters, enhancers, and other expression control elements such as polyadenylation signals. Regulatory sequences may direct constitutive, tissue-specific, or inducible expression. The design of an expression vector may depend on factors such as host cell type and the desired expression level. A promoter is a DNA sequence that directs RNA polymerase binding and initiation of RNA synthesis. A “strong promoter” is one that initiates transcription at a high frequency.

[0176] A “promoter” refers to a nucleotide sequence that initiates and regulates transcription of a polynucleotide. Promoters may be inducible, repressible, or constitutive. The term includes full-length promoters and functional fragments that direct transcription. The terms “promoter” and “control element” are used interchangeably.

[0177] The term “operably linked” refers to an arrangement wherein a regulatory element such as a promoter is positioned relative to a nucleic acid sequence to enable expression. The promoter need not be immediately adjacent to the sequence, as long as it functions effectively. Thus, untranslated sequences may be present between the promoter and coding region.

[0178] An “expression cassette” refers to a nucleic acid sequence capable of directing expression of a nucleotide sequence in a host cell. It typically includes a promoter operably linked to a coding region and may further include termination signals and translation control sequences. The cassette may be chimeric or recombinant and may be under the control of a constitutive or regulatable promoter. In some embodiments, suitable promoters include PGK, CMV, RSV, Hl, or U6 (Pol II and Pol III promoters).

[0179] A “nucleic acid fragment” refers to a portion of a given nucleic acid molecule. “Substantial identity” in the context of nucleic acid sequences means at least 70-99% sequence identity compared to a reference sequence, as determined using standard alignment algorithms. “Substantial identity” between nucleic acids or polypeptides indicates at least 90%-99% identity using alignment tools such as FASTA, BLAST, or GAP. “Substantial similarity” in polypeptides may include conservative amino acid substitutions, which do not significantly alter the protein’s function. Sequence comparisons can be conducted using tools such as GAP, BESTFIT, FASTA, or BLAST, with default parameters. Conservative substitutions are defined by physicochemical properties or substitution matrices such as PAM250. These algorithms help determine whether two sequences encode proteins with similar or identical function.

[0180] A “minivector” refers to a compact circular DNA molecule (e.g., mini circle or closed linear DNA such as CEDT), lacking a bacterial origin of replication and antibiotic resistance gene, and ranging from about 100 bp to about 5 kbp in size. Minivectors may be generated by site-specific recombination of parental plasmids and typically include only a transgene expression cassette, such as one expressing an ACE-tRNA for suppressing premature termination codons (PTCs), without bacterial-derived sequences.

[0181] The term “disease,” as used herein, is generally synonymous with “disorder” and “condition” and refers to any abnormal physiological state that impairs function and reduces quality or duration of life.

[0182] A “subject” or “subject in need thereof’ includes humans and non-human animals (e.g., mammals, birds, amphibians, and reptiles). In some embodiments, the subject is an experimental model or a human patient.

[0183] A “PTC-associated disease” refers to any condition caused by a nonsense mutation that introduces a premature termination codon, leading to a truncated and typically nonfunctional protein.

[0184] “Treating” or “treatment” refers to administration of an agent to cure, prevent, delay, or ameliorate a disease, its symptoms, or predisposition thereto. “Preventing” includes full or partial inhibition of disease onset or progression.

[0185] A “pharmaceutical composition” refers to a combination of an active agent with a carrier suitable for diagnostic or therapeutic use in vivo or ex vivo. A “pharmaceutically acceptable carrier” is one that does not cause undesirable effects and is compatible with the active ingredient. Carriers may include solubilizing agents, biocompatible vehicles, excipients, and stabilizers, among others.

[0186] The term “agent” refers broadly to chemical compounds, biological macromolecules (e.g., nucleic acids, antibodies), or extracts from biological materials. A “therapeutic agent” is an agent capable of producing a beneficial biological effect, such as ameliorating a disease or condition.

[0187] Doses are often expressed in relation to body weight. Accordingly, a dose expressed as [g, mg, or other unit] / kg (or g, mg, etc.) typically refers to [g, mg, or other unit] per kilogram (or g, mg, etc.) of body weight, even if the term “body weight” is not explicitly stated.

[0188] As used herein, the term “zzz vitro" refers to events that occur in an artificial environment, such as in a test tube, reaction vessel, or cell culture, rather than within a multicellular organism.

[0189] As used herein, the term “zzz vivo" refers to events that occur within a multicellular organism, such as a non-human animal.

[0190] It is noted that, as used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise.

[0191] The terms “including,” “comprising,” “containing,” and “having,” as well as variations thereof, are intended to be inclusive and open-ended. These terms encompass the listed elements and equivalents thereof, as well as additional unlisted elements, unless expressly stated otherwise.

[0192] The phrases “in some embodiments,” “in various embodiments,” and similar expressions are used repeatedly herein. These phrases do not necessarily refer to the same embodiment, although they may unless the context clearly indicates otherwise.

[0193] The terms “and / or” and the symbol “ / ” are intended to mean any one of the listed items, any combination of the listed items, or all of the listed items.

[0194] The term “substantially” does not exclude “completely.” For example, a composition that is “substantially free” of component Y may, in some instances, be entirely free of Y. Where context permits, the term “substantially” may be omitted from the definition of the invention.

[0195] As used herein, the terms “approximately” or “about,” when applied to one or more values, refer to a value that is close to the stated reference value. In some embodiments, “approximately” or “about” refers to a range of ±25%, ±20%, ±15%, ±10%, ±5%, ±2%, ±1%, or less, relative to the stated reference value, unless otherwise specified or evident from context (except where such a deviation would exceed 100% of a possible value). Unless indicated otherwise, the term “about” includes values proximate to the recited range that are functionally equivalent in terms of the relevant ingredient, composition, or embodiment.

[0196] It is to be understood that wherever numerical values or ranges are provided, all values and sub-ranges encompassed within those ranges are intended to be included within the scope of the present invention. This includes individual values, intermediate values, and boundary values within the stated ranges.

[0197] As used herein, the term “each,” when referring to a collection of items, is intended to identify an individual item within the collection, but does not necessarily refer to every item, unless clearly dictated by the context.

[0198] The use of examples or exemplary language (e.g., “such as”) is intended for illustration only and does not limit the scope of the invention unless expressly recited in the claims. No language in this specification should be construed as indicating that any non-claimed feature is essential to the practice of the invention. The term “exemplary” means “by way of example” and is not intended to imply preference or necessity.

[0199] Unless otherwise indicated or clearly contradicted by context, all methods described herein may be performed in any suitable order. The steps of a method may be performed simultaneously or sequentially. Where the steps occur sequentially, they may occur in any order unless expressly stated otherwise.

[0200] Where a method comprises a combination of steps, each step, as well as every subcombination or permutation of the steps, is deemed disclosed and encompassed within the scope of the invention, unless explicitly stated otherwise.

