Albumin-binding reagents

Abstract

The present invention relates to reagents comprising an albumin-binding moiety, their uses and related aspects.

Description

[0001]Ascendis Pharma A / S 1 CPX75149PC09 July 2025Albumin-binding reagents The present invention relates to reagents comprising an albumin-binding moiety, their uses and related aspects. 5 Whereas some classes of therapeutic proteins, including antibodies, have long inherent half- lives, many other molecules, particularly protein or peptide hormones are often susceptible to enzymatic degradation, renal clearance and / or rapid receptor-mediated clearance, which leads to a short plasma elimination half-life. Furthermore, due to the challenges associated with oral10 delivery, most peptide- or protein-based drugs require parenteral administration, whichcombined with a short half-life necessitates frequent injections, resulting in discomfort and inconvenience for the patient. This may negatively impact adherence and, ultimately, limit treatment efficacy and outcomes. 15 Injecting lipidated peptides has been demonstrated to have slower absorption from the subcutaneous tissue compared to the non-derivatized peptide as well as longer circulatory half- life due to reversible binding to albumin. The half-life of endogenous albumin in the circulation is approximately 3 weeks. This long half-life can be attributed both to its large molecular size, which minimizes renal clearance, as well as to recycling via the neonatal Fc receptor (FcRn). 20 In the circulation, the large molecular size protects the bound peptide from renal clearance and reduces the rate of distribution to the extravascular compartment. The slower absorption is thought to be due to a reduced rate of diffusion in the tissue by a mechanism involving interaction of the fatty acid side chain with cell membranes and / or 25 proteins such as albumin present at the injection site. The rate of diffusion in the tissue following injection and the passage over the capillary wall would expectedly be reduced due to the large molecular size of the albumin–peptide complex. Molecules with a molecular size greater than approximately 16 kDa are preferentially alternatively be absorbed via a lymphatic route compared to direct absorption into blood across the capillary wall. 30 Thus, slower absorption and reversible albumin binding has enabled extension of dosing intervals for drugs, such as peptide drugs, to up to a week. However, an even further extension of the dosing intervals would be desirable.Ascendis Pharma A / S 2 CPX75149PC09 July 2025It is an object of the present invention to overcome the shortcomings of current therapies at least partially. This object is achieved with a reagent of formula (Ia)5 (Ia), wherein -AB1is an albumin-binding moiety; -L2- is spacer moiety comprising a polymeric moiety; and-FG is a functional group. 10 In a further aspect the present application relates to a reagent of formula (Ib) wherein -AB1is an albumin-binding moiety;15 -L2- is spacer moiety comprising a polymeric moiety;-L3- is absent or a spacer moiety;-L1- is a linker moiety; and-FG1is a functional group. 20 In a further aspect the present invention relates to a method of synthesizing a compound of formula (Ic) (Ic), wherein -D- is independently a drug moiety;25 -AB1 and -AB2 are independently an albumin-binding moiety;-L1- is a linker moiety covalently and reversibly connected to -D-;-L2- is a spacer moiety comprising a polymeric moiety;-L4- is absent or a spacer moiety;-L5- is a linkage formed by reaction of -FG and -FG2;30 wherein the method comprising the steps of (i) Providing a reagent of formula (Ia);(ii) Providing a reagent FG2-L4-L1-D-AB2,whereinAscendis Pharma A / S 3 CPX75149PC09 July 2025-FG2 is a functional group capable of reacting with the functional group -FG ofthe reagent of formula (Ia); -L4- is absent or a spacer moiety;-L1- is a linker that is covalently and reversibly conjugated to -D-;5 -AB2is an albumin-binding moiety; and (iii) Reacting the reagent from step (i) with the reagent from step (ii) under suitableconditions to obtain the compound of formula (Ic). 10 In a further aspect the present invention relates to a method of synthesizing a compound of formula (Id) wherein -D- is a drug moiety;15 -AB1and -AB2are independently an albumin-binding moiety; -L1- is a linker moiety covalently and reversibly connected to -D-;-L2- is a spacer;wherein the method comprising the steps of (i) providing a reagent of formula (Ib) in which -L3- is absent;20 (ii) providing a drug of formula H-D-AB2, wherein the drug comprises a functionalgroup capable of reacting with the functional group -FG1of the reagent of formula (Ib); and(iii) reacting the regent from step (i) with the drug from step (ii) under suitableconditions to obtain the compound of formula (Id). 25 In a further aspect the present invention relates to a method of synthesizing a compound of formula (Ie) wherein30 -D- is a drug moiety;-AB1 and -AB2 are independently an albumin-binding moiety;-L1- is a linker moiety covalently and reversibly connected to -D-;-L2- is a spacer;Ascendis Pharma A / S 4 CPX75149PC09 July 2025wherein the method comprising the steps of (i) providing a reagent of formula (Ib);(ii) providing a drug of formula H-D-AB2, wherein the drug comprises a functionalgroup capable of reacting with the functional group -FG1of the reagent of formula 5 (Ib); and (iii) reacting the regent from step (i) with the drug from step (ii) under suitableconditions to obtain the compound of formula (Ie). In a further aspect the present invention relates to compounds of formula (Ic), (Id) and (Ie)10 obtainable by the methods disclosed herein.Within the present invention the terms are used having the meaning as follows. As used herein, the term “GLP-1 receptor agonist” refers to agonists of the GLP-1 receptor 15 (GLP1R) and optionally in addition agonists of one or more other receptors, such as for example a receptor for gastric inhibitory polypeptide (GIPR), a receptor for glucagon (GCGR), a receptor for amylin, a receptor for peptide YY (PYYR) or a receptor for glucagon-like peptide-2 (GLP2R). An “agonist” of a receptor, such as an agonist of the GLP-1 receptor, is a chemical compound that activates such receptor to produce a biological response. If a GLP-120 receptor agonist is in addition to being a GLP1R agonist also an agonist of one receptor other than GLP1R, such as an agonist of GIPR, GCGR, an amylin receptor, a PYYR or GLP2R, such GLP-1 receptor agonist is also referred to as being a “dual GLP-1 receptor agonist” or short “dual agonist”. Likewise, if a GLP-1 receptor agonist is in addition to being a GLP1R agonist also an agonist of two other receptors, which may be selected from the group consisting of 25 GIPR, GCGR, an amylin receptor, a PYYR or GLP2R, such GLP-1 receptor agonist is also referred to as being a “triple GLP-1 receptor agonist” or short “triple agonist”. As used herein, the term “peptide” as used herein refers to a chain of at least 2 and up to and including 50 amino acid monomer moieties, which may also be referred to as “amino acid 30 residues”, linked by peptide (amide) linkages. The amino acid monomers may be selected from the group consisting of proteinogenic amino acids and non-proteinogenic amino acids and may be D- or L-amino acids. The term “peptide” also includes peptidomimetics, such as peptoids,beta-peptides, cyclic peptides and depsipeptides and covers such peptidomimetic chains withAscendis Pharma A / S 5 CPX75149PC09 July 2025up to and including 50 monomer moieties. The cyclic peptides may be mono-, bi-, tri- ortetracyclic peptides. The term “peptide” also includes lasso peptides. As used herein, the term “protein” refers to a chain of more than 50 amino acid monomer 5moieties, which may also be referred to as “amino acid residues”, linked by peptide linkages,in which preferably no more than 12000 amino acid monomers are linked by peptide linkages, such as no more than 10000 amino acid monomer moieties, no more than 8000 amino acid monomer moieties, no more than 5000 amino acid monomer moieties or no more than 2000 amino acid monomer moieties. 10 As used herein, the term “small molecule drug” refers to drugs that are organic compounds with a molecular weight of less than 1000 Da, such as less than 900 Da or less than 800 Da. It is understood that nucleobase-based drug moieties, such as adenine or guanine analogues, may also be a type of small molecule drug. 15 As used herein, the term “medium molecule drug” or “medium size molecule drug” refer to drugs that are organic compounds which are not peptides and which are not proteins and have a molecular weight ranging from and including 1 kDa to 7.5 kDa.20 As used herein, the terms “oligonucleotide” refers to double- or single-stranded RNA and DNAwith preferably 2 to 1000 nucleotides and any modifications thereof. Modifications include, for example, those which provide other chemical groups that incorporate additional charge, polarizability, hydrogen bonding, electrostatic interaction, and fluxionality to the nucleic acid ligand bases or to the nucleic acid ligand as a whole. Such modifications include for example, 25 2’-position sugar modifications, 5-position pyrimidine modifications, 8-position purine modifications, modifications at exocyclic amines, substitution of 4-thiouridines, substitution of 5-bromo or 5-iodo-uracil; backbone modifications, methylations, unusual base-pairing combinations such as the isobases isocytidine and isoguanidine. Modifications can also include 3’ and 5’ modifications such as capping and change of stereochemistry. The term also includes 30 aptamers. As used herein, the term “peptide nucleic acids” refers to organic polymers having a peptidic backbone, i.e., a backbone in which the monomers are connected to each other through peptideAscendis Pharma A / S 6 CPX75149PC09 July 2025linkages, to which nucleobases such as adenine, cytosine, guanine, thymine and uracil, are attached. In certain embodiments, the peptide backbone comprises N-(2-aminoethyl)-glycine. As used herein, the term "random coil" relates to any conformation of a polymeric molecule, 5 including proteins, in which the individual monomeric elements that form said polymeric structure are essentially randomly oriented towards the adjacent monomeric elements while still being chemically bound to said adjacent monomeric elements. In particular, a polypeptide or protein having random coil conformation substantially lacks a defined secondary and tertiary structure. The nature of polypeptide random coils and their methods of experimental 10 identification are known to the person skilled in the art. In particular, the lack of secondary and tertiary structure of a protein may be determined by circular dichroism (CD) measurements. CD spectroscopy represents a light absorption spectroscopy method in which the difference in absorbance of right- and left-circularly polarized light by a substance is measured. Thesecondary structure of a protein can be determined by CD spectroscopy using far-ultraviolet 15 spectra with a wavelength between approximately 190 and 250 nm. At these wavelengths the different secondary structures commonly found in conformations each give rise to a characteristic shape and magnitude of the CD spectrum. Accordingly, by using CDspectrometry the skilled artisan is readily capable of determining whether an amino acid polymer adopts random coil conformation at physiological conditions. 20 When determining whether a peptide or protein adopts random coil conformation under experimental conditions using the methods as described herein, the biophysical parameters such as temperature, pH, osmolarity and protein content may be different to the physiological conditions normally found in vivo. Temperatures between 1 °C and 42 °C or preferably 4 °C 25 to 25 °C may be considered useful to test and / or verify the biophysical properties and biological activity of a peptide or protein under physiological conditions in vitro. Several buffers, in particular in experimental settings (for example in the determination of protein structures, in particular in circular dichroism (CD) measurements and other methods 30 that allow the person skilled in the art to determine the structural properties of a protein / polypeptide or peptide stretch) or in buffers, solvents and / or excipients for pharmaceutical compositions, are considered to represent "physiological solutions" or "physiological conditions" in vitro. Examples of such buffers are, e.g. phosphate-buffered saline (PBS: 115 mM NaCl, 4 mM KH2PO4, 16 mM Na2HPO4 pH 7.4), Tris buffers, acetateAscendis Pharma A / S 7 CPX75149PC09 July 2025buffers, citrate buffers or similar buffers such as those used in the appended examples. Generally, the pH of a buffer representing physiological conditions should lie in a range from 6.5 to 8.5, preferably in a range from 7.0 to 8.0, most preferably in a range from 7.2 to 7.7 and the osmolarity should lie in a range from 10 to 1000 mmol / kg H2O, more preferably in a range 5 from 50 to 500 mmol / kg H2O and most preferably in a range from 200 to 350 mmol / kg H2O. Optionally, the protein content of a buffer representing physiological conditions may lie in a range from 0 to 100 g / l, neglecting the protein with biological activity itself, whereby typical stabilizing proteins may be used, for example human or bovine serum albumin. 10 Other established biophysical methods for determining random coil conformation include nuclear magnetic resonance (NMR) spectroscopy, absorption spectrometry, infrared and Raman spectroscopy, measurement of the hydrodynamic volume via size exclusion chromatography, analytical ultracentrifugation and dynamic / static light scattering as well as measurements of the frictional coefficient or intrinsic viscosity. 15 As used herein the term “physiological conditions” refers to aqueous buffer at pH 7.4, 37°C. As used herein the term “pharmaceutical composition” refers to a composition containing one or more active ingredients, such as for example at least one compound of the present invention, 20 and one or more excipients, as well as any product which results, directly or indirectly, from combination, complexation or aggregation of any two or more of the ingredients of the composition, or from dissociation of one or more of the ingredients, or from other types of reactions or interactions of one or more of the ingredients. Accordingly, a pharmaceutical composition of the present invention encompasses any composition made by admixing one or 25 more compound of the present invention and one or more pharmaceutically acceptable excipient. As used herein, the term "excipient" refers to a diluent, adjuvant, or vehicle with which the therapeutic, such as a drug or prodrug, is administered. Such pharmaceutical excipient may be 30 sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, including but not limited to peanut oil, soybean oil, mineral oil, sesame oiland the like. Water is an example for an excipient when the pharmaceutical composition is administered orally. Saline and aqueous dextrose are examples of excipients when the pharmaceutical composition is administered intravenously. Saline solutions and aqueousAscendis Pharma A / S 8 CPX75149PC09 July 2025dextrose and glycerol solutions are in certain embodiments employed as liquid excipients for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, mannitol, trehalose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, 5 water, ethanol and the like. The pharmaceutical composition, if desired, can also contain minor amounts of wetting or emulsifying agents, pH buffering agents, like, for example, acetate, succinate, tris, carbonate, phosphate, HEPES (4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid), MES (2-(N-morpholino)ethanesulfonic acid), or can contain detergents, like Tween, poloxamers, poloxamines, CHAPS, Igepal, or amino acids like, for example, glycine, lysine, 10 or histidine. These pharmaceutical compositions can take the form of solutions, suspensions, emulsions, tablets, pills, capsules, powders, or sustained-release formulations. The pharmaceutical composition may be formulated as a suppository, with traditional binders and excipients such as triglycerides. Oral formulation can include standard excipients such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, 15 cellulose, magnesium carbonate, etc. Such compositions will contain a therapeutically effective amount of the drug or drug moiety, together with a suitable amount of excipient so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration. 