[0201] Each publication, patent application, patent, and other reference cited herein is hereby incorporated by reference in its entirety, to the extent it is not inconsistent with the present disclosure. The references provided are cited for their disclosure prior to the effective filing date of the present application. Nothing herein should be construed as an admission that the present invention is not entitled to antedate such references by virtue of prior invention. Moreover, the stated publication dates may differ from the actual dates, which may require independent verification.

[0202] It is understood that the examples and embodiments described herein are illustrative and non-limiting. Modifications or variations will be apparent to those skilled in the art in view of the present disclosure, and such variations are intended to be included within the spirit and scope of the invention and the appended claims.

[0203] Examples

[0204] This disclosure is directed to: (1) the development and optimization of highly functional DNA-based anticodon-engineered transfer RNA (ACE-tRNA) therapeutic constructs; (2) the formulation and co-delivery of these ACE-tRNA constructs with poly(amine-co-ester) (PACE) polymeric nanoparticle (NP) delivery systems to facilitate efficient transfection and gene delivery to airway epithelial cells; and (3) the evaluation of the biocompatibility and safety profile of the PACE NP formulations in vivo, including in murine models. The experimental methods described herein were designed to overcome deficiencies in the prior art and to provide improved approaches for the effective delivery of therapeutic genetic material to airway epithelial cells, while maintaining a favorable safety profile.

[0205] The experimental framework described herein was developed to incorporate rigorous methodological standards, including clearly defined experimental controls and statistical power analyses, to ensure the inclusion of appropriate technical and biological replicates. All complementary DNA (cDNA) constructs used in the studies were subjected to sequence verification by either Sanger sequencing or whole plasmid sequencing prior to their use in experimental protocols.

[0206] The influence of sex as a biological variable is acknowledged; however, it is not anticipated to significantly affect picovector-mediated delivery or the suppression efficiency or persistence of ACE-tRNAs. Nonetheless, the experiments were conducted using equal numbers of male and female mice and were statistically powered to evaluate potential sexdependent effects.

[0207] Statistical analyses were performed using one-way analysis of variance (ANOVA), followed by Tukey’s post hoc test for multiple comparisons. A / ?-value of less than 0.05 was considered indicative of statistical significance.

[0208] To ensure objectivity in the animal studies, the assignment of treatment groups, execution of procedures, and data collection were performed by independent investigators. Animals were assigned blinded identifiers, which were not disclosed until all analyses were completed.

[0209] For synthesized materials, chemical composition, molecular weight, and other relevant physical characteristics were confirmed using established characterization techniques employed in the Piotrowski-Daspit laboratory. These techniques included nuclear magnetic resonance (NMR), gel permeation chromatography (GPC), dynamic light scattering (DLS), and scanning electron microscopy (SEM) (see, e.g., Kauffman, A. C. etal. Biomacromolecules 19, 3861-3873 (2018); Cui, J. et al. J. Control Release 304, 259-267 (2019); Piotrowski- Daspit, A. S. et al. Sci. Adv. 8, eabo0522 (2022)).

[0210] The details of one or more embodiments of the invention are set forth in the description below. Other features, objectives, and advantages of the invention will be apparent from the description and from the claims. The examples and the description of the preferred embodiments are intended to illustrate, and not to limit, the present invention as defined by the claims. As will be readily appreciated, numerous variations and combinations of the features described above can be utilized without departing from the scope of the present invention as set forth in the claims. Such variations are not to be regarded as a departure from the scope of the invention, and all such variations are intended to be included within the scope of the following claims. All references cited herein are incorporated by reference in their entireties.

[0211] EXAMPLE 1

[0212] Evaluation of Functionalized ACE-tRNA Picovectors for Enhanced Nuclear Delivery and Premature Termination Codon (PTC) Suppression

[0213] Active nuclear import of ACE-tRNA encoding DNA in non-dividing cells is essential for successful PTC correction therapy. It was demonstrated that the ACE-tRNA-sLPVs can be functionalized with SV40, Tyl and hLa NLSs to support significant PTC suppression in nondividing cells without marked activation of the cGAS-STING pathway. It was hypothesized that efficient ACE-tRNA-sLPV trafficking to the nucleus will support robust PTC suppression and minimize toxicity. The goal is to identify NLSs, nucleolar localization sequences (NoLSs) and DNA nuclear targeting sequences (DTSs) that provide superior ACE-tRNA-sLPV localization for maximized PTC suppression in non-dividing cells. Further, it was hypothesized that directed ACE-tRNA-sLPV nucleolar trafficking will support optimal ACE-tRNA activity through enhanced transcription and processing. As further described below, qptLeuACE-tRNA was utilized in 16HBE14o- cells (dividing and non-dividing) that express a stably integrated nanoluciferase reporter containing a PTC. All luminometry experiments were performed using 3 technical replicates from 3 separate biological replicates each to obtain 80% power to detect an effect size of 2.3 at a two-sided 5% significance level (s=2.3 a=0.05, power=0.8).

[0214] Identification of DTSs to enhance nuclear trafficking of ACE-tRNA-sLPV The ability of transcription response elements (TREs) in gene promoters to bind transcription factor binding sequences and function as DNA nuclear targeting elements was first demonstrated using the SV40 enhancer sequence. Transcription factors that are actively trafficked to the nucleus bind TREs of cytoplasmic DNA and drag them into the nucleus through nuclear pore complexes (NPCs). In this example, SV40, NFkB and 325 unique TREs, identified by SELEX and ChIP sequencing (Jolma, A. et al. Cell 152, 327-339 (2013) and recently used for generation of synthetic promoters, are screen for DTS function with ACE- tRNAs. Identified TREs are short sequences ranging from 6-23 nucleotides that were concatenated with 3x end-to-end and ordered as complimentary oligos from IDT (below the 90nt cutoff for standard oligos). The dsDNA was Golden-Gate cloned into a positive / negative Type IIS restriction enzyme MCS in the backbone of the mini pUC57 plasmid that encodes ptACE-tRNALeuuGA. It was demonstrated this cloning strategy to result in near 100% cloning efficiency of thousands of oligos, with errors arising solely from oligo synthesis.

[0215] 3xTRE-ACE-tRNA plasmids were transfected into dividing and non-dividing (aphi dicolin, 5mg / ml) SGG I6HBE0- cells as previously described in 96-well plates. Rescued Nluc-PTC expression was quantified by plate-reader luminometry 24 later, with higher luminescence indicating active DNA trafficking to the nucleus. The TREs that support the highest PTC suppression in non-dividing cells were repeated with a dose-response (0.75 to 40ng) in non-dividing SGG 16HBEo-cells. The top 10 performing TREs that support maximum PTC suppression at the lowest DNA cone, were generated as closed-end dsDNA by ligated oligos with a single azide modification on the 5’ end and clicked to the ptLeu-sLPV as outlined in Figs. 11-12. ptLeu-sLPV-DTSs were transfected into dividing and non-dividing SGG I6HBE0- cells with a dose-response (0.75 to 40ng) in 96 well plates to identify the DTS that supports the highest maximal PTC suppression at the lowest DNA cone. Next, a cGAMP ELISA was performed to determine if DTS assisted nuclear targeting reduces the GAS-STING cellular response, as observed with hLa NLS (Fig. 17).