20 As used herein the term “liquid composition” refers to a mixture comprising a water-soluble compound and one or more solvents, such as water. The term “suspension composition” relates to a mixture comprising at least one water-insoluble compound and one or more solvents, such as water. 25 As used herein, the term “dry composition” means that a pharmaceutical composition is provided in a dry form. Suitable methods for drying are spray-drying and lyophilization, i.e., freeze-drying. Such dry composition has a residual water content of a maximum of 10%, such as less than 5% or less than 2%, determined according to Karl Fischer. In certain embodiments30 such dry pharmaceutical composition is dried by lyophilization. The term “drug” as used herein refers to a substance used in the treatment, cure, prevention, or diagnosis of a disease or used to otherwise enhance physical or mental well-being. If a drug isAscendis Pharma A / S 9 CPX75149PC09 July 2025conjugated to another moiety, the moiety of the resulting product that originated from the drug is referred to as “drug moiety”. As used herein the term “prodrug” refers to a covalent conjugate in which a drug moiety is 5 reversibly and covalently connected to a specialized protective group through a reversible linker moiety, also referred to as “reversible prodrug linker moiety” or “reversible linkermoiety”, which is conjugated through a reversible linkage to the drug moiety and wherein the specialized protective group alters or eliminates undesirable properties in the parent molecule. This also includes the enhancement of desirable properties in the drug and the suppression of 10 undesirable properties. The specialized non-toxic protective group is referred to as “carrier”. A prodrug releases the reversibly and covalently bound drug moiety in the form of its corresponding drug. In other words, a prodrug is a conjugate comprising a drug moiety which is covalently and reversibly conjugated to a carrier moiety via a reversible linker moiety, which covalent and reversible conjugation of the carrier to the reversible linker moiety is either15 directly or through a spacer moiety. Such conjugate releases the formerly conjugated drugmoiety in the form of a free unmodified drug. A “reversible linkage” is a linkage that is degradable, i.e., cleavable, in the absence of enzymes under physiological conditions (aqueous buffer at pH 7.4, 37°C) with a half-life ranging from 20 1 hour to three months. A “stable linkage” is a linkage having a half-life under physiological conditions (aqueous buffer at pH 7.4, 37°C) in the absence of enzymes of more than three months. As used herein, the terms “traceless prodrug linker” or “traceless linker” means a reversible 25 prodrug linker, i.e., a linker moiety reversibly and covalently connecting a drug moiety with a carrier, such as -AB1, which upon cleavage releases the drug in its free form. As used herein,the term “free form” of a drug or “free drug” means the drug in its unmodified, pharmacologically active form, i.e., as H-D-AB2. 30 As used herein, the term “reagent” means a chemical compound which comprises at least one functional group for reaction with the functional group of another chemical compound or drug. It is understood that a drug comprising a functional group, such as a primary or secondary amine or hydroxyl functional group, is also a reagent.Ascendis Pharma A / S 10 CPX75149PC09 July 2025As used herein, the term “moiety” means a part of a molecule, which lacks one or more atom(s) compared to the corresponding reagent. If, for example, a reagent of the formula “H-X-H” reacts with another reagent and becomes part of the reaction product, the corresponding moiety of the reaction product has the structure “H–X–” or “–X–”, whereas each “–” indicates 5 attachment to another moiety. Accordingly, a drug moiety is released from a prodrug as a drug. If a chemical structure of a group of atoms is provided, which group of atoms is attached to at least one other moiety, said chemical structure may be attached to the at least one other moiety in either orientation, unless explicitly stated otherwise. For example, a moiety “-C(O)N(R1)-”10 may be attached to two moieties either as “-C(O)N(R1)-” or as “-N(R1)C(O)-”. Similarly, amoiety may be attached to two moieties either as .15 As used herein, the term “functional group” means a group of atoms which can react with other groups of atoms. Functional groups are for example selected from the group consisting of carboxylic acid, primary or secondary amine, maleimide, thiol, sulfonic acid, carbonate, carbamate, hydroxyl, aldehyde, ketone, hydrazine, isocyanate, isothiocyanate, phosphoric acid, 20 phosphonic acid, haloacetyl, alkyl halide, acryloyl, aryl fluoride, hydroxylamine, disulfide, sulfonamides, sulfuric acid, vinyl sulfone, vinyl ketone, diazoalkane, oxirane and aziridine. As used herein, the term “pharmaceutically acceptable salt(s) thereof” refers to salts that retain the biological effectiveness or properties of the compound and that typically are not 25 biologically or otherwise undesirable. In certain embodiments, the compound is capable of forming acid / or base salts by virtue of the presence of amino and / or carboxylic functionalAscendis Pharma A / S 11 CPX75149PC09 July 2025groups or groups similar thereto. Pharmaceutically acceptable acid addition salts can be formed with inorganic acids and organic acids, e.g., acetate, aspartate, benzoate, besylate, bromide / hydrobromide, bicarbonate / carbonate, bisulfate / sulfate, camphorsulfonate, chloride / hydrochloride, chlortheophyllinate, citrate, ethanedisulfonate, fumarate, gluceptate, 5 gluconate, glucuronate, hippurate, hydroiodide / iodide, isethionate, lactate, lactobionate, laurylsulfate, malate, maleate, malonate, mandelate, mesylate, methylsulfate, naphthoate, napsylate, nicotinate, nitrate, octadecanoate, oleate, oxalate, palmitate, pamoate, phosphate / hydrogen phosphate / dihydrogen phosphate, polygalacturonate, propionate, stearate, succinate, subsalicylate, tartrate, tosylate and trifluoroacetate salts. Inorganic acids from which 10 salts can be derived include, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like. Organic acids from which salts can be derived include, for example, acetic acid, propionic acid, glycolic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, toluenesulfonic acid, sulfosalicylic acid, and the 15 like. Pharmaceutically acceptable base addition salts can be formed with inorganic and organic bases. Inorganic bases from which salts can be derived include, for example, ammonium salts and metals from columns I to XII of the periodic table. In certain embodiments, the salts arederived from sodium, potassium, ammonium, calcium, magnesium, iron, silver, zinc, and copper; particularly suitable salts include ammonium, potassium, sodium, calcium and 20 magnesium salts. Organic bases from which salts can be derived include, for example, primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, basic ion exchange resins, and the like. Certain organic amines include isopropylamine, benzathine, cholinate, diethanolamine, diethylamine, lysine, meglumine, piperazine, or tromethamine. The pharmaceutically acceptable salts can be synthesized from a25 parent compound, a basic or acidic moiety, by conventional chemical methods. The term "pharmaceutically acceptable" means a substance that does not cause harm when administered to a patient and in certain embodiments means approved by a regulatory agency, such as the EMA (Europe) and / or the FDA (US) and / or any other national regulatory agency30 for use in animals, in particular for use in humans. As used herein the terms “about” or “approx.” in combination with a numerical value is used to indicate a range ranging from and including the numerical value plus and minus no more than 10% of said numerical value. For example, the phrases “about 200” or “approx.200” isAscendis Pharma A / S 12 CPX75149PC09 July 2025used to mean a range ranging from and including 200 + / - 10%, i.e. ranging from and including180 to 220. It is understood that a percentage given as “about 20%” or “approx.20%” does not mean “20% + / - 10%”, i.e. ranging from and including 10 to 30%, but “about 20%” or “approx.20%” means ranging from and including 18 to 22%, i.e. plus and minus 10% of the numerical 5 value which is 20. As used herein, the term “polymer” means a molecule comprising repeating structural units, i.e., the monomers, connected by chemical bonds in a linear, circular, branched, crosslinked or dendrimeric way or a combination thereof, which may be of synthetic or biological origin or a 10 combination of both. It is understood that a polymer may also comprise one or more other chemical groups and / or moieties, such as, for example, one or more functional groups. In certain embodiments a soluble polymer has a molecular weight of at least 0.5 kDa, e.g., a molecular weight of at least 1 kDa, a molecular weight of at least 2 kDa, a molecular weight of at least 3 kDa or a molecular weight of at least 5 kDa. If the polymer is soluble, it in certain 15 embodiments has a molecular weight of at most 1000 kDa, such as at most 750 kDa, such as at most 500 kDa, such as at most 300 kDa, such as at most 200 kDa, or such as at most 100 kDa. It is understood that for water-insoluble polymers, such as hydrogels, no meaningful molecular weight ranges can be provided. It is understood that also a peptide or protein is a polymer in which the amino acids are the repeating structural units, even though the side chains of each20 amino acid may be different. As used herein, the term “polymeric” means a reagent or a moiety comprising one or more polymers or polymer moieties. A polymeric reagent or moiety may optionally also comprise one or more other moiety / moieties, which are in certain embodiments selected from the group25 consisting of: ^C1-50 alkyl, C2-50 alkenyl, C2-50 alkynyl, C3-10 cycloalkyl, 3- to 10-memberedheterocyclyl, 8- to 11-membered heterobicyclyl, phenyl, naphthyl, indenyl, indanyl,and tetralinyl; and ^linkages selected from the group comprisingAscendis Pharma A / S 13 CPX75149PC09 July 2025 wherein dashed lines indicate attachment to the remainder of the moiety or reagent, and -R and -Raare independently of each other selected from the group consisting of -H, 5 methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, 2- methylbutyl, 2,2-dimethylpropyl, n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2- dimethylbutyl, 2,3-dimethylbutyl and 3,3-dimethylpropyl. The person skilled in the art understands that the polymerization products obtained from a 10 polymerization reaction do not all have the same molecular weight, but rather exhibit a molecular weight distribution. Consequently, the molecular weight ranges, molecular weights, ranges of numbers of monomers in a polymer and numbers of monomers in a polymer as used herein, refer to the number average molecular weight and number average of monomers, i.e., to the arithmetic mean of the molecular weight of the polymer or polymeric moiety and the 15 arithmetic mean of the number of monomers of the polymer or polymeric moiety. Accordingly, in a polymeric moiety comprising “x” monomer units any integer given for “x” therefore corresponds to the arithmetic mean number of monomers. Any range of integers given for “x” provides the range of integers in which the arithmetic mean numbers of 20 monomers lie. An integer for “x” given as “about x” means that the arithmetic mean numbers of monomers lie in a range of integers of x + / - 10%.As used herein, the term “number average molecular weight” means the ordinary arithmetic mean of the molecular weights of the individual polymers.25Ascendis Pharma A / S 14 CPX75149PC09 July 2025As used herein the term “water-soluble” with reference to the compound of the present invention means that at least 1 g of the compound may be dissolved in one liter of water at 20°C to form a homogeneous solution. Accordingly, the term “water-insoluble” with reference to the compound means that less than 1 g of the compound may be dissolved in one liter of 5 water at 20°C to form a homogeneous solution. As used herein, the term “PEG-based” in relation to a moiety or reagent means that said moiety or reagent comprises PEG. In certain embodiments a PEG-based moiety or reagent comprises at least 10% (w / w) PEG, such as at least 20% (w / w) PEG, such as at least 30% (w / w) PEG, 10 such as at least 40% (w / w) PEG, such as at least 50% (w / w), such as at least 60 (w / w) PEG, such as at least 70% (w / w) PEG, such as at least 80% (w / w) PEG, such as at least 90% (w / w) PEG, such as at least 95%. The remaining weight percentage of the PEG-based moiety or reagent are other moieties that in certain embodiments are selected from the following moieties and linkages:15 ^ C1-50 alkyl, C2-50 alkenyl, C2-50 alkynyl, C3-10 cycloalkyl, 3- to 10-memberedheterocyclyl, 8- to 11-membered heterobicyclyl, phenyl, naphthyl, indenyl, indanyl,and tetralinyl; and ^linkages selected from the group comprising 20 wherein dashed lines indicate attachment to the remainder of the moiety or reagent, and -R and -Raare independently of each other selected from the group consisting of -H, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, 2- methylbutyl, 2,2-dimethylpropyl, n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2-25 dimethylbutyl, 2,3-dimethylbutyl and 3,3-dimethylpropyl.Ascendis Pharma A / S 15 CPX75149PC09 July 2025The term “hyaluronic acid-based” is used accordingly. The term “substituted” as used herein means that one or more -H atom(s) of a molecule or moiety are replaced by a different atom or a group of atoms, which are referred to as 5 “substituent”. In certain embodiments the one or more further optional substituents are independently of each other selected from the group consisting of halogen, -CN, -COORx1, -ORx1, -C(O)Rx1, -C(O)N(Rx1Rx1a), -S(O)2N(Rx1Rx1a), -S(O)N(Rx1Rx1a), -S(O)2Rx1, -S(O)Rx1, 10 -N(Rx1)S(O)2N(Rx1aRx1b), -SRx1, -N(Rx1Rx1a), -NO2, -OC(O)Rx1, -N(Rx1)C(O)Rx1a, -N(Rx1)S(O)2Rx1a, -N(Rx1)S(O)Rx1a, -N(Rx1)C(O)ORx1a, -N(Rx1)C(O)N(Rx1aRx1b), -OC(O)N(Rx1Rx1a), -T0, C1-50 alkyl, C2-50 alkenyl and C2-50 alkynyl; wherein -T0, C1-50 alkyl, C2-50alkenyl and C2-50alkynyl are optionally substituted with one or more -Rx2, which are the same or different, and wherein C1-50 alkyl, C2-50 alkenyl and C2-50 alkynyl are optionally15 interrupted by one or more groups selected from the group consisting of -T0-, -C(O)O-, -O-, -C(O)-, -C(O)N(Rx3)-, -S(O)2N(Rx3)-, -S(O)N(Rx3)-, -S(O)2-, -S(O)-, -N(Rx3)S(O)2N(Rx3a)-, -S-, -N(Rx3)-, -OC(ORx3)(Rx3a)-, -N(Rx3)C(O)N(Rx3a)- and -OC(O)N(Rx3)-;-Rx1, -Rx1a, -Rx1bare independently of each other selected from the group consisting of -H, -T0, C1-50alkyl, C2-50alkenyl and C2-50alkynyl; wherein -T0, C1-50alkyl, C2-50alkenyl and C2-5020 alkynyl are optionally substituted with one or more -Rx2, which are the same or different, andwherein C1-50 alkyl, C2-50 alkenyl and C2-50 alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T0-, -C(O)O-, -O-, -C(O)-, -C(O)N(Rx3)-, -S(O)2N(Rx3)-, -S(O)N(Rx3)-; -S(O)2-, -S(O)-, -N(Rx3)S(O)2N(Rx3a)-, -S-, -N(Rx3)-, -OC(ORx3)(Rx3a)-, -N(Rx3)C(O)N(Rx3a)- and -OC(O)N(Rx3)-;25 each T0is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl and 8- to 11-memberedheterobicyclyl; wherein each T0is independently optionally substituted with one or more -Rx2, which are the same or different; each -Rx2is independently selected from the group consisting of halogen, -CN, oxo 30 (=O), -COORx4, -ORx4, -C(O)Rx4, -C(O)N(Rx4Rx4a), -S(O)2N(Rx4Rx4a), -S(O)N(Rx4Rx4a), -S(O)2Rx4, -S(O)Rx4, -N(Rx4)S(O)2N(Rx4aRx4b), -SRx4, -N(Rx4Rx4a), -NO2, -OC(O)Rx4, -N(Rx4)C(O)Rx4a, -N(Rx4)S(O)2Rx4a, -N(Rx4)S(O)Rx4a, -N(Rx4)C(O)ORx4a, -N(Rx4)C(O)N(Rx4aRx4b), -OC(O)N(Rx4Rx4a) and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are the same or different;Ascendis Pharma A / S 16 CPX75149PC09 July 2025each -Rx3, -Rx3a, -Rx4, -Rx4a and -Rx4b is independently selected from the group consisting of -Hand C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different. 