[0216] It was found that compact DTS from the 325 TRE screen support efficient nuclear transport of ptLeu-sLPV, efficient PTC suppression and reduced generation of cGAMP. Along the way, the DTSs can be connected to the transcription factor that binds it from the original SELEX and ChIP sequencing study. However, a head-to-head experiment will be performed following electroporation in lungs of SGG mice and I6HBE0- cells. Of note, it was already demonstrated DTSs improve plasmid delivery in vivo. DTSs are advantageous over peptide-mediated nuclear import as they are not expected to elicit an immunogenic response that is more likely with peptides.

[0217] Identification of NoLSs and NLSs to enhance nuclear trafficking of ACE-tRNA- sLPV

[0218] It was already demonstrated that SV40-, Tyl- and hLa-NLSs enhance ptLeu-sLPV- dependent PTC suppression. These three NLSs were the first sequences that were investigated, and it was hypothesize that other NLS (and / or NoLS) exist that support more potent ptLeu- sLPV nuclear trafficking. Notably, the hLa-NLS was highly potent in supporting qptLeu-sLPV PTC suppression in non-dividing cells. hLa protein binds to the 3’ ends of precursor tRNAs to protect from exonuclease digestion, and the hLa-NLS localizes to RNAs in both the nucleus and nucleolus.

[0219] To identify NoLSs sequences that may exhibit further improved qptLeu-sLPV function, the Nucleolar localization sequence Detector prediction software (NoD) was used to identify 27 “strong” NoLSs in tRNA transcription protein complexes (PolIII, TFIIIB, TFIIIC) (Scott, M. S., et al. BMC Bioinformatics 12, 317 (2011); Scott, M. S., et al. Nucleic Acids Research 38, 7388-7399 (2010)). Further, there are dozens of experimentally validated NoLSs in the literature, mostly validated by microscopy, including 40 with sequence varied amino acid composition under 50 amino acids in length.

[0220] However, there is some concern that NoLSs will not transport qptLeu-sLPV into the nucleus but may only act to bring it to the nucleolus after NLS-dependent nuclear entry. Therefore, additional validated NLS sequences were tested. Validated sequences with heterogeneous amino acid composition under 50 amino acids in length were searched, and NLSs from classical (monopartite, bipartite, other), non-classic (proline-tyrosine, other), and non-classified categories that utilize different importin complexes for nuclear localization were identified. To reduce cost for testing 107 total NoLS / NLS peptides, a platform approach was generated, utilizing the exceptionally tight binding (KD=0.026 ± 0.001 nM) of a recombinant ALFA nanobody (NbALFA) (Gbtzke, H., etal. Nat Commun 10, 4403 (2019)) with the desired NoLS / NLS encoded C-terminally (Fig. 12) to a constant ALFA-tag peptide clicked onto ptLeu-sLPV (Fig. 12).

[0221] To generate NbALFA-NLS protein in a high throughput manner, a high throughput cloning MCS at the 3 ’ end of the NbALFA was generated to clone in NLS DNA sequence with high efficiency. The NbALFA-NLS are expressed in E. coll with a N-terminal PelB signal sequence to co-translationally translocate the NbALFA-NLS to the periplasm, where it is subsequently removed by a peptidase. Nbs fold well in the periplasm and allow for rapid purification with limited steps using a N-terminal 6xHIS tag. Fig. 13 shows CB stain of NbALFA protein with no NLS, scrambled and hLa NLS (Fig. 13 A), that was bound to ptLeu- sLPV-ALFA (1 : 1 stoichiometry) resulting in an electrophoretic mobility shift (Fig. 13B). When transfected into non-dividing 16HBE14o- PTC reporter cells, the NbALFA-hLa labelled qptLeu-sLPV exhibited the same PTC suppression activity as the hLa peptide (Fig. 13C). Using this strategy, the proposed NoLS / NLS peptide sequences in dividing and non-dividing SGG 16HBE14o- cells were screened as described above. The top performing sequences (—20) were used to synthesize peptides for direct conjugation to qptLeu-sLPV, where a dose response study in 16HBE14o- cells that express a stably integrated nanoluciferase reporter containing a PTC, will be performed, and also tested for reduced generation of cGAMP. It was found that NoLS / NLS peptides from the screen support efficient nuclear transport of ptLeu-sLPV that is superior to hLa. A head-to-head comparison of top performing DTSs, NoLSs and NLSs following electroporation was performed in lungs of Stop-Go-Gio PTC reporter mice and PTC reporter 16HBE14o- cells.

[0222] Electroporation of most active nuclear targeted / Leu-sLPVs into SGG mouse lungs

[0223] To determine whether the optimal nuclear import moieties identified in cells translates to better function in vivo, PTC suppression efficiency in Stop-Go-Glow PTC reporter mice was used as the main readout for function by developing electroporation-mediated gene transfer technologies for alveoli in the deep lung to enhance treatment for acute lung injury / acute respiratory distress syndrome (ALLARDS). This approach is also a highly effective for airway gene delivery. In addition, the method is safe, rapid, and highly effective for gene delivery throughout all cell types in the lung of the mouse, rat, and pig. Safety is the major concern for lung electroporation. The idea of passing an electric field across the chest may be fine for a mouse, but some feel that a person is different. Using 40-50 kg pigs, the optimal electroporation-mediated gene transfer occurs at a field of 130V / cm (2000V) with 150 psec pulses, which utilizes ~4 Joules (J) of energy. No deaths or altered cardiac activity was observed at optimal fields in over 89 healthy and 56 septic pigs with ARDS (protein rich edema). Electroporation-mediated gene transfer technology was adopted here to test how the different nuclear targeting moieties in Stop-Go-Glow PTC reporter mice. The top 2 performing DTS, NoLS and NLS sequences were compared head-to-head with ptLeu-sLPV-hLa. As demonstrated, 50 pl of each functionalized ptLeu-sLPVs-AF647 vector at 4 concentrations (2 mg / ml, 1 mg / ml, 0.5 mg / ml and 0.25 mg / ml) balanced with empty pUC57 plasmid (demonstrated to be inert) to 2 mg / ml in salt-balanced solution was delivered to lung by electroporation in 3 -week-old Stop-Go-Glow PTC reporter mouse lungs (n=10 / vector). Naive and scramble control (n=10) cohorts was also included. Mice were analyzed at 5d, 20d andlmo (n=10 / timepoint) to determine their delivery efficiency, PTC suppression efficiency and durability by IVIS imaging of the chest of intact Stop-Go-Glow PTC reporter mice. At 1 month, excised lungs and lung lysate was analyzed by IVIS and the left or right lobe was inflated and fixed for ptLeu-sLPVs-AF647 imaging, and mNeonGreen expression was recovered with HA antibodies and with DAPI.

[0224] Hematoxylin and eosin (H&E) histological analyses are performed to detect changes in lung morphology. The other lobe is homogenized for analysis of Nluc luminescence. A more comprehensive analysis of cell-type delivery is conducted using the top-performing constructs. The study employs 340 SGG mice for completion. Based on the standard deviation obtained from preliminary data, a sample size of ten mice provides 80% power to detect a 1.3 standard deviation (threefold) difference from the control mean luminescence (s = 137,886; a = 0.05; power = 0.8) for all SGG mouse studies. A nuclear localization moiety is identified that significantly outperforms the hLa NLS in both maximum premature termination codon (PTC) suppression efficiency and potency. Notably, the top-performing construct is used for PACE NP delivery to SGG and W1282X-CFTR mouse lungs upon its identification. Timepoints (shorter or longer) and DNA concentrations (typically lower) are adjusted to distinguish differences in PTC suppression efficacy among various nuclear localization moieties.

[0225] Quantify target NTC suppression in mouse lung following electroporation of pfLeu-sLPV-hLa (UGA, UAG and UAA)

[0226] The efficiency of ACE-tRNA dependent suppression of NTCs using Ribo-seq was previously described. In this technique, total cellular RNA is isolated and subjected to RNAse treatment. Under the proper conditions, the ribosomes remain bound to the RNA, and protect 26 to 34nt footprints that can then be gel isolated and sequenced to determine their location on each transcript across the entire transcriptome. cDNA plasmids encoding ACE-tRNAGlnuAA, - tRNAGluuAG, -tRNA^uGA, -tRNAGlyuGA and -tRNATrpuGA were transfected into HEK293 cells, and after 48hrs, the cellular RNA was subjected to Ribo-seq to determine if ribosome occupancy on the 3’ untranslated region (UTR) was higher in the presence of ACE-tRNAs compared to scrambled control. The amount of 3’UTR occupancy of ribosomes was nominal, indicating that ACE-tRNAs do not significantly suppress NTCs under conditions that significantly suppress PTCs, indicating a therapeutic window. These surprising results led biotech companies to take interest in this approach as a possible therapeutic.

[0227] Delivery of sup-tRNATyruAG to mice systemically by AAV IV injection was reported, and it was found minimal UAG NTC readthrough using Ribo-seq in liver (Wang, J. et al. Nature 604, 343-348 (2022).). These findings are consistent with the concept that ACE-tRNA activity possesses a ‘Goldilocks’ window of therapeutic PTC suppression without toxicity. Importantly, ACE-tRNA rescue of CFTR function exceeds that of multiple reports using aminoglycosides. The transcriptomes of HEK293 cells (what were tested), liver and airway epithelia are different, and therefore, may exhibit distinct susceptibilities to NTC readthrough. It was therefore proposed to generate a first in-class Ribo-seq dataset in mouse airway cells.

[0228] As optimized leucine ACE-tRNAs exhibit potent UGA, UAG, and UAA nonsense suppressor activity, nonsense codon (NTC) readthrough of all transcripts is assessed. Freshly dissected sections from the left lung lobe (~30 mg) of wild-type (WT) mice (naive, optLeu- sLPV-hLaUGA, optLeu-sLPV-hLaUAG, optLeu-sLPV-hLaUAA, and scramble control) are collected at 4-7 days post-treatment to generate ribosomal footprint mRNA libraries. While lung tissue permits isolation of total RNA via trituration in lysis buffer, obtaining high-quality RNA remains challenging. To address this, a series of pilot RNA footprint isolation studies is conducted in naive animals to optimize RNA quality for sequencing. The variability inherent to the Ribo-seq technique largely stems from the quality of the isolated RNA. For each condition, RNA of the highest quality (RIN score of 7-10, as determined using an Agilent TapeStation, indicating low degradation) and high purity (A260 / A280 ~ 2.0 and A260 / A230 = 2.0-2.2) is selected for analysis (n = 4 per condition), as further confirmed by gel electrophoresis. Sequencing reads are aligned to the longest transcript variant of each mouse gene / transcript, as annotated in the UCSC RefSeq GRCm38 reference genome.

[0229] EXAMPLE 2

[0230] In vivo NP delivery of ACE-tRNA LPVs to mouse airway cells

[0231] The ability of ptLeu-sLPV-hLa to enter the nucleus of non-dividing airway cells after delivery to the cytoplasm by Lipofectamine 2000, resulting in significant PTC suppression, was demonstrated. As a therapeutic cargo delivery platform, the disclosed picovector technology is expected to exhibit durability that correlates with the half-life of the target cells. In particular, airway epithelial cells are known to have extended turnover times, with reported half-lives of over six months in the trachea and approximately 17 months in the bronchioles in murine models, and approximately 50 days in humans. Accordingly, when administered to the airway epithelium, the picovector platform is anticipated to require infrequent redosing, potentially less than once per month in human patients, thereby enhancing patient compliance and reducing treatment burden.

[0232] It is hypothesized that the combination of ACE-tRNA-sLPVs with a therapeutically viable airway nucleic acid delivery vehicle can provide a broadly applicable platform for nonsense mutation therapy. This approach may offer significant clinical advantages over current electroporation-based delivery methods, potentially enabling more widespread therapeutic use.

[0233] Nanoparticles (NPs) formulated using poly(amine-co-ester) (PACE) polymers represent advantageous vehicles for the delivery of nucleic acids. These polymers exhibit several favorable characteristics, including biocompatibility, biodegradability, and structural versatility, which allow for chemical customization to optimize delivery performance. Additionally, PACE polymers possess a mild cationic charge, which facilitates electrostatic interaction with negatively charged nucleic acid cargo, thereby enhancing encapsulation and delivery efficiency.

[0234] PACE polymers were synthesized in small batches via enzymatic copolymerization of diesters with amino-substituted diols. Terpolymers have three component monomers: a lactone that confers hydrophobicity, NP stability and reduces cytotoxicity, an amino-diol that confers a mildly cationic charge, and an ester that enables additional hydrophobic control. Higher MW polymers are efficient in condensing nucleic acids, whereas hydrophobic domains enhance vehicle stability and facilitate cargo release. A set of principles that guide optimization for nucleic acid payloads (DNA and RNA) was already identified by variation of molecular weight (MW) and hydrophobicity to focus the screening process. Further, an advantage of PACE compared to other cationic polymers is that the mild cationic charge improves association with cells and promotes endosomal escape without causing toxicity.

[0235] Leveraging the structural diversity of the PACE family of polymers, the present disclosure provides formulations that efficiently encapsulate and deliver ptLeu-sLPV-hLa to the airways in vivo. These polymer-based delivery systems are optimized for targeted pulmonary administration in murine models, with the ultimate objective of developing a viable therapeutic for cystic fibrosis (CF) and other airway diseases caused by nonsense mutations.