5 In certain embodiments the one or more further optional substituents are independently of each other selected from the group consisting of halogen, -CN, -COORx1, -ORx1, -C(O)Rx1, -C(O)N(Rx1Rx1a), -S(O)2N(Rx1Rx1a), -S(O)N(Rx1Rx1a), -S(O)2Rx1, -S(O)Rx1, -N(Rx1)S(O)2N(Rx1aRx1b), -SRx1, -N(Rx1Rx1a), -NO2, -OC(O)Rx1, -N(Rx1)C(O)Rx1a, -N(Rx1)S(O)2Rx1a, -N(Rx1)S(O)Rx1a, -N(Rx1)C(O)ORx1a, -N(Rx1)C(O)N(Rx1aRx1b), 10 -OC(O)N(Rx1Rx1a), -T0, C1-10alkyl, C2-10alkenyl and C2-10alkynyl; wherein -T0, C1-10alkyl, C2-10 alkenyl, and C2-10 alkynyl are optionally substituted with one or more -Rx2, which are the same or different, and wherein C1-10 alkyl, C2-10 alkenyl and C2-10 alkynyl are optionallyinterrupted by one or more groups selected from the group consisting of -T0-, -C(O)O-, -O-, -C(O)-, -C(O)N(Rx3)-, -S(O)2N(Rx3)-, -S(O)N(Rx3)-, -S(O)2-, -S(O)-,15 -N(Rx3)S(O)2N(Rx3a)-, -S-, -N(Rx3)-, -OC(ORx3)(Rx3a)-, -N(Rx3)C(O)N(Rx3a)- and -OC(O)N(Rx3)-; each -Rx1, -Rx1a, -Rx1b, -Rx3 and -Rx3a is independently selected from the group consisting of -H,halogen, C1-6 alkyl, C2-6 alkenyl and C2-6 alkynyl; each T0is independently selected from the group consisting of phenyl, naphthyl, indenyl,20 indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl and 8- to 11-memberedheterobicyclyl; wherein each T0is independently optionally substituted with one or more -Rx2, which are the same or different; each -Rx2is independently selected from the group consisting of halogen, -CN, oxo (=O), -COORx4, -ORx4, -C(O)Rx4, -C(O)N(Rx4Rx4a), -S(O)2N(Rx4Rx4a), -S(O)N(Rx4Rx4a), 25 -S(O)2Rx4, -S(O)Rx4, -N(Rx4)S(O)2N(Rx4aRx4b), -SRx4, -N(Rx4Rx4a), -NO2, -OC(O)Rx4, -N(Rx4)C(O)Rx4a, -N(Rx4)S(O)2Rx4a, -N(Rx4)S(O)Rx4a, -N(Rx4)C(O)ORx4a, -N(Rx4)C(O)N(Rx4aRx4b), -OC(O)N(Rx4Rx4a) and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are the same or different; each -Rx4, -Rx4a and -Rx4b is independently selected from the group consisting of -H, halogen,30 C1-6alkyl, C2-6alkenyl and C2-6alkynyl. In certain embodiments the one or more further optional substituents are independently of each other selected from the group consisting of halogen, -CN, -COORx1, -ORx1, -C(O)Rx1, -C(O)N(Rx1Rx1a), -S(O)2N(Rx1Rx1a), -S(O)N(Rx1Rx1a), -S(O)2Rx1, -S(O)Rx1,Ascendis Pharma A / S 17 CPX75149PC09 July 2025-N(Rx1)S(O)2N(Rx1aRx1b), -SRx1, -N(Rx1Rx1a), -NO2, -OC(O)Rx1, -N(Rx1)C(O)Rx1a, -N(Rx1)S(O)2Rx1a, -N(Rx1)S(O)Rx1a, -N(Rx1)C(O)ORx1a, -N(Rx1)C(O)N(Rx1aRx1b), -OC(O)N(Rx1Rx1a), -T0, C1-6alkyl, C2-6alkenyl and C2-6alkynyl; wherein -T0, C1-6alkyl, C2-6alkenyl and C2-6alkynyl are optionally substituted with one or more -Rx2, which are the same 5or different, and wherein C1-6 alkyl, C2-6 alkenyl and C2-6 alkynyl are optionally interrupted byone or more groups selected from the group consisting of -T0-, -C(O)O-, -O-, -C(O)-, -C(O)N(Rx3)-, -S(O)2N(Rx3)-, -S(O)N(Rx3)-, -S(O)2-, -S(O)-, -N(Rx3)S(O)2N(Rx3a)-, -S-, -N(Rx3)-, -OC(ORx3)(Rx3a)-, -N(Rx3)C(O)N(Rx3a)- and -OC(O)N(Rx3)-;each -Rx1, -Rx1a, -Rx1b, -Rx2, -Rx3 and -Rx3a is independently selected from the group consisting10 of -H, halogen, C1-6alkyl, C2-6alkenyl and C2-6alkynyl; each T0is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl and 8- to 11-memberedheterobicyclyl; wherein each T0is independently optionally substituted with one or more -Rx2, which are the same or different. 15 In certain embodiments a maximum of 6 -H atoms of an optionally substituted molecule are independently replaced by a substituent, e.g. 5 -H atoms are independently replaced by a substituent, 4 -H atoms are independently replaced by a substituent, 3 -H atoms are independently replaced by a substituent, 2 -H atoms are independently replaced by a20 substituent, or 1 -H atom is replaced by a substituent. The term “interrupted” means that a moiety is inserted between two carbon atoms or – if theinsertion is at one of the moiety’s ends – between a carbon or heteroatom and a hydrogen atom,in certain embodiments between a carbon and a hydrogen atom. 25 As used herein, the term “C1-4alkyl” alone or in combination means a straight-chain or branched alkyl moiety having 1 to 4 carbon atoms. If present at the end of a molecule, examples of straight-chain or branched C1-4 alkyl are methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl and tert-butyl. When two moieties of a molecule are linked by the C1-4 alkyl, then 30 examples for such C1-4alkyl groups are -CH2-, -CH2-CH2-, -CH(CH3)-, -CH2-CH2-CH2-, -CH(C2H5)-, -C(CH3)2-. Each hydrogen of a C1-4 alkyl carbon may optionally be replaced by a substituent as defined above. Optionally, a C1-4 alkyl may be interrupted by one or more moieties as defined below.Ascendis Pharma A / S 18 CPX75149PC09 July 2025As used herein, the term “nucleophile” refers to a reagent or functional group that forms a bond to its reaction partner, i.e., the electrophile by donating both bonding electrons.As used herein, the term “C1-6alkyl” alone or in combination means a straight-chain or 5 branched alkyl moiety having 1 to 6 carbon atoms. If present at the end of a molecule, examples of straight-chain and branched C1-6 alkyl groups are methyl, ethyl, n-propyl, isopropyl, n-butyl,isobutyl, sec-butyl, tert-butyl, n-pentyl, 2-methylbutyl, 2,2-dimethylpropyl, n-hexyl, 2- methylpentyl, 3-methylpentyl, 2,2-dimethylbutyl, 2,3-dimethylbutyl and 3,3-dimethylpropyl. When two moieties of a molecule are linked by the C1-6 alkyl group, then examples for such 10 C1-6alkyl groups are -CH2-, -CH2-CH2-, -CH(CH3)-, -CH2-CH2-CH2-, -CH(C2H5)- and -C(CH3)2-. Each hydrogen atom of a C1-6 carbon may optionally be replacedby a substituent as defined above. Optionally, a C1-6 alkyl may be interrupted by one or more moieties as defined below. 15 Accordingly, “C1-10 alkyl”, “C1-20 alkyl” or “C1-50 alkyl” means an alkyl chain having 1 to 10, 1 to 20 or 1 to 50 carbon atoms, respectively, wherein each hydrogen atom of the C1-10, C1-20 or C1-50carbon may optionally be replaced by a substituent as defined above. Optionally, a C1-10 or C1-50 alkyl may be interrupted by one or more moieties as defined below. 20 As used herein, the term “C2-6alkenyl” alone or in combination means a straight-chain or branched hydrocarbon moiety comprising at least one carbon-carbon double bond having 2 to 6 carbon atoms. If present at the end of a molecule, examples are -CH=CH2, -CH=CH-CH3, -CH2-CH=CH2, -CH=CHCH2-CH3and -CH=CH-CH=CH2. When two moieties of a molecule are linked by the C2-6alkenyl group, then an example for such C2-6alkenyl is -CH=CH-. Each 25 hydrogen atom of a C2-6 alkenyl moiety may optionally be replaced by a substituent as defined above. Optionally, a C2-6alkenyl may be interrupted by one or more moieties as defined below. Accordingly, the term “C2-10 alkenyl”, “C2-20 alkenyl” or “C2-50 alkenyl” alone or in combination means a straight-chain or branched hydrocarbon moiety comprising at least one 30 carbon-carbon double bond having 2 to 10, 2 to 20 or 2 to 50 carbon atoms. Each hydrogen atom of a C2-10 alkenyl, C2-20 alkenyl or C2-50 alkenyl group may optionally be replaced by asubstituent as defined above. Optionally, a C2-10 alkenyl, C2-20 alkenyl or C2-50 alkenyl may beinterrupted by one or more moieties as defined below.Ascendis Pharma A / S 19 CPX75149PC09 July 2025As used herein, the term “C2-6 alkynyl” alone or in combination means straight-chain or branched hydrocarbon moiety comprising at least one carbon-carbon triple bond having 2 to 6 carbon atoms. If present at the end of a molecule, examples are -C≡CH, -CH2-C≡CH, CH2-CH2-C≡CH and CH2-C≡C-CH3. When two moieties of a molecule are linked by the 5 alkynyl group, then an example is -C≡C-. Each hydrogen atom of a C2-6 alkynyl group may optionally be replaced by a substituent as defined above. Optionally, one or more double bond(s) may occur. Optionally, a C2-6alkynyl may be interrupted by one or more moieties as defined below. 10 Accordingly, as used herein, the term “C2-10alkynyl”, “C2-20alkynyl” and “C2-50alkynyl” alone or in combination means a straight-chain or branched hydrocarbon moiety comprising at least one carbon-carbon triple bond having 2 to 10, 2 to 20 or 2 to 50 carbon atoms, respectively. Each hydrogen atom of a C2-10 alkynyl, C2-20 alkynyl or C2-50 alkynyl group may optionally bereplaced by a substituent as defined above. Optionally, one or more double bond(s) may occur.15 Optionally, a C2-10 alkynyl, C2-20 alkynyl or C2-50 alkynyl may be interrupted by one or moremoieties as defined below. As mentioned above, a C1-4 alkyl, C1-6 alkyl, C1-10 alkyl, C1-20 alkyl, C1-50 alkyl, C2-6 alkenyl, C2-10 alkenyl, C2-20 alkenyl, C2-50 alkenyl, C2-6 alkynyl, C2-10 alkynyl, C2-20 alkenyl or C2-5020 alkynyl may optionally be interrupted by one or more moieties which in certain embodiments are selected from the group consisting of , wherein dashed lines indicate attachment to the remainder of the moiety or reagent; and 25 -R and -Raare independently of each other selected from the group consisting of -H, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, 2-Ascendis Pharma A / S 20 CPX75149PC09 July 2025methylbutyl, 2,2-dimethylpropyl, n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2- dimethylbutyl, 2,3-dimethylbutyl and 3,3-dimethylpropyl. As used herein, the term "C3-10cycloalkyl" means a cyclic alkyl chain having 3 to 10 carbon 5 atoms, which may be saturated or unsaturated, e.g. cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cyclohexenyl, cycloheptyl, cyclooctyl, cyclononyl or cyclodecyl. Each hydrogen atom of a C3-10 cycloalkyl carbon may be replaced by a substituent as defined above. The term"C3-10 cycloalkyl" also includes bridged bicycles like norbornane or norbornene.10 The term “8- to 30-membered carbopolycyclyl” or “8- to 30-membered carbopolycycle” meansa cyclic moiety of two or more rings with 8 to 30 ring atoms, where two neighboring rings share at least one ring atom and that may contain up to the maximum number of double bonds (aromatic or non-aromatic ring which is fully, partially or un-saturated). In certain embodiments an 8- to 30-membered carbopolycyclyl means a cyclic moiety of two, three, four15 or five rings, in certain embodiments of two, three or four rings. As used herein, the term "3- to 10-membered heterocyclyl" or "3- to 10-membered heterocycle"means a ring with 3, 4, 5, 6, 7, 8, 9 or 10 ring atoms that may contain up to the maximum number of double bonds (aromatic or non-aromatic ring which is fully, partially or un- 20 saturated) wherein at least one ring atom up to 4 ring atoms are replaced by a heteroatom selected from the group consisting of sulfur (including -S(O)-, -S(O)2-), oxygen and nitrogen (including =N(O)-) and wherein the ring is linked to the rest of the molecule via a carbon or nitrogen atom. Examples for 3- to 10-membered heterocycles include but are not limited toaziridine, oxirane, thiirane, azirine, oxirene, thiirene, azetidine, oxetane, thietane, furan, 25 thiophene, pyrrole, pyrroline, imidazole, imidazoline, pyrazole, pyrazoline, oxazole, oxazoline, isoxazole, isoxazoline, thiazole, thiazoline, isothiazole, isothiazoline, thiadiazole, thiadiazoline, tetrahydrofuran, tetrahydrothiophene, pyrrolidine, imidazolidine, pyrazolidine, oxazolidine, isoxazolidine, thiazolidine, isothiazolidine, thiadiazolidine, sulfolane, pyran, dihydropyran, tetrahydropyran, imidazolidine, pyridine, pyridazine, pyrazine, pyrimidine, 30 piperazine, piperidine, morpholine, tetrazole, triazole, triazolidine, tetrazolidine, diazepane, azepine and homopiperazine. Each hydrogen atom of a 3- to 10-membered heterocyclyl or 3-to 10-membered heterocyclic group may be replaced by a substituent as defined below.Ascendis Pharma A / S 21 CPX75149PC09 July 2025As used herein, the term "8- to 11-membered heterobicyclyl" or "8- to 11-memberedheterobicycle" means a heterocyclic moiety of two rings with 8 to 11 ring atoms, where at least one ring atom is shared by both rings and that may contain up to the maximum number of double bonds (aromatic or non-aromatic ring which is fully, partially or un-saturated) wherein 5 at least one ring atom up to 6 ring atoms are replaced by a heteroatom selected from the group consisting of sulfur (including -S(O)-, -S(O)2-), oxygen and nitrogen (including =N(O)-) and wherein the ring is linked to the rest of the molecule via a carbon or nitrogen atom. Examples for an 8- to 11-membered heterobicycle are indole, indoline, benzofuran, benzothiophene,benzoxazole, benzisoxazole, benzothiazole, benzisothiazole, benzimidazole, benzimidazoline, 10 quinoline, quinazoline, dihydroquinazoline, quinoline, dihydroquinoline, tetrahydroquinoline, decahydroquinoline, isoquinoline, decahydroisoquinoline, tetrahydroisoquinoline, dihydroisoquinoline, benzazepine, purine and pteridine. The term 8- to 11-memberedheterobicycle also includes spiro structures of two rings like 1,4-dioxa-8-azaspiro[4.5]decane or bridged heterocycles like 8-aza-bicyclo[3.2.1]octane. Each hydrogen atom of an 8- to 11-15 membered heterobicyclyl or 8- to 11-membered heterobicycle carbon may be replaced by asubstituent as defined below. Similary, the term “8- to 30-membered heteropolycyclyl” or “8- to 30-memberedheteropolycycle” means a heterocyclic moiety of more than two rings with 8 to 30 ring atoms, 20 in certain embodiments of three, four or five rings, where two neighboring rings share at least one ring atom and that may contain up to the maximum number of double bonds (aromatic or non-aromatic ring which is fully, partially or unsaturated), wherein at least one ring atom up to 10 ring atoms are replaced by a heteroatom selected from the group of sulfur (including -S(O)- and -S(O)2-), oxygen and nitrogen (including =N(O)-) and wherein the ring is linked to the rest 25 of a molecule via a carbon or nitrogen atom. It is understood that the phrase “the pair Rx / Ryis joined together with the atom to which they are attached to form a C3-10 cycloalkyl or a 3- to 10-membered heterocyclyl” in relation with amoiety of the structure 30 means that Rxand Ryform the following structure:Ascendis Pharma A / S 22 CPX75149PC09 July 2025 , wherein R is C3-10 cycloalkyl or 3- to 10-membered heterocyclyl.It is also understood that the phrase “the pair Rx / Ry is joint together with the atoms to which5 they are attached to form a ring A” in relation with a moiety of the structure means that Rxand Ryform the following structure: . 10 As used herein, "halogen" means fluoro, chloro, bromo or iodo. In certain embodiments halogen is fluoro or chloro. In general, the term “comprise” or “comprising” also encompasses “consist of” or “consisting of”. 