[0236] Using Ail4 mouse models (CAG-flox-stop-flox tdTomato), Cre mRNA was delivered directly to the airway via IT instillation using a PACE formulation optimized for airway delivery (PACE-Lung). By flow cytometry, IT delivery of Cre mRNA resulted in -10% expression in bulk lung and -30% expression in cells from bronchoalveolar lavage fluid (BALF) of treated animals. It was demonstrated specific cell types in the lung that were transfected by flow cytometry: CD31+ endothelial cells, EpCAM+ epithelial cells, and CD45+ leukocytes. -20% of epithelial cells and leukocytes were observed to express tdTomato, with no detectable expression in endothelial cells. Efficient delivery of firefly luciferase (Flue) mRNA to the lung was achieved using PACE polymers, which they assessed by Flue luminescence.

[0237] In vivo ACE-tRNA delivery to SGG mice using PACE-Lung NPs ptLeu-sLPV-hLa (w / AF647) is encapsulated into 20 unique polymeric NPs composed of PACE polymers designed for IT delivery. NPs are formulated with ptLeu-sLPV-hLa- AF647 and characterized (size, morphology, surface charge, loading, release kinetics). Unloaded NPs are included as negative controls. Each of the 20 unique PACE NP formulations is first be tested in 3 week old male and female WT mice (50mg DNA; n=3 / formulation) by IT instillation in the Piotrowski -Daspit lab. 2 days after IT instillation, overall delivery efficiency is assessed by quantifying AF647 signal via flow cytometry using the established protocols and by fluorescence microscopy of frozen lung sections with DAPI and cell specific stains. Antibodies (Abs) used for co-staining include keratin 5 (basal cells in submucosal glands), acetylated-tubulin and FoxJl (ciliated or non-ciliated airway epithelial cells depending on staining), nerve growth factor receptor, keratin 14, p63 (basal cells in airways), and Muc5AC (goblet cells), Foxll lonocytes, EpCAM+ epithelial cells, CD31+ endothelial cells, and CD45+ leukocytes.

[0238] The top 5 performing NP formulations are delivered by IT instillation, and dose response is assessed (in mg: 10, 20, 50, 100; n=10 mice / dose). NP encapsulated ptLeu-sLPV- hLa and scrambled control are tested for safety and efficacy in SGG mice. Safety is assessed by standard serum chemistry analysis (including AST, ALT, Aik Phos, T. Bilirubin, BUN, Creatinine), serum and bronchoalveolar lavage (BAL) cytokine analyses (including IL-6, IL- la, MIP-1 a, GM-CSF, RANTES, KC, G-CSF) and histopathological examination of organs (brain, heart, lung, liver, spleen, kidney) 24-48 hours post-treatment. Transfection and PTC suppression efficiency of ptLeu-sLPV-hLa in live mice, ex vivo lungs, and homogenized lung tissue is assessed for Nluc luminescence by IVIS luminometry. Short-term efficacy studies after a single delivery of PACE NPs encapsulating ptLeu-sLPV-hLa and scrambled control will take place 5d post-delivery. The best performing PACE NP formulation is identified to proceed to longer-term in vivo studies.

[0239] Long-term assessment of in vivo ACE-tRNA delivery to SGG mice

[0240] To translate this technology to the clinic, long-term measures of efficacy must be assessed. The effects of a single delivery of the optimal PACE NP formulation identified above are assessed. PACE NPs encapsulating ptLeu-sLPV-hLa and scrambled control are again delivered by IT instillation, and a dose response is assessed (in mg: 10, 20, 50, 100; n=10 mice / dose). Delivery efficacy measurements after a single NP administration are assessed and quantified via IVIS luminescence at 5d, 20d, Imo, 2mo, and 3mo post-delivery. As a measure of long-term animal well-being, mouse weights are tracked twice weekly throughout the duration of the long-term study. At the 3-month endpoint, NP delivery is assessed by flow cytometry and microscopy as described above in E2.1, and transfection efficiency and ACE- tRNA PTC suppression activity is and quantified by luminescence of homogenized lung tissue. Safety is assessed as described above.

[0241] Repeated dose assessment of in vivo ACE-tRNA delivery to mice

[0242] In addition to assessing the long-term efficacy of a single PACE NP ACE-tRNA treatment, the effects of repeat dosing are assessed. The best-performing PA CE NP formulation is used, and administered to SGG mice twice with a Imo interval in between doses. Dose response of ptLeu-sLPV-hLa and scrambled control is assessed (in mg: 10, 20, 50, 100; n=10 mice / dose). Efficacy is quantified by weekly IVIS luminescence after the first dose administration. As a measure of animal well-being, body weights are tracked twice weekly throughout the duration of this study and then daily after the 2nddose. 5 days after the 2nd, NP delivery is assessed by flow cytometry and microscopy as described above, with transfection efficiency and ACE-tRNA activity assessed and quantified by luminescence of homogenized lung tissue. Safety studies are performed as described above, 24 hours after the 2nddose.

[0243] Quantification of the ability of pfLen-sLPV-hLa to suppress W1282X-CFTR in mouse lungs C57BL / 6 mice harboring the W1282X nonsense mutation in the CFTR gene are previously acquired and are currently maintained in the vivarium at the University of Rochester Medical Center (URMC). While these genetically modified mice serve as a useful tool for certain in vivo studies, it is well established in the scientific community that murine models are inherently limited in their ability to recapitulate cystic fibrosis (CF) lung pathogenesis. This limitation arises from substantial interspecies differences, including disparities in anatomical scale, pulmonary cellular composition, physiological responses, host-pathogen interactions, behavioral patterns, and overall lifespan.

[0244] W1282X-CFTR mouse models are valuable tools for evaluating premature termination codon (PTC)-targeted therapeutics, as the observed alterations in CFTR transcripts closely mirror those in human patients. Upon successful demonstration of greater than 10% restoration of CFTR function in W1282X mice using the disclosed therapeutic approaches, the strategy is further evaluated in the G542X-CF rat model or in a genetically engineered CF ferret model harboring a relevant nonsense mutation. Additionally, intratracheal (IT) administration of PACE nanoparticle (NP) formulations has been shown to exhibit similar delivery profiles in both murine and large animal models, supporting translational relevance of the proposed delivery system.

[0245] The optimal PACE NP formulation and dosing regimen identified above are utilized to administer optLeu-sLPV-hLa-AF647 and a scrambled control formulation to the lungs of 3- week-old homozygous CFTR W1282X mice. Post-administration evaluations are conducted at 7, 14, and 21 days. Given that only approximately 40% of homozygous CFTR W1282X mice survive beyond 40 days of age due to intestinal obstruction, the study is initiated with sufficiently large cohorts to ensure statistical robustness at each time point. Specifically, 16 mice are included in the 21-day cohort, and 12 mice each is included in the 7-day and 14-day cohorts, in order to achieve a minimum of six surviving mice per endpoint.

[0246] Group sizes are calculated to ensure statistical confidence in detecting a 10% rescue of endpoints, including CFTR mRNA expression and function. A conservative standard deviation estimate of 10 is employed based on preliminary Ussing chamber data, and power analysis is conducted using parameters of a = 0.05 and power = 0.8. Based on this analysis, the proposed sample sizes are determined to achieve 80% power to detect differences in the range of 10 to 16, depending on the number of mice available at each time point. Both male and female mice are utilized to satisfy the required sample numbers. At each designated time point, tracheas are excised, longitudinally bisected, and subjected to Ussing chamber measurements according to established protocols. The change in CFTR short-circuit current is determined following the sequential basolateral administration of forskolin and IBMX (F&I), followed by CFTR inhibition using Inhl72 (Fig. 14).

[0247] CFTR activity is also measured in intestinal segments (duodenum, ileum, jejunum, colon) harvested from the same animals, serving as negative controls, wherein CFTR function is not expected. A correction exceeding 10% in short-circuit current is predicted in airway tissues obtained from mice administered ptLeu-sLPV-hLa, whereas no such correction is anticipated in mice receiving a scramble control.

[0248] The right lung lobe is perfused, inflated with agarose, and embedded in OCT compound for preparation of frozen sections. To minimize the total number of animals used, the left lung lobe is divided into upper, middle, and lower segments. These segments are allocated across the cohort for one of the following purposes: (1) flash freezing for subsequent Western blot protein analysis, or (2) immediate RNA extraction for quantitative reverse transcription PCR (qRT-PCR) or digital droplet PCR (ddPCR) analysis of CFTR mRNA levels. Frozen lung samples are solubilized, and glycosylated CFTR protein is isolated via wheat germ agglutinin precipitation. The purified proteins are then subjected to immunoblotting using an anti-CFTR monoclonal antibody (1 :1000 dilution; clone M3A7, Millipore, USA).

[0249] Following the isolation of total RNA, the abundance of CFTR mRNA is quantified using quantitative reverse transcription PCR (qRT-PCR) or digital droplet PCR (ddPCR). Tissue sections from the right lung lobe are excised at three anatomical levels — top, middle, and bottom — and imaged by confocal microscopy to detect optLeu-sLPV-hLa-AF647 and DAPI fluorescence. Quantification is conducted by determining the number of AF647-positive cells relative to the total number of cells across 10 sections per anatomical level. Automated image analysis is performed using MATLAB-based software developed by the Piotrowski- Daspti laboratory.

[0250] Cell-type-specific antibody co-staining is conducted as described above. Inflammatory cytokine levels are measured in a subset of mice (n=6 per experimental group) at three time points: prior to transfection, immediately post-transfection, and at the time of lung harvest (7- day time point), to assess potential treatment-induced inflammatory responses. Histological evaluation using hematoxylin and eosin (H&E) staining is carried out to identify pathological changes in lung tissue. To evaluate therapeutic efficacy, optLeu-sLPV-hLa-AF647 and a scrambled control are administered, alongside untreated naive cohorts, across three time points using a total of 144 W1282X mice (n=15-16 per group). As demonstrated, the therapeutic platform combining ACE-tRNAs and PACE nanoparticles (NPs) resulted in the restoration of greater than 10% of normal CFTR function in W1282X CF mice.

[0251] EXAMPLE 3

[0252] Picovectors (sLPVs) containing NLS signals for enhanced nuclear entry

[0253] Three previously characterized, but structurally distinct, nuclear localization signal (NLS) sequences — SV40, Tyl, and hLa — were evaluated alongside a scrambled hLa peptide (Scram) as a negative control. Notably, all tested NLS sequences were found to significantly enhance PTC suppression in aphidicolin-treated PTC reporter 16HBE14o- cells. Among the sequences tested, hLa demonstrated the highest level of enhancement, exhibiting a 3.5-fold increase in suppression activity relative to the Scram control.

[0254] To evaluate whether the optimized ACE-tRNALeuuGA sequence could be employed in sLPVs, dose-response studies were conducted in which increasing amounts of ACE-tRNA- sLPV DNA were transfected into Nluc-PTC / Fluc reporter 16HBEo-cells using Lipofectamine 2000. These studies yielded two notable results: (1) the optimized ptACE-tRNALeuuGA-sLPVs construct exhibited approximately a 6.5-fold greater maximal premature termination codon (PTC) suppression activity compared to the original sequence (FIG. 15); and (2) the optimized construct achieved 3.5-fold higher suppression efficiency when only 0.5 ng G / VACE- tRNALeuuGA -sLPV was delivered, relative to 75 ng of the original construct (Fig. 15).

[0255] These findings demonstrated that the optimized sequence conferred (A) substantial efficacy even under conditions of low delivery efficiency, and (B) the potential to achieve therapeutically meaningful levels of CFTR PTC suppression with significantly reduced quantities of sLPV.

[0256] The 5 ’-conjugated nuclear localization signal (NLS) sequences were subsequently paired with the ptACE-tRNALeuuGA-sLPVs (also referred to as “optLeu-sLPVs”), and this pairing was found to significantly enhance premature termination codon (PTC) suppression in aphidicolin-treated PTC reporter 16HBE14o- cells (Fig. 16). Among the tested NLS sequences, both Tyl and hLa NLSs were observed to support comparably potent improvements in PTC suppression. Given that cytoplasmic double-stranded DNA (dsDNA) is known to activate the cyclic GMP-AMP synthase-stimulator of interferon genes (cGAS-STING) innate immune pathway — a recognized concern for therapeutic DNA delivery to airway cells — it was necessary to evaluate whether the disclosed technologies induced such activation. To this end, cyclic GMP- AMP (cGAMP) levels were assessed via enzyme-linked immunosorbent assays (ELISA; ThermoFisher) in HeLa cells following transfection with various DNA platforms, including CFTR and ACE-tRNA plasmid cDNA (pcDNA), ACE-tRNA- sLPV, and optLeu-sLPV-hLa constructs (Fig. 17).

[0257] Strikingly, the diminutive size of the ptLeu-sLPV was found to significantly reduce cGAMP generation by approximately 25%, and the addition of the hLa NLS further reduced cGAMP generation by approximately 83%, relative to CFTR pcDNA (Fig. 17). These findings were consistent with prior reports indicating that a reduction in DNA size attenuates activation of the cGAS-STING pathway. It was hypothesized that the incorporation of the hLa NLS decreased the residence time of the sLPV in the cytoplasm, thereby further diminishing activation of the cGAS-STING signaling cascade. Notably, when the amount of ptLeu-sLPV- hLa DNA was reduced to 150 ng and 7.5 ng — quantities sufficient to maintain maximal premature termination codon (PTC) suppression activity — no detectable cGAMP generation was observed (Fig. 17). Collectively, these results supported ptLeu-sLPV-hLa-AF647 as the lead cargo candidate for PACE nanoparticle-mediated delivery to the airways of mice.