15 The moiety -AB1may be a fatty acid-based albumin-binding moiety or a peptidic albumin binding moiety. In certain embodiments -AB1is a fatty acid-based albumin-binding moiety. In certain embodiments -AB1 is of formula (A):20 wherein the dashed line indicates attachment to -L2-; -F0is of formula (a-1) 25 whereinAscendis Pharma A / S 23 CPX75149PC09 July 2025the dashed line indicates attachment to -LA-; -R0is selected from the group consisting of -CR1R1aR1b, -COOR1, -R1, -R1aand -R1bare selected from the group consisting of -H, methyl, ethyl, 5propyl and isopropyl;n is 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24; -LA- is absent or is of formula (a-2) wherein 10 the unmarked dashed line indicates attachment to -LB-; the dashed line marked with the asterisk indicates attachment to -F0; -Ra- is selected from the group consisting of and ,wherein the dashed line marked with the asterisk indicates attachment to -F0;15 the unmarked dashed line indicates attachment to the remainder of -LA- ; mis 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10;p is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10;-LB- is absent or is of formula (a-3)20 wherein the unmarked dashed line indicates attachment to -L2-; the dashed line marked with the asterisk indicates attachment to -LA; 25 -Rd- is selected from the group consisting of C1-50 alkyl, C2-50 alkenyl and C2-50alkynyl, wherein C1-50 alkyl, C2-50 alkenyl and C2-50 alkynyl may be substitutedAscendis Pharma A / S 24 CPX75149PC09 July 2025with one or more -R1, which may be the same or different, and which C1-50 alkyl, C2-50 alkenyl or C2-50 alkynyl may be interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(R2)-, -S(O)2N(R2)-, -S(O)N(R2)-, -S(O)2-, -S(O)-, 5 -N(R2)S(O)2N(R2a)-, -S-, -N(R2)-, -OC(OR2)(R2a)-, -N(R2)C(O)N(R2a)-, and -OC(O)N(R2)-; each -T- is independently selected from the group consisting of phenyl,naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-memberedheterocyclyl, 8- to 11-membered heterobicyclyl, 8-to 30-membered10 carbopolycyclyl, and 8- to 30-membered heteropolycyclyl; whereineach -T- may independently be substituted with one or more -R1, which maybe the same or different; each -R1is independently selected from the group consisting of halogen, -CN, oxo (=O), -COOR3, -OR3, -C(O)R3, -C(O)N(R3R3a), -S(O)2N(R3R3a), -S(O)N15 (R3R3a), -S(O)2R3, -S(O)R3, -N(R3)S(O)2N(R3aR3b), -SR3,-N(R3R3a), -NO2, -OC(O)R3, -N(R3)C(O)R3a, -N(R3)S(O)2R3a, -N(R3)S(O)R3a, -N(R3)C(O)OR3a, -N(R3)C(O)N(R3aR3b), -OC(O)N(R3R3a), and C1-6alkyl; wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different; 20 each -R2, -R2a, -R3, -R3aand -R3bis independently selected from the group consisting of -H, and C1-6 alkyl, wherein C1-6 alkyl may be substituted with one or more halogen, which may be the same or different; and -Re- is selected from the group consisting of -CH2-, .25 If -Rb- is not absent, then and -LB- isnot absent, then - .In certain embodiments -LA- is of formula (a-2), i.e., is not absent. In certainembodiments -LA- is absent.30Ascendis Pharma A / S 25 CPX75149PC09 July 2025a In certain embodiments -R - is , wherein the dashed line marked with the asteriskindicates attachment to -F0and the unmarked dashed line indicates attachment to the remainder of -LA-. 5In certain embodiments -Ra- is , wherein the dashed line marked with the asteriskindicates attachment to -F0and the unmarked dashed line indicates attachment to the remainder of -LA-. In certain embodiments -Rb- is . In certain embodiments -Rb- is .10 In certain embodiments m of formula (a-2) is 1. In certain embodiments m of formula (a-2) is 2. In certain embodiments m of formula (a-2) is 3. In certain embodiments m of formula (a-2) is 4. In certain embodiments m of formula (a-2) is 5. In certain embodiments m of formula (a- 2) is 6. In certain embodiments m of formula (a-2) is 7. In certain embodiments m of formula 15 (a-2) is 8. In certain embodiments m of formula (a-2) is 9. In certain embodiments m of formula (a-2) is 10. In certain embodiments p of formula (a-2) is 1. In certain embodiments p of formula (a-2) is 2. In certain embodiments p of formula (a-2) is 3. In certain embodiments p of formula (a-2) is 4. 20 In certain embodiments p of formula (a-2) is 5. In certain embodiments p of formula (a-2) is 6. In certain embodiments p of formula (a-2) is 7. In certain embodiments p of formula (a-2) is 8. In certain embodiments p of formula (a-2) is 9. In certain embodiments p of formula (a-2) is 10.25 In certain embodiments -LB- is of formula (a-3). In certain embodiments -LB- is absent.If -LB- is absent, the unmarked dashed line in formula (a-2) indicates attachment to -L2-.In certain embodiments -Rc- is . In certain embodiments -Rc- is .Ascendis Pharma A / S 26 CPX75149PC09 July 2025In certain embodiments -Re- is -CH2-. In certain embodiments -Re- is . In certain embodiments - .In certain embodiments both -LA- and -LB- are absent. If both -LA- and -LB- are absent, the5 dashed line in formula (a-1) indicates attachment to -L2-. In certain embodiments -F0is selected from the group consisting of 10 15 Ascendis Pharma A / S 27 CPX75149PC09 July 2025510 Ascendis Pharma A / S 28 CPX75149PC09 July 2025510 wherein dashed lines indicate attachment to -LA-.Ascendis Pharma A / S 29 CPX75149PC09 July 2025If -LA- is absent, the dashed lines in formulas (a-4) to (a-39) indicate attachment to -LB-. Ifboth -LA- and -LB- are absent, the dashed lines in formulas (a-4) to (a-39) indicate attachmentto -L2-.5 In certain embodiments -F0 is of formula (a-4). In certain embodiments -F0 is of formula (a-5).In certain embodiments -F0is of formula (a-6). In certain embodiments -F0is of formula (a-7). In certain embodiments -F0is of formula (a-8). In certain embodiments -F0is of formula (a-9). In certain embodiments -F0is of formula (a-10). In certain embodiments -F0is of formula (a-11). In certain embodiments -F0is of formula (a-12). In certain embodiments -F0is of 10 formula (a-13). In certain embodiments -F0is of formula (a-14). In certain embodiments -F0is of formula (a-15). In certain embodiments -F0is of formula (a-16). In certain embodiments -F0is of formula (a-17). In certain embodiments -F0is of formula (a-18). In certain embodiments -F0 is of formula (a-19). In certain embodiments -F0 is of formula (a-20). Incertain embodiments -F0is of formula (a-21). In certain embodiments -F0is of formula (a-22). 15 In certain embodiments -F0is of formula (a-23). In certain embodiments -F0is of formula (a-24). In certain embodiments -F0is of formula (a-25). In certain embodiments -F0is of formula (a-26). In certain embodiments -F0is of formula (a-27). In certain embodiments -F0is of formula (a-28). In certain embodiments -F0is of formula (a-29). In certain embodiments -F0is of formula (a-30). In certain embodiments -F0is of formula (a-31). In certain 20 embodiments -F0is of formula (a-32). In certain embodiments -F0is of formula (a-33). In certain embodiments -F0is of formula (a-34). In certain embodiments -F0is of formula (a-35). In certain embodiments -F0is of formula (a-36). In certain embodiments -F0is of formula (a- 37). In certain embodiments -F0is of formula (a-38). In certain embodiments -F0is of formula (a-39). 25 In certain embodiments -F0 is of formula (a-4) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-5) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-6) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-7) and both -LA- and -LB- are absent. In certain30 embodiments -F0 is of formula (a-8) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-9) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-10) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-11) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-12) and both -LA- and -LB- are absent. In certainAscendis Pharma A / S 30 CPX75149PC09 July 2025embodiments -F0 is of formula (a-13) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-14) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-15) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-16) and both -LA- and -LB- are absent. In certain5 embodiments -F0 is of formula (a-17) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-18) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-19) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-20) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-21) and both -LA- and -LB- are absent. In certain10 embodiments -F0 is of formula (a-22) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-23) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-24) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-25) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-26) and both -LA- and -LB- are absent. In certain15 embodiments -F0 is of formula (a-27) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-28) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-29) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-30) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-31) and both -LA- and -LB- are absent. In certain20 embodiments -F0 is of formula (a-32) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-33) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-34) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-35) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-36) and both -LA- and -LB- are absent. In certain25 embodiments -F0 is of formula (a-37) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-38) and both -LA- and -LB- are absent. In certainembodiments -F0 is of formula (a-39) and both -LA- and -LB- are absent.In certain embodiments -LA- is selected from the group consisting ofAscendis Pharma A / S 31 CPX75149PC09 July 20255 Ascendis Pharma A / S 32 CPX75149PC09 July 20255 wherein a dashed line marked with an asterisk indicates attachment to -F0- and an unmarkeddashed line indicates attachment to -LB-. If -LB- is absent an unmarked dashed line indicatesattachment to -L2-. 10 In certain embodiments -LA- is of formula (a-40). In certain embodiments -LA- is of formula(a-41). In certain embodiments -LA- is of formula (a-42). In certain embodiments -LA- is offormula (a-43). In certain embodiments -LA- is of formula (a-44). In certainembodiments -LA- is of formula (a-45). In certain embodiments -LA- is of formula (a-46). In15 certain embodiments -LA- is of formula (a-47). In certain embodiments -LA- is of formula (a-48). In certain embodiments -LA- is of formula (a-49). In certain embodiments -LA- is offormula (a-50). In certain embodiments -LA- is of formula (a-51). In certainembodiments -LA- is of formula (a-52). In certain embodiments -LA- is of formula (a-53). Incertain embodiments -LA- is of formula (a-54). In certain embodiments -LA- is of formula (a-20 55). In certain embodiments -LA- is of formula (a-56). In certain embodiments -LA- is ofAscendis Pharma A / S 33 CPX75149PC09 July 2025formula (a-57). In certain embodiments -LA- is of formula (a-58). In certainembodiments -LA- is of formula (a-59). In certain embodiments -LA- is of formula (a-60). Incertain embodiments -LA- is of formula (a-61). In certain embodiments -LA- is of formula (a-62). In certain embodiments -LA- is of formula (a-63). In certain embodiments -LA- is of5 formula (a-64). In certain embodiments -LA- is of formula (a-65). In certainembodiments -LA- is of formula (a-66). In certain embodiments -LA- is of formula (a-67). Incertain embodiments -LA- is of formula (a-68). In certain embodiments -LA- is of formula (a-69). In certain embodiments -LA- is of formula (a-70). In certain embodiments -LA- is offormula (a-71). In certain embodiments -LA- is of formula (a-72). In certain10 embodiments -LA- is of formula (a-73). In certain embodiments -LA- is of formula (a-74). Incertain embodiments -LA- is of formula (a-75). In certain embodiments -LA- is of formula (a-76). In certain embodiments -LA- is of formula (a-77). In certain embodiments -LA- is offormula (a-78). In certain embodiments -LA- is of formula (a-79). In certainembodiments -LA- is of formula (a-80). In certain embodiments -LA- is of formula (a-81). In15 certain embodiments -LA- is of formula (a-82).In certain embodiments -LB- is selected from the group consisting of20 (a-89),Ascendis Pharma A / S 34 CPX75149PC09 July 20255 10 (a-94), wherein the dashed line marked with the asterisk indicates attachment to -LA-; the unmarked dashed line indicates attachment to -L2-; and q is an integer ranging from and including 2 to 50. 15 If -LA- is absent, the dashed line marked with the asterisk in formulas (a-83) to (a-94) indicatesattachment to -F0. In certain embodiments q of formula (a-84) is an integer ranging from and including 3 to 45. 20 In certain embodiments q of formula (a-84) is an integer ranging from and including 4 to 40. In certain embodiments q of formula (a-84) is an integer ranging from and including 5 to 35. In certain embodiments q of formula (a-84) is an integer ranging from and including 6 to 30.In certain embodiments q of formula (a-84) is an integer ranging from and including 7 to 25.Ascendis Pharma A / S 35 CPX75149PC09 July 2025In certain embodiments q of formula (a-84) is an integer ranging from and including 10 to 20. In certain embodiments q of formula (a-84) is 23.In certain embodiments -LB- is of formula (a-83). In certain embodiments -LB- is of formula5 (a-84). In certain embodiments -LB- is of formula (a-84) with q = 23. In certainembodiments -LB- is of formula (a-85). In certain embodiments -LB- is of formula (a-86). Incertain embodiments -LB- is of formula (a-87). In certain embodiments -LB- is of formula(a-88). In certain embodiments -LB- is of formula (a-89). In certain embodiments -LB- is offormula (a-90). In certain embodiments -LB- is of formula (a-91). In certain10 embodiments -LB- is of formula (a-92). In certain embodiments -LB- is of formula (a-93). Incertain embodiments -LB- is of formula (a-94).In certain embodiments -AB1and / or -AB2is of formula (i) 15 wherein the dashed line indicates attachment to -L2-; n is an integer ranging from and including 14 to 22; and the stereocenter marked with the asterisk is either in S- or R-configuration.In certain embodiments -AB1 and / or -AB2 is of formula (i) and n is 14. In certain20 embodiments -AB1and / or -AB2is of formula (i) and n is 15. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 16. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 17. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 18. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 19. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 20. In certain embodiments -AB125 and / or -AB2is of formula (i) and n is 21. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 22. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 14 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of 30 formula (i) and n is 15 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 16 and the stereocenter markedAscendis Pharma A / S 36 CPX75149PC09 July 2025with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 17 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 18 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) 5 and n is 19 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 20 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 21 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 22 and the stereocenter marked with 10 the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 14 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 15 and the stereocenter marked with the asterisk is in S-configuration. In 15 certain embodiments -AB1and / or -AB2is of formula (i) and n is 16 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 17 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 18 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (i)20 and n is 19 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 20 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 21 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (i) and n is 22 and the stereocenter marked with 25 the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (i-a): wherein 30 the dashed line indicates attachment to -L2-.Ascendis Pharma A / S 37 CPX75149PC09 July 2025In certain embodiments -AB1and / or -AB2is of formula (i-b): wherein the dashed line indicates attachment to -L2-. 5 In certain embodiments -AB1and / or -AB2is of formula (i-c): wherein the dashed line indicates attachment to -L2-. 10 In certain embodiments -AB1and / or -AB2is of formula (i-d): wherein the dashed line indicates attachment to -L2-. 15 In certain embodiments -AB1and / or -AB2is of formula (i-e): wherein the dashed line indicates attachment to -L2-. 20 In certain embodiments -AB1and / or -AB2is of formula (i-f): whereinAscendis Pharma A / S 38 CPX75149PC09 July 2025the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (ii) 5 wherein the dashed line indicates attachment to -L2-; n is an integer ranging from 14 to 22; and the stereocenter marked with the asterisk is either in S- or R-configuration.In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 14. In certain10 embodiments - and / or or -AB2 is of formula (ii) and n is 15. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 16. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 17. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 18. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 19. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 20. In certain embodiments -AB115 and / or -AB2is of formula (ii) and n is 21. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 22. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 14 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of 20 formula (ii) and n is 15 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 16 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 17 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 18 and the stereocenter 25 marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 19 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 20 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 21 and the stereocenter marked with the asterisk is in R-configuration. In 30 certain embodiments -AB1and / or -AB2is of formula (ii) and n is 22 and the stereocenter marked with the asterisk is in R-configuration.Ascendis Pharma A / S 39 CPX75149PC09 July 2025In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 14 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 15 and the stereocenter marked with the asterisk is in S-configuration. In 5 certain embodiments -AB1and / or -AB2is of formula (ii) and n is 16 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 17 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 18 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of 10 formula (ii) and n is 19 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 20 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 21 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii) and n is 22 and the stereocenter 15 marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (ii-a): wherein 20 the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (ii-b): wherein 25 the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (ii-c):Ascendis Pharma A / S 40 CPX75149PC09 July 2025 wherein the dashed line indicates attachment to -L2-. 5 In certain embodiments -AB1and / or -AB2is of formula (ii-d): wherein the dashed line indicates attachment to -L2-. 10 In certain embodiments -AB1and / or -AB2is of formula (ii-e): wherein the dashed line indicates attachment to -L2-. 15 In certain embodiments -AB1and / or -AB2is of formula (ii-f): wherein the dashed line indicates attachment to -L2-.20 In certain embodiments -AB1 and / or -AB2 is of formula (iii) whereinAscendis Pharma A / S 41 CPX75149PC09 July 2025the dashed line indicates attachment to -L2-; t is an integer ranging from and including 14 to 22; and the stereocenter marked with the asterisk is either in S- or R-configuration.5 In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 14. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 15. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 16. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 17. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 18. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 19. In certain10 embodiments -AB1and / or -AB2is of formula (iii) and t is 20. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 21. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 22. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 14 and the stereocenter15 marked with the asterisk is in R-configuration. In certain embodiments -AB1 and / or -AB2 is offormula (iii) and t is 15 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 16 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 17 and the stereocenter marked with the asterisk is in R-configuration. In20 certain embodiments -AB1 and / or -AB2 is of formula (iii) and t is 18 and the stereocentermarked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 19 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 20 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of 25 formula (iii) and t is 21 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 22 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 14 and the stereocenter 30 marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 15 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1 and / or -AB2 is of formula (iii) and t is 16 and the stereocentermarked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 17 and the stereocenter marked with the asterisk is in S-configuration. InAscendis Pharma A / S 42 CPX75149PC09 July 2025certain embodiments -AB1and / or -AB2is of formula (iii) and t is 18 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 19 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 20 and the stereocenter 5 marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (iii) and t is 21 and the stereocenter marked with the asterisk is in S-configuration. Incertain embodiments -AB1and / or -AB2is of formula (iii) and t is 22 and the stereocenter marked with the asterisk is in S-configuration. 10 In certain embodiments -AB1and / or -AB2is of formula (iii-a) (iii-a), wherein the dashed line indicates attachment to -L2-. 15 In certain embodiments -AB1and / or -AB2is of formula (iii-b) wherein the dashed line indicates attachment to -L2-; 20 In certain embodiments -AB1and / or -AB2is of formula (iii-c) (iii-c), wherein the dashed line indicates attachment to -L2-.Ascendis Pharma A / S 43 CPX75149PC09 July 2025In certain embodiments -AB1and / or -AB2is of formula (iii-d) (iii-d), wherein the dashed line indicates attachment to -L2-. 5 In certain embodiments -AB1and / or -AB2is of formula (iii-e) wherein the dashed line indicates attachment to -L2-. 10 In certain embodiments -AB1and / or -AB2is of formula (iii-f) wherein the dashed line indicates attachment to -L2-. 15 In certain embodiments -AB1and / or -AB2is of formula (iv) wherein the dashed line indicates attachment to -L2-, and 20 u is an integer ranging from and including 14 to 22.Ascendis Pharma A / S 44 CPX75149PC09 July 2025In certain embodiments -AB1and / or -AB2is of formula (iv) and u is 14. In certain embodiments -AB1and / or -AB2is of formula (iv) and u is 15. In certain embodiments -AB1and / or -AB2is of formula (iv) and u is 16. In certain embodiments -AB1and / or -AB2is of formula (iv) and u is 17. In certain embodiments -AB1and / or -AB2is of formula (iv) and u is 5 18. In certain embodiments -AB1and / or -AB2is of formula (iv) and u is 19. In certain embodiments -AB1and / or -AB2is of formula (iv) and u is 20. In certain embodiments -AB1and / or -AB2is of formula (iv) and u is 21. In certain embodiments -AB1and / or -AB2is of formula (iv) and u is 22. 10 In certain embodiments -AB1and / or -AB2is of formula (v) wherein the dashed line indicates attachment to -L2-; v is an integer ranging from and including 14 to 22; and15 the stereocenter marked with the asterisk is either in S- or R-configuration.In certain embodiments -AB1and / or -AB2is of formula (v) and v is 14. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 15. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 16. In certain embodiments -AB1and / or -AB2is of 20 formula (v) and v is 17. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 18. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 19. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 20. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 21. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 22. 25 In certain embodiments -AB1 and / or -AB2 is of formula (v) and v is 14 and the stereocentermarked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 15 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 16 and the stereocenter 30 marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is ofAscendis Pharma A / S 45 CPX75149PC09 July 2025formula (v) and v is 17 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 18 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 19 and the stereocenter marked with the asterisk is in R-configuration. In5 certain embodiments -AB1and / or -AB2is of formula (v) and v is 20 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 21 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 22 and the stereocenter marked with the asterisk is in R-configuration. 10 In certain embodiments -AB1and / or -AB2is of formula (v) and v is 14 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 15 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 16 and the stereocenter 15 marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 17 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 18 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 19 and the stereocenter marked with the asterisk is in S-configuration. In 20 certain embodiments -AB1and / or -AB2is of formula (v) and v is 20 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 21 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (v) and v is 22 and the stereocenter marked with the asterisk is in S-configuration. 25 In certain embodiments -AB1and / or -AB2is of formula (v-a) wherein the dashed line indicates attachment to -L2-. 30Ascendis Pharma A / S 46 CPX75149PC09 July 2025In certain embodiments -AB1and / or -AB2is of formula (v-b) wherein the dashed line indicates attachment to -L2-; 5 In certain embodiments -AB1and / or -AB2is of formula (v-c) wherein the dashed line indicates attachment to -L2-. 10 In certain embodiments -AB1and / or -AB2is of formula (v-d) wherein the dashed line indicates attachment to -L2-. 15 In certain embodiments -AB1and / or -AB2is of formula (vi-e) wherein the dashed line indicates attachment to -L2-. 20 In certain embodiments -AB1and / or -AB2is of formula (vi-f)Ascendis Pharma A / S 47 CPX75149PC09 July 2025 wherein the dashed line indicates attachment to -L2-. 5 In certain embodiments -AB1and / or -AB2is of formula (vii) wherein the dashed line indicates attachment to -L2-; w is an integer ranging from and including 14 to 22; and the stereocenter marked with the asterisk is either in S- or R-configuration.10 In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 14. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 15. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 16. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 17. In certain embodiments -AB1and / or -AB2is of formula (vii) and w15 is 18. In certain embodiments -AB1 and / or -AB2 is of formula (vii) and w is 19. In certainembodiments -AB1and / or -AB2is of formula (vii) and w is 20. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 21. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 22. 20 In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 14 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 15 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 16 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of 25 formula (vii) and w is 17 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 18 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 19 and the stereocenter marked with the asterisk is in R-configuration.Ascendis Pharma A / S 48 CPX75149PC09 July 2025In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 20 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 21 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 22 and the stereocenter 5 marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 14 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 15 and the stereocenter marked with the asterisk is in S-configuration. 10 In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 16 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 17 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 18 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of 15 formula (vii) and w is 19 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 20 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 21 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii) and w is 22 and the stereocenter 20 marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (vii-a): wherein 25 the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (vii-b): whereinAscendis Pharma A / S 49 CPX75149PC09 July 2025the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (vii-c): (vii-c), 5 wherein the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (vii-d): (vii-d), 10 wherein the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (vii-e): (vii-e), 15 wherein the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (vii-f): (vii-f), 20 wherein the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (viii)Ascendis Pharma A / S 50 CPX75149PC09 July 2025 wherein the dashed line indicates attachment to -L2-; w is an integer ranging from and including 14 to 22; and the stereocenter marked with the asterisk is either in S- or R-configuration.5 In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 14. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 15. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 16. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 17. In certain embodiments -AB1and / or -AB2is of formula (viii) and x 10 is 18. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 19. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 20. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 21. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 22. 15 In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 14 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 15 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 16 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of20 formula (viii) and x is 17 and the stereocenter marked with the asterisk is in R-configuration.In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 18 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 19 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 20 and the stereocenter 25 marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 21 and the stereocenter marked with the asterisk is in R-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 22 and the stereocenter marked with the asterisk is in R-configuration. 30 In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 14 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is ofAscendis Pharma A / S 51 CPX75149PC09 July 2025formula (viii) and x is 15 and the stereocenter marked with the asterisk is in S-configuration.In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 16 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 17 and the stereocenter marked with the asterisk is in S-configuration. 5 In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 18 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 19 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 20 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of 10 formula (viii) and x is 21 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii) and x is 22 and the stereocenter marked with the asterisk is in S-configuration. In certain embodiments -AB1and / or -AB2is of formula (viii-a) 15 wherein the dashed line indicates attachment to -L2-. In certain embodiments -AB1 and / or -AB2 is of formula (viii-b) 20 wherein the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (viii-c) wherein the dashed line indicates attachment to -L2-. 25 In certain embodiments -AB1and / or -AB2is of formula (viii-d)Ascendis Pharma A / S 52 CPX75149PC09 July 2025 wherein the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (viii-e) 5 wherein the dashed line indicates attachment to -L2-. In certain embodiments -AB1and / or -AB2is of formula (viii-f) 10 wherein the dashed line indicates attachment to -L2-. In certain embodiments -AB1 and / or -AB2 is of formula (ix-i)15 with Ph being phenyl, a is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10; b is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10; 20 c is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10; d is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10;Ascendis Pharma A / S 53 CPX75149PC09 July 2025m is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10; n is 10, 11, 12, 13 ,14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 ; p is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. 