[0258] EXAMPLE 4

[0259] Labeled ACE-tRNA LPV assembly protocol

[0260] Oligonucleotides were synthesized by Integrated DNA Technologies (IDT) with 5’ phosphorylation modifications. Each oligonucleotide comprising a hairpin end was synthesized with an internal PEG4-DBCO modification in the loop and a 5’ phosphorylation modification. All oligonucleotides were resuspended to a concentration of 100 pM in TE buffer (Fisher Scientific).

[0261] Azide-containing NLS peptides (Genscript) or Alexa Fluor fluorescent dyes (Thermo Fisher Scientific) were resuspended to 1 mM in either molecular biology-grade water (for peptides) or DMSO (for Alexa Fluor dyes). Labeling reactions were conducted individually for each oligonucleotide hairpin end. Atypical labeling reaction consisted of 15 pL DBCO-hairpin (200 pmol hairpin oligonucleotide at a final concentration of 1.33 pM in the reaction), 30 pL azide-label (4 nmol azide-label at a final concentration of 26.7 pM in the reaction), and 105 pL water. Reactions were incubated at room temperature in the dark for 48 hours.

[0262] Oligonucleotides comprising the ACE-tRNA cargo were annealed in 1 * IDT annealing buffer (100 mM potassium acetate, 30 mM HEPES, pH 7.5), with each oligonucleotide present at a final concentration of 10 pM in the annealing mixture. The mixture was heated to 95 °C for 5 minutes and then cooled to 4 °C over 30 minutes using a thermocycler.

[0263] The labeled hairpin ends were annealed to the core ACE-tRNA assembly by mixing 30 pL of each labeled hairpin with 30 pL of the annealed core ACE-tRNA. The complete linear picovector annealing mixture was heated to 65 °C for 5 minutes and then cooled to 4 °C over 20 minutes in a thermocycler.

[0264] A typical linear picovector assembly reaction consisted of 90 pL of the annealed oligonucleotide mixture [30 pL of each labeled hairpin (133 nM each, final concentration in the ligation reaction) and 30 pL of annealed core ACE-tRNA (1 pM, final concentration in the ligation reaction)], 30 pL T4 DNA ligase buffer (New England Biolabs), 6 pL T4 DNA ligase (2400 units; NEB), and 174 pL water. The ligation reaction was incubated at room temperature in the dark for 16 hours.

[0265] To remove residual non-ligated products, 6 pL of T5 exonuclease (600 units; NEB) was added to the reaction mixture, followed by incubation at 37 °C for 2 hours. The labeled linear picovector (LPV) was then purified using the Monarch DNA Cleanup Kit and quantified using a NanoDrop spectrophotometer. hLa NLS peptide:

[0266] GGPVKRAREETDKEEPASKQQKTENGAGDQ (SEQ ID NO: 1)

[0267] Tyl NLS peptide:

[0268] GGPNSKKRSLEDNETEIKVSRDTWNTKNMRSLEPPRSKKRIH (SEQ ID NO: 2)

[0269] SV40 NLS peptide:

[0270] GGGPKKKRKVED (SEQ ID NO: 3)

[0271] Scram neg control peptide:

[0272] GGPSEVANKEPQQTAEGKEGKTRAKRDEDQ (SEQ ID NO: 10)

[0273] SV40 DTS: TGTtggttgctgactaattgagatgcatgctttgcatacttctgcctgctggggagcctggggactttccacaccGAACG (SEQ

[0274] ID NO: 5)

[0275] 3xNFKB DTS: tacgggaaattccacctcgggaaattcctgatcgggaaattccgaacg (SEQ ID NO: 6)

[0276] The present disclosure is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention, in addition to those described herein, will become apparent to those skilled in the art from the foregoing description and the accompanying figures. Such modifications are intended to fall within the scope of the appended claims.

Claims

CLAIMSWhat is claimed is:

1. An oligonucleotide set comprising: a first hairpin oligonucleotide comprising from 5’ end to 3’ end: a first antisense strand, a first loop, and a first sense strand that is complementary to the first antisense strand; and a second hairpin oligonucleotide comprising from 5’ end to 3’ end: a second sense strand, a second loop, and a second antisense strand that is complementary to the second sense strand, wherein the first sense strand and the second sense strand are adapted to be joined together to form a nucleic acid sequence encoding a RNA molecule, and wherein the first loop or the second loop or another part of the oligonucleotide is directly or indirectly linked with a nuclear targeting moiety.

2. An oligonucleotide set comprising: a first hairpin oligonucleotide comprising from 5’ end to 3’ end: a first antisense strand, a first loop, and a first sense strand that is complementary to the first antisense strand; a second hairpin oligonucleotide comprising from 5’ end to 3’ end: a second sense strand, a second loop, and a second antisense strand that is complementary to the second sense strand; and a third sense strand and a third antisense strand having a sequence complementary to the third sense strand, wherein the first sense strand, the third sense strand, and the second sense strand are adapted to be joined together in an order to form a second nucleic acid sequence encoding a RNA molecule, and wherein the first loop or the second loop or another part of the oligonucleotide is directly or indirectly linked with a nuclear targeting moiety.

3. The oligonucleotide set of claim 1, wherein when the first sense strand and the second sense strand are joined, the first hairpin oligonucleotide and the second hairpin oligonucleotide form a closed-end DNA thread (CEDT) molecule.

4. The oligonucleotide set of any one of claims 1 and 3, wherein the first hairpin oligonucleotide comprises a nucleic acid sequence encoding a tRNA leader.

5. The oligonucleotide set of any one of claims 1 and 3-4, wherein the second hairpin oligonucleotide comprises a nucleic acid sequence encoding a RNA polymerase III termination signal.

6. The oligonucleotide set of any one of claims 1 and 3-5, further comprising a third sense strand and a third antisense strand having a sequence complementary to the third sense strand.

7. The oligonucleotide set of claim 6, wherein the first sense strand, the third sense strand, and the second sense strand are adapted to be joined together in an order to form a second nucleic acid sequence encoding the RNA molecule.

8. The oligonucleotide set of claim 2, wherein when the first sense strand, the third sense strand, and the second sense strand are joined, the first hairpin oligonucleotide, the third sense and antisense strands, and the second hairpin oligonucleotide form a closed-end DNA thread (CEDT) molecule.

9. The oligonucleotide set of any one of claims 2 and 8, wherein the third sense strand comprises a nucleic sequence encoding a tRNA leader.

10. The oligonucleotide set of any one of claims 2 and 8-9, wherein the third sense strand comprises a nucleic sequence encoding a RNA polymerase III termination signal.