5In certain embodiments -AB1 and / or -AB2 is of formula (ix-i) with a being 1, b being 1, c being1, d being 1, m being 1, n being 18 and m being 1. In certain embodiments -AB1 and / or -AB2 is of formula (ix-i) and X1- is and -X2 is. In certain embodiments -AB1 and / or -AB2 is of formula (ix-i) and X1- is . embodiments -AB1and / or -AB2is of10 formula (ix-i) and X1- is . In certain embodiments -AB1and / or -AB2 is of formula embodiments -AB1 and / or -AB2 is of formula - . - -15 certain embodiments -AB1 and / o 2 r -ABis of formula (ix-i) and X1- is and -X2 is . In certain embodiments -AB1and / or -AB2 is of formula certainembodiments -AB1 and / or -AB2 is of formula Ascendis Pharma A / S 54 CPX75149PC09 July 2025. In certain embodiments -AB1 and / or -AB2 is of formula (ix-i) and X1- isd 5 In certain embodiments -AB1and / or -AB2is a peptidic albumin-binding moiety. If -D- is a peptide or protein drug moiety, a peptidic moiety -AB2 may be fused to the N- or C-terminus of -D-, either directly or with a peptidic spacer between -D- and -AB2.10 In certain embodiments -AB1and / or -AB2is selected from the group consisting of WWEQDRDWDFDVFGGGTP (SEQ ID NO:34); DICLPRWGCLW (SEQ ID NO:35), wherein the cysteines at position 3 and 9 are connected via a disulfide bridge; RLIEDICLPRWGCLWEDD (SEQ ID NO:36), 15 wherein the cysteines at position 7 and 13 are connected via a disulfide bridge; LAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO:37); IAEAKEAANAELDSYGVSDFYKRLIDKAKTVEGVEALKDAILAALP (SEQ ID NO:38); and X1EYEX2EYE (SEQ ID NO:39), 20 wherein X1 is fluorescein-(AEEA), X2 is K(palmitate), and AEEA is 2-(2-(2- aminoethoxy)acetyl. In certain embodiments -AB1and / or -AB2is of SEQ ID NO:34. In certain embodiments -AB1and / or -AB2is of SEQ ID NO:35. In certain embodiments -AB1and / or -AB2is of SEQ ID 25 NO:36. In certain embodiments -AB1and / or -AB2is of SEQ ID NO:37. In certain embodiments -AB1and / or -AB2is of SEQ ID NO:38. In certain embodiments -AB1and / or -AB2is of SEQ ID NO:39. In certain embodiments -AB1is of formula (XIX)Ascendis Pharma A / S 55 CPX75149PC09 July 2025 wherein the dashed line indicates attachment to -L2-; and a is 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24. 5 In certain embodiments -L2- has a molecular weight of at least 3 kDa, of at least 3.5 kDa, of atleast 4 kDa, of at least 4.5 kDa or of at least 5 kDa. In certain embodiments the molecular weight of -L2- is less than 100 kDa, less than 80, less than 60 kDa, less than 40 kDa, less than30 kDa or less than 20 kDa. In certain embodiments the molecular weight of -L2- ranges from10 1 kDa to 80 kDa. In certain embodiments the molecular weight of -L2- ranges from 2 kDa to60 kDa. In certain embodiments the molecular weight of -L2- ranges from 2.5 kDa to 50 kDa.In certain embodiments the molecular weight of -L2- ranges from 3 kDa to 40 kDa. In certainembodiments the molecular weight of -L2- ranges from 4 kDa to 30 kDa. In certainembodiments the molecular weight of -L2- ranges from 4.5 kDa to 20 kDa. In certain15 embodiments the molecular weight of -L2- ranges from 5 kDa to 15 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 2 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 2.5 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 3 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 3.5 kDa. In certain20 embodiments the molecular weight of -L2- has a molecular weight of about 4 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 5 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 6 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 7 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 8 kDa. In certain25 embodiments the molecular weight of -L2- has a molecular weight of about 9 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 10 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 11 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 12 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 13 kDa. In certain30 embodiments the molecular weight of -L2- has a molecular weight of about 14 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 15 kDa. In certainAscendis Pharma A / S 56 CPX75149PC09 July 2025embodiments the molecular weight of -L2- has a molecular weight of about 16 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 17 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 18 kDa. In certainembodiments the molecular weight of -L2- has a molecular weight of about 19 kDa. In certain5 embodiments the molecular weight of -L2- has a molecular weight of about 20 kDa.In certain embodiments -L2- comprises a polymer with a Flory radius of at least 1.2 nm, of atleast 1.5 nm, of at least 2 nm, of at least 2.5 nm, of at least 3 nm, of at least 3.5 nm, of at least4 nm, of at least 4.5 nm or of at least 5 nm. In certain embodiments the polymer moiety has a10 Flory radius of no more than 200 nm, of no more than 175 nm, of no more than 150 nm, of nomore than 125 nm, of no more than 100 nm, of no more than 75 nm, of no more than 50 nm,of no more than 45 nm, of no more than 40 nm, of no more than 35 nm or of no more than 30nm. In certain embodiments the one or more polymer moiety of -L2- has a Flory radius of about1.2 nm, of about 1.5 nm, of about 2 nm, of about 2.5 nm, of about 3 nm, of about 3.5 nm, of15 about 4 nm, of about 4.5 nm, of about 5 nm, of about 5.5 nm, of about 6 nm. In certainembodiments the one or more polymer moiety of -L2-has a Flory radius of about 6.5 nm, ofabout 7 nm, of about 7.5 nm, of about 8.5 nm, of about 9 nm, of about 9.5 nm or of about 10nm. It is understood that if -L2- comprises one polymer moiety the Flory radius provided aboveapplies to this one polymer moiety and if -L2- comprises more than one polymer moiety the20 Flory radius provided above refers to the Flory radius of all polymer moieties together. In certain embodiments -L2- is of formula (B) wherein25 the unmarked dashed line indicates attachment to -FG, -L3-, -L5- or -L1-, respectively;the dashed line marked with the asterisk indicates attachment to -AB1; -POL- is a polymeric moiety; and-LD- and -LE- are independently absent or selected from the group consistingof -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, 30 -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T-, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-50alkyl, C2-50alkenyl,Ascendis Pharma A / S 57 CPX75149PC09 July 2025and C2-50 alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; 5 -Ry1and -Ry1aare independently of each other selected from the group consisting of -H, -T, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T, C1-50 alkyl, C2-50alkenyl, and C2-50alkynyl are optionally substituted with one or more -Ry2, which are the same or different, and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, 10 -O-, -C(O)-, -C(O)N(Ry4)-, -S(O)2N(Ry4)-, -S(O)N(Ry4)-, -S(O)2-, -S(O)-, -N(Ry4)S(O)2N(Ry4a)-, -S-, -N(Ry4)-, -OC(ORy4)(Ry4a)-, -N(Ry4)C(O)N(Ry4a)-, and -OC(O)N(Ry4)-; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-membered15 heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-memberedheteropolycyclyl; wherein each T is independently optionally substituted with one or more -Ry2, which are the same or different; each -Ry2is independently selected from the group consisting of halogen, -CN, oxo (=O), -COORy5, -ORy5, -C(O)Ry5, -C(O)N(Ry5Ry5a), -S(O)2N(Ry5Ry5a), -S(O)N(Ry5Ry5a), 20 -S(O)2Ry5, -S(O)Ry5, -N(Ry5)S(O)2N(Ry5aRy5b), -SRy5, -N(Ry5Ry5a), -NO2, -OC(O)Ry5, -N(Ry5)C(O)Ry5a, -N(Ry5)S(O)2Ry5a, -N(Ry5)S(O)Ry5a, -N(Ry5)C(O)ORy5a, -N(Ry5)C(O)N(Ry5aRy5b), -OC(O)N(Ry5Ry5a), and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different; and each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently selected from the group 25 consisting of -H, and C1-6 alkyl, wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different. In certain embodiments -LD- and -LE- are independently selected from the group consistingof -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, 30 -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T-, C1-20 alkyl, C2-20 alkenyl, and C2-20 alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-20alkyl, C2-20alkenyl, and C2-20alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-,Ascendis Pharma A / S 58 CPX75149PC09 July 2025-C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; -Ry1and -Ry1aare independently of each other selected from the group consisting of -H, -T, C1-10alkyl, C2-10alkenyl, and C2-10alkynyl; wherein -T, C1-10alkyl, C2-10alkenyl, and C2-105 alkynyl are optionally substituted with one or more -Ry2, which are the same or different, and wherein C1-10alkyl, C2-10alkenyl, and C2-10alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry4)-, -S(O)2N(Ry4)-, -S(O)N(Ry4)-, -S(O)2-, -S(O)-, -N(Ry4)S(O)2N(Ry4a)-, -S-, -N(Ry4)-, -OC(ORy4)(Ry4a)-, -N(Ry4)C(O)N(Ry4a)-, and -OC(O)N(Ry4)-; 10 each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-memberedheterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl;wherein each T is independently optionally substituted with one or more -Ry2, which are the same or different; 15 -Ry2is selected from the group consisting of halogen, -CN, oxo (=O), -COORy5, -ORy5, -C(O)Ry5, -C(O)N(Ry5Ry5a), -S(O)2N(Ry5Ry5a), -S(O)N(Ry5Ry5a), -S(O)2Ry5, -S(O)Ry5, -N(Ry5)S(O)2N(Ry5aRy5b), -SRy5, -N(Ry5Ry5a), -NO2, -OC(O)Ry5, -N(Ry5) C(O)Ry5a, -N(Ry5)S(O)2Ry5a, -N(Ry5)S(O)Ry5a, -N(Ry5)C(O)ORy5a, -N(Ry5)C(O)N(Ry5aRy5b), -OC(O)N(Ry5Ry5a), and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more20 halogen, which are the same or different; and each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently of each other selected from the group consisting of -H, and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with oneor more halogen, which are the same or different.25 In certain embodiments -LD- and -LE- are independently selected from the group consistingof -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T-, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally substituted with one or more -Ry2, which are the same or different and30wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-;Ascendis Pharma A / S 59 CPX75149PC09 July 2025-Ry1and -Ry1aare independently selected from the group consisting of -H, -T, C1-10 alkyl, C2-10 alkenyl, and C2-10 alkynyl; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-membered5 heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl;each -Ry2is independently selected from the group consisting of halogen, and C1-6alkyl; and each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently of each other selected from the group consisting of -H, and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with oneor more halogen, which are the same or different.10 In certain embodiments -LD- and -LE- are independently a C1-20 alkyl chain, which is optionallyinterrupted by one or more groups independently selected from -C(O)-, -N(Ry1)-,-O-, -S-, -T- and -C(O)N(Ry1)-; and which C1-20 alkyl chain is optionally substituted with oneor more groups independently selected from halogen, -OH, -T and -N(Ry1Ry1a); wherein -Ry1and -Ry1a are independently selected from the group consisting of H and C1-4 alkyl and wherein15 T is selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl, which is optionallysubstituted with one or more oxo (=O) or halogen.20 In certain embodiments -LD- and -LE- have independently of each other a molecular weight inthe range of from 14 g / mol to 750 g / mol. In certain embodiments -LD- and -LE- independently comprise a moiety selected from,25 ,Ascendis Pharma A / S 60 CPX75149PC09 July 2025, ; 5 wherein -R and -Raare independently of each other selected from the group consisting of -H, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, 2-methylbutyl, 2,2- dimethylpropyl, n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2-dimethylbutyl, 2,3- dimethylbutyl and 3,3-dimethylpropyl. 10 In certain embodiments -LD- and -LE- have independently a chain length of 1 to 20 atoms. Incertain embodiments -LD- and -LE- have independently a chain length of 2 to 10 atoms.Ascendis Pharma A / S 61 CPX75149PC09 July 2025In certain embodiments -LD- is absent. In certain embodiments -LD- is -N(Ry1)-, wherein -Ry1is -H, methyl, ethyl, propyl or isopropyl. In certain embodiments -LD- is -NH-. In certainembodiments -LD- is -C(O)-.5 In certain embodiments -LE- is absent. In certain embodiments -LE- is of formula (B-a) wherein the dashed line marked with the asterisk indicates attachment to -POL-; the unmarked dashed line indicates attachment to -FG, -L3-, -L5- or -L1-, respectively;10 d1 is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20; d2 is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20; and -Z1- is15 Ascendis Pharma A / S 62 CPX75149PC09 July 2025 wherein 5 -R and -Raare independently of each other selected from the group consisting of -H, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, 2-methylbutyl, 2,2-dimethylpropyl, n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2- dimethylbutyl, 2,3-dimethylbutyl and 3,3-dimethylpropyl.10 In certain embodiments d1 of formula (B-a) is 0. In certain embodiments d1 of formula (B-a)is 1. In certain embodiments d1 of formula (B-a) is 2. In certain embodiments d1 of formula(B-a) is 3. In certain embodiments d1 of formula (B-a) is 4. In certain embodiments d1 offormula (B-a) is 5. In certain embodiments d1 of formula (B-a) is 6. In certain embodiments d1 of formula (B-a) is 7. In certain embodiments d1 of formula (B-a) is 8. In certain 15 embodiments d1 of formula (B-a) is 9. In certain embodiments d1 of formula (B-a) is 10. In certain embodiments d1 of formula (B-a) is 11. In certain embodiments d1 of formula (B-a) is 12. In certain embodiments d1 of formula (B-a) is 13. In certain embodiments d1 of formula (B-a) is 14. In certain embodiments d1 of formula (B-a) is 15. In certain embodiments d1 ofAscendis Pharma A / S 63 CPX75149PC09 July 2025formula (B-a) is 16. In certain embodiments d1 of formula (B-a) is 17. In certain embodimentsd1 of formula (B-a) is 18. In certain embodiments d1 of formula (B-a) is 19. In certain embodiments d1 of formula (B-a) is 20. 5 In certain embodiments d2 of formula (B-a) is 0. In certain embodiments d2 of formula (B-a) is 1. In certain embodiments d2 of formula (B-a) is 2. In certain embodiments d2 of formula(B-a) is 3. In certain embodiments d2 of formula (B-a) is 4. In certain embodiments d2 offormula (B-a) is 5. In certain embodiments d2 of formula (B-a) is 6. In certain embodimentsd2 of formula (B-a) is 7. In certain embodiments d2 of formula (B-a) is 8. In certain 10 embodiments d2 of formula (B-a) is 9. In certain embodiments d2 of formula (B-a) is 10. In certain embodiments d2 of formula (B-a) is 11. In certain embodiments d2 of formula (B-a) is 12. In certain embodiments d2 of formula (B-a) is 13. In certain embodiments d2 of formula (B-a) is 14. In certain embodiments d2 of formula (B-a) is 15. In certain embodiments d2 offormula (B-a) is 16. In certain embodiments d2 of formula (B-a) is 17. In certain embodiments15 d2 of formula (B-a) is 18. In certain embodiments d2 of formula (B-a) is 19. In certain embodiments d2 of formula (B-a) is 20. In certain embodiments -Z1- is of formula (e1). In certain embodiments -Z1- is of formula (e2).In certain embodiments -Z1- is of formula (e3). In certain embodiments -Z1- is of formula (e4).20 In certain embodiments -Z1- is of formula (e5). In certain embodiments -Z1- is of formula (e6).In certain embodiments -Z1- is of formula (e7). In certain embodiments -Z1- is of formula (e8).In certain embodiments -Z1- is of formula (e9). In certain embodiments -Z1- is of formula (e10).In certain embodiments -Z1- is of formula (e11). In certain embodiments -Z1- is of formula(e12). In certain embodiments -Z1- is of formula (e13). In certain embodiments -Z1- is of25 formula (e14). In certain embodiments -Z1- is of formula (e15). In certain embodiments -Z1- isof formula (e16). In certain embodiments -Z1- is of formula (e17). In certainembodiments -Z1- is of formula (e18). In certain embodiments -Z1- is of formula (e19). Incertain embodiments -Z1- is of formula (e20). In certain embodiments -Z1- is of formula (e21).In certain embodiments -Z1- is of formula (e22).30 In certain embodiments -LE- is of formula (B-b) Ascendis Pharma A / S 64 CPX75149PC09 July 2025wherein the dashed line marked with the asterisk indicates attachment to -POL-; the unmarked dashed line indicates attachment to -L1-; d1 is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20; 5 d2 is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20; and -R is -H, methyl, ethyl, propyl or isopropyl. In certain embodiments d1 of formula (B-b) is 0, 1, 2, 3, 4, 5 or 6. In certain embodiments d1 of formula (B-b) is 0. In certain embodiments d1 of formula (B-b) is 1. In certain embodiments 10 d1 of formula (B-b) is 2. In certain embodiments d1 of formula (B-b) is 3. In certain embodiments d1 of formula (B-b) is 4. In certain embodiments d1 of formula (B-b) is 5. Incertain embodiments d1 of formula (B-b) is 6. In certain embodiments d2 of formula (B-b) is 0, 1, 2, 3, 4, 5 or 6. In certain embodiments d2 15 of formula (B-b) is 0. In certain embodiments d2 of formula (B-b) is 1. In certain embodiments d2 of formula (B-b) is 2. In certain embodiments d2 of formula (B-b) is 3. In certain embodiments d2 of formula (B-b) is 4. In certain embodiments d2 of formula (B-b) is 5. Incertain embodiments d2 of formula (B-b) is 6.20 In certain embodiments -R of formula (B-b) is -H. In certain embodiments -R of formula (B- b) is of methyl. In certain embodiments -LE- is of formula (B-b), in which d1 is 2, d2 is 2 and -R is -H. Incertain embodiments -LE- is of formula (B-b), in which d1 is 2, d2 is 2 and -R is -H. In certain25 embodiments -LE- is of formula (B-b), in which d1 is 2, d2 is 3 and -R is -H. In certainembodiments -LE- is of formula (B-b), in which d1 is 3, d2 is 3 and -R is -H. In certainembodiments -LE- is of formula (B-b), in which d1 is 2, d2 is 2 and -R is -H. In certainembodiments -LE- is of formula (B-b), in which d1 is 2, d2 is 2 and -R is -H. In certainembodiments -LE- is of formula (B-b), in which d1 is 2, d2 is 3 and -R is -H. In certain30 embodiments -LE- is of formula (B-b), in which d1 is 3, d2 is 3 and -R is -H.In certain embodiments -LE- is of formula (B-b), in which d1 is 2, d2 is 2 and -R is -H. Incertain embodiments -LE- is of formula (B-b), in which d1 is 2, d2 is 2 and -R is -H. In certainAscendis Pharma A / S 65 CPX75149PC09 July 2025embodiments -LE- is of formula (B-b), in which d1 is 2, d2 is 3 and -R is -H. In certainembodiments -LE- is of formula (B-b), in which d1 is 3, d2 is 3 and -R is -H.In certain embodiments -POL- of formula (B) is a polymeric moiety with a molecular weight5 of at least 3 kDa, at least 3.5 kDa, at least 4 kDa, at least 4.5 kDa or at least 5 kDa. In certain embodiments the molecular weight of -POL- of formula (B) is less than 100 kDa. In certainembodiments the molecular weight of -POL- of formula (B) is less than 80 kDa. In certainembodiments the molecular weight of -POL- of formula (B) is less than 60 kDa. In certainembodiments the molecular weight of -POL- of formula (B) is less than 40 kDa. In certain10 embodiments the molecular weight of -POL- of formula (B) is less than 30 kDa. In certainembodiments the molecular weight of -POL- of formula (B) is less than 20 kDa. In certainembodiments the molecular weight of -POL- of formula (B) ranges from 1 kDa to 80 kDa. Incertain embodiments the molecular weight of -POL- of formula (B) ranges from 2 kDa to 60kDa. In certain embodiments the molecular weight of -POL- of formula (B) ranges from 2.515 kDa to 50 kDa. In certain embodiments the molecular weight of -POL- of formula (B) rangesfrom 3 kDa to 40 kDa. In certain embodiments the molecular weight of -POL- of formula (B)ranges from 4 kDa to 30 kDa. In certain embodiments the molecular weight of -POL- offormula (B) ranges from 4.5 kDa to 20 kDa. In certain embodiments the molecular weightof -POL- of formula (B) ranges from 5 kDa to 15 kDa. In certain embodiments the molecular20 weight of -POL- of formula (B) has a molecular weight of about 2 kDa. In certain embodimentsthe molecular weight of -POL- of formula (B) has a molecular weight of about 2.5 kDa. Incertain embodiments the molecular weight of -POL- of formula (B) has a molecular weight ofabout 3 kDa. In certain embodiments the molecular weight of -POL- of formula (B) has amolecular weight of about 3.5 kDa. In certain embodiments the molecular weight of -POL- of25 formula (B) has a molecular weight of about 4 kDa. In certain embodiments the molecular weight of -POL- of formula (B) has a molecular weight of about 5 kDa. In certain embodimentsthe molecular weight of -POL- of formula (B) has a molecular weight of about 6 kDa. In certainembodiments the molecular weight of -POL- of formula (B) has a molecular weight of about 7kDa. In certain embodiments the molecular weight of -POL- of formula (B) has a molecular30 weight of about 8 kDa. In certain embodiments the molecular weight of -POL- of formula (B)has a molecular weight of about 9 kDa. In certain embodiments the molecular weight of -POL- of formula (B) has a molecular weight of about 10 kDa. In certain embodiments themolecular weight of -POL- of formula (B) has a molecular weight of about 11 kDa. In certainembodiments the molecular weight of -POL- of formula (B) has a molecular weight of aboutAscendis Pharma A / S 66 CPX75149PC09 July 202512 kDa. In certain embodiments the molecular weight of -POL- of formula (B) has a molecularweight of about 13 kDa. In certain embodiments the molecular weight of -POL- of formula (B)has a molecular weight of about 14 kDa. In certain embodiments the molecular weight of -POL- of formula (B) has a molecular weight of about 15 kDa. In certain embodiments the5 molecular weight of -POL- of formula (B) has a molecular weight of about 16 kDa. In certainembodiments the molecular weight of -POL- of formula (B) has a molecular weight of about17 kDa. In certain embodiments the molecular weight of -POL- of formula (B) has a molecularweight of about 18 kDa. In certain embodiments the molecular weight of -POL- of formula (B)has a molecular weight of about 19 kDa In certain embodiments the molecular weight10 of -POL- of formula (B) has a molecular weight of about 20 kDa.Applicant surprisingly found that the presence of suitable distance between -AB1and -AB2, such as the distance provided by a moiety -POL-, allows for the binding of two different albumin moieties. This is advantageous, because the ability to bind to two different albumins 15 increases the likelihood that the compound of formula (Ia) or (Ib) is bound to at least one albumin, which increases circulation half-life. In certain embodiments -POL- comprises a polymer selected from the group consisting ofpoly(2-methacryloyl-oxyethyl phosphoyl cholins), poly(acrylic acids), poly(acrylates), 20 poly(acrylamides), poly(alkyloxy) polymers, poly(amides), poly(amidoamines), poly(amino acids), poly(anhydrides), poly(aspartamides), poly(butyric acids), poly(glycolic acids), polybutylene terephthalates, poly(caprolactones), poly(carbonates), poly(cyanoacrylates), poly(dimethylacrylamides), poly(esters), poly(ethylenes), poly(ethyleneglycols), poly(ethylene oxides), poly(ethyl phosphates), poly(ethyloxazolines), poly(glycolic acids), 25 poly(hydroxyethyl acrylates), poly(hydroxyethyl-oxazolines), poly(hydroxymethacrylates), poly(hydroxypropylmethacrylamides), poly(hydroxypropyl methacrylates), poly(hydroxypropyloxazolines), poly(iminocarbonates), poly(lactic acids), poly(lactic-co- glycolic acids), poly(methacrylamides), poly(methacrylates), poly(methyloxazolines), poly(organophosphazenes), poly(ortho esters), poly(oxazolines), poly(propylene glycols), 30 poly(siloxanes), poly(urethanes), poly(vinyl alcohols), poly(vinyl amines), poly(vinylmethylethers), poly(vinylpyrrolidones), silicones, celluloses, carbomethyl celluloses, hydroxypropyl methylcelluloses, chitins, chitosans, dextrans, dextrins, gelatins, hyaluronic acids and derivatives, functionalized hyaluronic acids, alginate, mannans, pectins,Ascendis Pharma A / S 67 CPX75149PC09 July 2025rhamnogalacturonans, starches, hydroxyalkyl starches, hydroxyethyl starches and other carbohydrate-based polymers, xylans and copolymers thereof.In certain embodiments -POL- of formula (B) is a PEG-based polymer.5 In certain embodiments -POL- of formula (B) is of formula (XII-i) wherein y is an integer ranging from 2 to 1000. 10 In certain embodiments y of formula (XII-i) is an integer ranging from 68 to 1000. In certain embodiments y of formula (XII-i) is an integer ranging from 79 to 800. In certain embodiments y of formula (XII-i) is an integer ranging from 90 to 600. In certain embodiments y of formula (XII-i) is an integer ranging from 102 to 500. In certain embodiments y of formula (XII-i) is 15 an integer ranging from 113 to 450. In certain embodiments y of formula (XII-i) is selected such that the molecular weight of -POL- is about 3 kDa. In certain embodiments y of formula (XII-i) is selected such that themolecular weight of -POL- is about 3.5 kDa. In certain embodiments y of formula (XII-i) is20 selected such that the molecular weight of -POL- is about 4 kDa. In certain embodiments y offormula (XII-i) is selected such that the molecular weight of -POL- is about 4.5 kDa. In certainembodiments y of formula (XII-i) is selected such that the molecular weight of -POL- is about5 kDa. In certain embodiments y of formula (XII-i) is selected such that the molecular weight of -POL- is about 6 kDa. In certain embodiments y of formula (XII-i) is selected such that the25 molecular weight of -POL- is about 7 kDa. In certain embodiments y of formula (XII-i) isselected such that the molecular weight of -POL- is about 8 kDa. In certain embodiments y offormula (XII-i) is selected such that the molecular weight of -POL- is about 9 kDa. In certainembodiments y of formula (XII-i) is selected such that the molecular weight of -POL- is about10 kDa. In certain embodiments y of formula (XII-i) is selected such that the molecular weight30 of -POL- is about 11 kDa. In certain embodiments y of formula (XII-i) is selected such that themolecular weight of -POL- is about 12 kDa. In certain embodiments y of formula (XII-i) isselected such that the molecular weight of -POL- is about 13 kDa. In certain embodiments y offormula (XII-i) is selected such that the molecular weight of -POL- is about 14 kDa. In certainAscendis Pharma A / S 68 CPX75149PC09 July 2025embodiments y of formula (XII-i) is selected such that the molecular weight of -POL- is about15 kDa. In certain embodiments y of formula (XII-i) is selected such that the molecular weight of -POL- is about 20 kDa. In certain embodiments y of formula (XII-i) is selected such that themolecular weight of -POL- is about 25 kDa. In certain embodiments y of formula (XII-i) is5 selected such that the molecular weight of -POL- is about 30 kDa. In certain embodiments y offormula (XII-i) is selected such that the molecular weight of -POL- is about 40 kDa.In certain embodiments -L2- is of formula (XII-ii) -ii), 10 wherein the dashed line marked with the asterisk indicates attachment to -FG; the unmarked dashed line indicates attachment to -AB1; b is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15; c is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15; 15 x ranges from 2 to 1000; -R1and -R2are independent of each other selected from the group consisting of -H and C1-6 alkyl. In certain embodiments x of formula (XII-ii) is about 68. In certain embodiments x of formula20 (XII-ii) is about 79. In certain embodiments x of formula (XII-ii) is about 90. In certain embodiments x of formula (XII-ii) is about 102. In certain embodiments x of formula (XII-ii) is about 113. In certain embodiments x of formula (XII-ii) is about 136. In certain embodimentsx of formula (XII-ii) is about 160. In certain embodiments x of formula (XII-ii) is about 182. In certain embodiments x of formula (XII-ii) is about 204. In certain embodiments x of formula25 (XII-ii) is about 227. In certain embodiments x of formula (XII-ii) is about 250. In certainembodiments x of formula (XII-ii) is about 340. In certain embodiments x of formula (XII-ii) is about 455. In certain embodiments x of formula (XII-ii) is about 910. In certain embodiments x of formula (XII-ii) ranges from 23 to 910, from 45 to 600, from 65 30 to 500, from 79 to 450, from 90 to 350 or from 100 to 280.Ascendis Pharma A / S 69 CPX75149PC09 July 2025In certain embodiments b of formula (XII-ii) is 1. In certain embodiments b of formula (XII- ii) is 2. In certain embodiments b of formula (XII-ii) is 3. In certain embodiments b of formula (XII-ii) is 4. In certain embodiments b of formula (XII-ii) is 5. In certain embodiments b offormula (XII-ii) is 6. In certain embodiments b of formula (XII-ii) is 7. In certain embodiments 5 b of formula (XII-ii) is 8. In certain embodiments b of formula (XII-ii) is 9. In certain embodiments b of formula (XII-ii) is 10. In certain embodiments b of formula (XII-ii) is 11. In certain embodiments b of formula (XII-ii) is 12. In certain embodiments b of formula (XII-ii) is 13. In certain embodiments b of formula (XII-ii) is 14. In certain embodiments b of formula (XII-ii) is 15. 10 In certain embodiments c of formula (XII-ii) is 1. In certain embodiments c of formula (XII-ii) is 2. In certain embodiments c of formula (XII-ii) is 3. In certain embodiments c of formula (XII-ii) is 4. In certain embodiments c of formula (XII-ii) is 5. In certain embodiments c offormula (XII-ii) is 6. In certain embodiments c of formula (XII-ii) is 7. In certain embodiments15 c of formula (XII-ii) is 8. In certain embodiments c of formula (XII-ii) is 9. In certain embodiments c of formula (XII-ii) is 10. In certain embodiments c of formula (XII-ii) is 11. In certain embodiments c of formula (XII-ii) is 12. In certain embodiments c of formula (XII-ii) is 13. In certain embodiments c of formula (XII-ii) is 14. In certain embodiments c of formula (XII-ii) is 15. 20 In certain embodiments -R1of formula (XII-ii) is -H. In certain embodiments -R1of formula (XII-ii) is methyl. In certain embodiments -R1of formula (XII-ii) is ethyl. In certain embodiments -R1of formula (XII-ii) is propyl. In certain embodiments -R1of formula (XII-ii) is isopropyl. 25 In certain embodiments -R2of formula (XII-ii) is -H. In certain embodiments -R2of formula (XII-ii) is methyl. In certain embodiments -R2of formula (XII-ii) is ethyl. In certain embodiments -R2of formula (XII-ii) is propyl. In certain embodiments -R2of formula (XII-ii) is isopropyl. 