11. The oligonucleotide set of any one of the preceding claims, wherein the RNA molecule comprises tRNA.

12. The oligonucleotide set of claim 11, wherein the tRNA comprises an anti-code edited- tRNA (ACE-tRNA).

13. The oligonucleotide set of any one of claims 11-12, wherein the tRNA is selected from the group consisting of Arg-tRNA-UGA, Gln-tRNA-UAA, Gln-tRNA-UAG, Trp-tRNA- UGA, Trp-tRNA-UAG, Glu-tRNA-UAA, Glu-tRNA-UAG, Cys-tRNA-UGA, Tyr-tRNA- UAG, Tyr-tRNA-UAA, Leu-tRNA-UGA, Leu-tRNA-UAG, Leu-tRNA-UAA, Lys-tRNA- UAG, Lys-tRNA-UGA, Ser-tRNA-UGA, Ser-tRNA-UAG, and Ser-tRNA-UAA.

14. The oligonucleotide set of any one of claims 12-13, wherein the ACE-tRNA causes a ribosome to read through one or more stop codons during translation.

15. The oligonucleotide set of claim 14, wherein the one or more stop codons comprise a premature termination codon (PTC).

16. The oligonucleotide set of claim 15, wherein the premature termination codon (PTC) is present in a nucleic acid sequence encoding cystic fibrosis transmembrane conductance regulator (CFTR).

17. The oligonucleotide set of any one of the preceding claims, wherein the nucleic acid sequence has a size of from 200 nucleotides to 1,000 nucleotides.

18. The oligonucleotide set of any one of the preceding claims, wherein the first loop or the second loop or another part of the oligonucleotide is linked with an agent.

19. The oligonucleotide set of claim 18, wherein the agent comprises a labeling agent, a peptide, a bioactive agent, or a combination thereof.

20. The oligonucleotide set of claim 19, wherein the labeling agent comprises any one of N- hydroxysuccinimide, thiol-maleimide, and azide-dibenzocyclooctyne.

21. The oligonucleotide set of any one of the preceding claims, wherein the first hairpin oligonucleotide or the second hairpin oligonucleotide comprises one or more chemically modified nucleotides.

22. The oligonucleotide set of claim 21, wherein the one or more chemically modified nucleotides comprise a 2’-O-methyl modified sugar moiety.

23. The oligonucleotide set of any one of claims 21-22, wherein the one or more chemically modified nucleotides comprise a modified internucleoside linkage.

24. The oligonucleotide set of any one of claims 1-23, wherein the nuclear targeting moiety comprises a peptide or a protein having a nuclear localization signal or sequence (NLS).

25. The oligonucleotide set of claim 24, wherein the peptide or protein is linked to the first loop or the second loop or another part of the oligonucleotide via a linker.

26. The oligonucleotide set of any one of claims 24-25, wherein the protein is a transcription factor or a nuclear protein.

27. The oligonucleotide set of claim 25 or 26, wherein the linker is a small molecule compound, a polypeptide, or a oligonucleotide.

28. The oligonucleotide set of any one of claims 1-23, wherein the nuclear targeting moiety comprises a nucleic acid having a DNA targeting sequence (DTS).

29. The oligonucleotide set of any one of claims 1-23, wherein the nuclear targeting moiety comprises a binding pair having(i) a first member that is linked to the first loop or the second loop or another part of the oligonucleotide, and(ii) a second member that contains to a NLS or a DTS or is linked to the NLS or DTS; wherein the first member and the second member are designed to bind to each other.

30. A composition comprising the oligonucleotide set of any one of the preceding claims.

31. The composition of claim 30, wherein the composition is formulated as a nanoparticle formulation.

32. A kit comprising the oligonucleotide set of any one of claims 1-28 and optionally a ligase.

33. The kit of claim 32, wherein the ligase is a T4 DNA ligase.

34. A method for making a closed-end DNA thread (CEDT) molecule, comprising: providing an oligonucleotide set according to any one of claims 1-28; and ligating components of the oligonucleotide set, thereby obtaining the CEDT molecule.

35. The method of claim 34, wherein the oligonucleotide set is synthesized chemically.

36. The method of any one of claims 34-35, wherein the oligonucleotide set is synthesized with chemically modified nucleotides.

37. The method of any one of claims 34-36, wherein the closed-end DNA thread molecule is further linked to a labeling agent, a bioactive agent, or a combination thereof.

38. A closed-end DNA thread (CEDT) molecule made according to the method of any one of claims 34-37.

39. A closed-end DNA thread (CEDT) molecule comprising the components recited in any one of claims 1-29.

40. A method of treating a disease associated with a premature termination codon (PTC) in a subject in need thereof, comprising administering to the subject the closed-end DNA thread (CEDT) molecule of claim 39, or a pharmaceutical composition thereof.

41. The method of claim 40, wherein the disease is selected from the group consisting of cystic fibrosis, Duchenne and Becker muscular dystrophies, retinoblastoma, neurofibromatosis, ataxia- telangiectasia, Tay-Sachs disease, Wilm’s tumor, hemophilia A, hemophilia B, Menkes disease, Ullrich’s disease, b-Thalassemia, type 2A and type 3 von Willebrand disease, Robinow syndrome, brachydactyly type B (shortening of digits and metacarpals), inherited susceptibility to mycobacterial infection, inherited retinal disease,inherited bleeding tendency, inherited blindness, congenital neurosensory deafness and colonic agangliosis and inherited neural develop-mental defect including neurosensory deafness, colonic agangliosis, peripheral neuropathy and central dysmyelinating leukodystrophy, Liddle’s syndrome, xeroderma pigmentosum, Fanconi’s anemia, anemia, hypothyroidism, p53-associated cancers, esophageal carcinoma, osteocarcinoma, ovarian carcinoma, hepatocellular carcinoma, breast cancer, hepatocellular carcinoma, fibrous histiocytoma, ovarian carcinoma, SRY sex reversal, triosephosphate isomerase-anemia, diabetes, rickets, Hurler Syndrome, Dravet Syndrome, Spinal Muscular Dystrophy, Usher Syndrome, Aniridia, Choroideremia, Ocular Coloboma, Retinitis pigmentosa, dystrophic epidermolysis bullosa, Pseudoxanthoma elasticum, Alagille Snydrome, Waardenburg-Shah, infantile neuronal ceroid lipofuscinosis, Cystinosis, X- linked nephrogenic diabetes insipidus, McArdle’s disease and Polycystic kidney disease.

Citation Information

Patent Citations

  • Methods and systems for high homologous recombination ("HR") targeting efficiency

    US20080187999A1

  • Non-viral transfection vector

    WO2000037659A1

  • Generation of single-strand circular DNA from linear self-annealing segments

    WO2001040516A2

  • Substituted, non-coding nucleic acid molecule used for the therapeutic and prophylactic immune stimulation in humans and higher animals

    WO2005080567A1

  • vectors

    WO2016195598A1