30 In certain embodiments b of formula (XII-ii) is 2, c of formula (XII-ii) is 2, and both -R1and -R2of formula (XII-ii) are -H. In certain embodiments b of formula (XII-ii) is 2, c of formula (XII- ii) is 2, and both -R1and -R2of formula (XII-ii) are -H and x of formula (XII-ii) ranges fromAscendis Pharma A / S 70 CPX75149PC09 July 202579 to 340. In certain embodiments b of formula (XII-ii) is 2, c of formula (XII-ii) is 2, andboth -R1and -R2of formula (XII-ii) are -H and x of formula (XII-ii) is about 113. The moiety -FG, -FG1 and / or -FG2 are independently of each other a functional group for5 reaction with a functional group on a different reagent and are in certain embodimentsindependently selected from the group consisting of 10 Ascendis Pharma A / S 71 CPX75149PC09 July 20255 Ascendis Pharma A / S 72 CPX75149PC09 July 20255 Ascendis Pharma A / S 73 CPX75149PC09 July 2025 wherein the dashed line indicates attachment to -L2- or -L1-, respectively;5 each -R08, -R08aand -R08bis independently selected from the group consisting of halogen, -H, -CN, -T0, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T0, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally substituted with one or more -R09, which are the same or different, and wherein C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T0-, -C(O)O-, 10 -O-, -C(O)-, -C(O)N(R010)-, -S(O)2N(R010)-, -S(O)N(R010)-, -S(O)2-, -S(O)-, -N(R010)S(O)2N(R010a)-, -S-, -N(R010)-, -OC(OR010)(R010a)-, -N(R010)C(O)N(R010a)-, and -OC(O)N(R010)-; each T0is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, and 8- to 11-15 membered heterobicyclyl; wherein each T0is independently optionally substituted with one or more -R09, which are the same or different; each -R09, -R010and -R010ais independently selected from the group consisting of -H and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are the same or different; 20 each -Y01is independently selected from the group consisting of -F, -Cl, -Br and -I; each n is independently 1, 2, 3 or 4; each -Y02and -Y02ais independently selected from the group consisting of -H and -Br; each -Y03and -Y03ais independently selected from the group consisting of -F, -Cl, -Br, -I, -OR, -NR011R011aand -SR011;25 each -Y04- is independently selected from -O-, -S-, -NR011-, -CR011R011a-; andeach -R011and -R011ais independently selected from the group consisting of halogen, -H, -CN, -T0, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T0, C1-50 alkyl, C2-50alkenyl, and C2-50alkynyl are optionally substituted with one or more -R012,Ascendis Pharma A / S 74 CPX75149PC09 July 2025which are the same or different, and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T0-, -C(O)O-, -O-, -C(O)-, -C(O)N(R013)-, -S(O)2N(R013)-, -S(O)N(R013)-, -S(O)2-, -S(O)-, -N(R013)S(O)2N(R013a)-, -S-, 5 -N(R013)-, -OC(OR013)(R013a)-, -N(R013)C(O)N(R013a)-, and -OC(O)N(R013)-; each T0is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, and 8- to 11-membered heterobicyclyl; wherein each T0is independently optionally substituted with one or more -R012, which are the same or different; and10 each -R12, -R013and -R013ais independently selected from the group consisting of -H and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different. In certain embodiments -FG and / or -FG1 are independently of each other selected from the15 group consisting of (y-1), (y-2), (y-6) , (y-7), (y-8), (y-9), (y-16), (y-17), (y-18), (y-19), (y-21),(y-22), (y-23), (y-24), (y-27), (y-30), (y-31), (y-32), (y-36), (y-38), (y-40), (y-45), (y-46), (y- 47), (y-48), (y-50), (y-57), (y-58), (y-59), (y-61), (y-62), (y-64), (y-70), (y-71), (y-72), (y-73), (y-74), (y-75), (y-76), (y-77), (y-78), (y-80), (y-81), (y-82), (y-83), (y-86), (y-87) and (y-89).In certain embodiments -FG is of formula (y-1). In certain embodiments -FG is of formula (y- 20 1) wherein -R08is -H. In certain embodiments -FG is of formula (y-2). In certain embodiments -FG is of formula (y-3). In certain embodiments -FG is of formula (y-3) wherein -R08 is -H. In certain embodiments -FG is of formula (y-4). In certainembodiments -FG is of formula (y-4) wherein -R08is -H. In certain embodiments -FG is of formula (y-5). In certain embodiments -FG is of formula (y-5) wherein -R08is -H. In certain 25 embodiments -FG is of formula (y-6). In certain embodiments -FG is of formula (y-6) wherein -R08 and -R08a are both -H. In certain embodiments -FG is of formula (y-7). In certainembodiments -FG is of formula (y-8). In certain embodiments -FG is of formula (y-9). In certain embodiments -FG is of formula (y-10). In certain embodiments -FG is of formula (y- 10) wherein -R08 is -H. In certain embodiments -FG is of formula (y-11). In certain30 embodiments -FG is of formula (y-11) wherein -Y01 is -F. In certain embodiments -FG is offormula (y-11) wherein -Y01 is -Br. In certain embodiments -FG is of formula (y-11)wherein -Y01 is -Cl. In certain embodiments -FG is of formula (y-11) wherein -Y01 is -I. Incertain embodiments -FG is of formula (y-12). In certain embodiments -FG is of formula (y-Ascendis Pharma A / S 75 CPX75149PC09 July 202513). In certain embodiments -FG is of formula (y-13) wherein -R08 and -R08a are both -H. Incertain embodiments -FG is of formula (y-14). In certain embodiments -FG is of formula (y- 14) wherein -R08 and -R08a are both -H. In certain embodiments -FG is of formula (y-15). Incertain embodiments -FG is of formula (y-16). In certain embodiments -FG is of formula (y- 5 17). In certain embodiments -FG is of formula (y-18). In certain embodiments -FG is of formula (y-19). In certain embodiments -FG is of formula (y-20). In certain embodiments -FG is of formula (y-21). In certain embodiments -FG is of formula (y-22). In certain embodiments -FG is of formula (y-23). In certain embodiments -FG is of formula (y-24). In certain embodiments -FG is of formula (y-25). In certain embodiments -FG is of formula (y-26). In10 certain embodiments -FG is of formula (y-26) wherein -R08 and -R08a are both -H. In certainembodiments -FG is of formula (y-27). In certain embodiments -FG is of formula (y-27) wherein -R08 is -H. In certain embodiments -FG is of formula (y-28). In certainembodiments -FG is of formula (y-28) wherein -R08 is -H. In certain embodiments -FG is offormula (y-29). In certain embodiments -FG is of formula (y-29) wherein -R08is -H and -Y0115 is -F. In certain embodiments -FG is of formula (y-29) wherein -R08 is -H and -Y01 is -Cl. Incertain embodiments -FG is of formula (y-29) wherein -R08is -H and -Y01is -Br. In certain embodiments -FG is of formula (y-29) wherein -R08is -H and -Y01is -I. In certain embodiments -FG is of formula (y-30). In certain embodiments -FG is of formula (y-30) wherein -R08 is -H. In certain embodiments -FG is of formula (y-31). In certain20 embodiments -FG is of formula (y-31) wherein -R08 is -H. In certain embodiments -FG is offormula (y-32). In certain embodiments -FG is of formula (y-32) wherein -R08 is -H. In certainembodiments -FG is of formula (y-33). In certain embodiments -FG is of formula (y-33) wherein -R08 is -H. In certain embodiments -FG is of formula (y-34). In certainembodiments -FG is of formula (y-35). In certain embodiments -FG is of formula (y-35),25 wherein -Y01 is -F. In certain embodiments -FG is of formula (y-35), wherein -Y01 is -Cl. Incertain embodiments -FG is of formula (y-35), wherein -Y01is -Br. In certain embodiments -FG is of formula (y-35), wherein -Y01 is -I. In certain embodiments -FG is of formula (y-36). Incertain embodiments -FG is of formula (y-37). In certain embodiments -FG is of formula (y- 38). In certain embodiments -FG is of formula (y-39). In certain embodiments -FG is of formula 30 (y-39), wherein n is 1. In certain embodiments -FG is of formula (y-40). In certain embodiments -FG is of formula (y-40), wherein -Y01 is -F. In certain embodiments -FG is offormula (y-40), wherein -Y01is -Cl. In certain embodiments -FG is of formula (y-40), wherein -Y01 is -Br. In certain embodiments -FG is of formula (y-40), wherein -Y01 is -I. Incertain embodiments -FG is of formula (y-41). In certain embodiments -FG is of formula (y-Ascendis Pharma A / S 76 CPX75149PC09 July 202541) wherein -R08 is -H. In certain embodiments -FG is of formula (y-42). In certainembodiments -FG is of formula (y-42) wherein -R08 is -H. In certain embodiments -FG is offormula (y-43). In certain embodiments -FG is of formula (y-43) wherein -R08 is -H. In certainembodiments -FG is of formula (y-44). In certain embodiments -FG is of formula (y-44) 5 wherein -R08is -H. In certain embodiments -FG is of formula (y-12). In certain embodiments -FG is of formula (y-45). In certain embodiments -FG is of formula (y-45) wherein -R08 and -R08a are both -H. In certain embodiments -FG is of formula (y-46). In certainembodiments -FG is of formula (y-46) wherein -R08 is -H. In certain embodiments -FG is offormula (y-47). In certain embodiments -FG is of formula (y-48). In certain embodiments -FG10 is of formula (y-49). In certain embodiments -FG is of formula (y-49), wherein -R08, -R08aand -R08bare -H. In certain embodiments -FG is of formula (y-50). In certain embodiments -FG is of formula (y-51). In certain embodiments -FG is of formula (y-52). In certain embodiments -FG is of formula (y-53). In certain embodiments -FG is of formula (y-54). In certain embodiments -FG is of formula (y-55). In certain embodiments -FG is of formula (y- 15 56). In certain embodiments -FG is of formula (y-57). In certain embodiments -FG is of formula (y-58). In certain embodiments -FG is of formula (y-58), wherein both -Y02and -Y02aare both -H. In certain embodiments -FG is of formula (y-58), wherein both -Y02and -Y02aare both -Br. In certain embodiments -FG is of formula (y-58), wherein -Y02 is -H and -Y02a is -H.In certain embodiments -FG is of formula (y-59). In certain embodiments -FG is of formula (y- 20 60). In certain embodiments -FG is of formula (y-61). In certain embodiments -FG is of formula (y-62). In certain embodiments -FG is of formula (y-63). In certain embodiments -FG is of formula (y-64). In certain embodiments -FG is of formula (y-64), wherein -R08is -H. In certain embodiments -FG is of formula (y-65). In certain embodiments -FG is of formula (y-66). In certain embodiments -FG is of formula (y-67). In certain embodiments -FG is of formula (y-25 67), wherein -R08 is -H. In certain embodiments -FG is of formula (y-68). In certainembodiments -FG is of formula (y-68), wherein -R08 is -H. In certain embodiments -FG is offormula (y-69). In certain embodiments -FG is of formula (y-70). In certain embodiments -FG is of formula (y-71). In certain embodiments -FG is of formula (y-72). In certain embodiments -FG is of formula (y-73). In certain embodiments -FG is of formula (y-74). In30 certain embodiments -FG is of formula (y-75). In certain embodiments -FG is of formula (y- 75), wherein -R08is -H. In certain embodiments -FG is of formula (y-76). In certain embodiments -FG is of formula (y-77). In certain embodiments -FG is of formula (y-77), wherein -R08is -H. In certain embodiments -FG is of formula (y-78). In certain embodiments -FG is of formula (y-79). In certain embodiments -FG is of formula (y-79),Ascendis Pharma A / S 77 CPX75149PC09 July 2025wherein -R08 is -H. In certain embodiments -FG is of formula (y-80). In certainembodiments -FG is of formula (y-81). In certain embodiments -FG is of formula (y-81), wherein -R08 is -H. In certain embodiments -FG is of formula (y-82). In certainembodiments -FG is of formula (y-82), wherein -R08 is -H. In certain embodiments -FG is of5 formula (y-83). In certain embodiments -FG is of formula (y-83), wherein -R08 is -H. In certainembodiments -FG is of formula (y-84). In certain embodiments -FG is of formula (y-84), wherein -R08 and -R08a are both -H. In certain embodiments -FG is of formula (y-85). In certainembodiments -FG is of formula (y-85), wherein -R08 is -H. In certain embodiments -FG is offormula (y-86). In certain embodiments -FG is of formula (y-87). In certain embodiments -FG10 is of formula (y-88). In certain embodiments -FG is of formula (y-89). In certain embodiments -FG1is of formula (y-1). In certain embodiments -FG1is of formula (y-1) wherein -R08 is -H. In certain embodiments -FG1 is of formula (y-2). In certainembodiments -FG1is of formula (y-3). In certain embodiments -FG1is of formula (y-3) wherein -R08 is -H. In certain embodiments -FG1 is of formula (y-4). In certain15 embodiments -FG1is of formula (y-4) wherein -R08is -H. In certain embodiments -FG1is of formula (y-5). In certain embodiments -FG1is of formula (y-5) wherein -R08is -H. In certain embodiments -FG1is of formula (y-6). In certain embodiments -FG1is of formula (y-6) wherein -R08 and -R08a are both -H. In certain embodiments -FG1 is of formula (y-7). In certainembodiments -FG1is of formula (y-8). In certain embodiments -FG1is of formula (y-9). In20 certain embodiments -FG1is of formula (y-10). In certain embodiments -FG1is of formula (y- 10) wherein -R08 is -H. In certain embodiments -FG1 is of formula (y-11). In certainembodiments -FG1 is of formula (y-11) wherein -Y01 is -F. In certain embodiments -FG1 is offormula (y-11) wherein -Y01 is -Br. In certain embodiments -FG1 is of formula (y-11)wherein -Y01 is -Cl. In certain embodiments -FG1 is of formula (y-11) wherein -Y01 is -I. In25 certain embodiments -FG1is of formula (y-12). In certain embodiments -FG1is of formula (y- 13). In certain embodiments -FG1 is of formula (y-13) wherein -R08 and -R08a are both -H. Incertain embodiments -FG1is of formula (y-14). In certain embodiments -FG1is of formula (y- 14) wherein -R08 and -R08a are both -H. In certain embodiments -FG1 is of formula (y-15). Incertain embodiments -FG1is of formula (y-16). In certain embodiments -FG1is of formula (y- 30 17). In certain embodiments -FG1is of formula (y-18). In certain embodiments -FG1is of formula (y-19). In certain embodiments -FG1is of formula (y-20). In certain embodiments -FG1is of formula (y-21). In certain embodiments -FG1is of formula (y-22). In certain embodiments -FG1is of formula (y-23). In certain embodiments -FG1is of formula (y-24). InAscendis Pharma A / S 78 CPX75149PC09 July 2025certain embodiments -FG1is of formula (y-25). In certain embodiments -FG1is of formula (y- 26). In certain embodiments -FG1 is of formula (y-26) wherein -R08 and -R08a are both -H. Incertain embodiments -FG1is of formula (y-27). In certain embodiments -FG1is of formula (y- 27) wherein -R08 is -H. In certain embodiments -FG1 is of formula (y-28). In certain5 embodiments -FG1 is of formula (y-28) wherein -R08 is -H. In certain embodiments -FG1 is offormula (y-29). In certain embodiments -FG1is of formula (y-29) wherein -R08is -H and -Y01is -F. In certain embodiments -FG1 is of formula (y-29) wherein -R08 is -H and -Y01 is -Cl. Incertain embodiments -FG1is of formula (y-29) wherein -R08is -H and -Y01is -Br. In certain embodiments -FG1is of formula (y-29) wherein -R08is -H and -Y01is -I. In certain 10 embodiments -FG1is of formula (y-30). In certain embodiments -FG1is of formula (y-30) wherein -R08 is -H. In certain embodiments -FG1 is of formula (y-31). In certainembodiments -FG1 is of formula (y-31) wherein -R08 is -H. In certain embodiments -FG1 is offormula (y-32). In certain embodiments -FG1 is of formula (y-32) wherein -R08 is -H. In certainembodiments -FG1is of formula (y-33). In certain embodiments -FG1is of formula (y-33)15 wherein -R08 is -H. In certain embodiments -FG1 is of formula (y-34). In certainembodiments -FG1is of formula (y-35). In certain embodiments -FG1is of formula (y-35), wherein -Y01is -F. In certain embodiments -FG1is of formula (y-35), wherein -Y01is -Cl. In certain embodiments -FG1is of formula (y-35), wherein -Y01is -Br. In certain embodiments -FG1 is of formula (y-35), wherein -Y01 is -I. In certain embodiments -FG1 is of20 formula (y-36). In certain embodiments -FG1is of formula (y-37). In certain embodiments -FG1is of formula (y-38). In certain embodiments -FG1is of formula (y-39). In certain embodiments -FG1is of formula (y-39), wherein n is 1. In certain embodiments -FG1is of formula (y-40). In certain embodiments -FG1is of formula (y-40), wherein -Y01is -F. In certain embodiments -FG1is of formula (y-40), wherein -Y01is -Cl. In certain embodiments -FG1is 25 of formula (y-40), wherein -Y01is -Br. In certain embodiments -FG1is of formula (y-40), wherein -Y01 is -I. In certain embodiments -FG1 is of formula (y-41). In certainembodiments -FG1 is of formula (y-41) wherein -R08 is -H. In certain embodiments -FG1 is offormula (y-42). In certain embodiments -FG1 is of formula (y-42) wherein -R08 is -H. In certainembodiments -FG1is of formula (y-43). In certain embodiments -FG1is of formula (y-43)30 wherein -R08 is -H. In certain embodiments -FG1 is of formula (y-44). In certainembodiments -FG1is of formula (y-44) wherein -R08is -H. In certain embodiments -FG1is of formula (y-12). In certain embodiments -FG1is of formula (y-45). In certain embodiments -FG1is of formula (y-45) wherein -R08 and -R08a are both -H. In certain embodiments -FG1 is offormula (y-46). In certain embodiments -FG1 is of formula (y-46) wherein -R08 is -H. In certainAscendis Pharma A / S 79 CPX75149PC09 July 2025embodiments -FG1is of formula (y-47). In certain embodiments -FG1is of formula (y-48). In certain embodiments -FG1is of formula (y-49). In certain embodiments -FG1is of formula (y- 49), wherein -R08, -R08aand -R08bare -H. In certain embodiments -FG1is of formula (y-50). In certain embodiments -FG1G is of formula (y-51). In certain embodiments -FG1is of formula 5 (y-52). In certain embodiments -FG1is of formula (y-53). In certain embodiments -FG1is of formula (y-54). In certain embodiments -FG1is of formula (y-55). In certain embodiments -FG1is of formula (y-56). In certain embodiments -FG1is of formula (y-57). In certain embodiments -FG1is of formula (y-58). In certain embodiments -FG1is of formula (y-58), wherein both -Y02and -Y02aare both -H. In certain embodiments -FG1is of formula (y-58),10 wherein both -Y02 and -Y02a are both -Br. In certain embodiments -FG1 is of formula (y-58),wherein -Y02 is -H and -Y02a is -H. In certain embodiments -FG1 is of formula (y-59). In certainembodiments -FG1is of formula (y-60). In certain embodiments -FG1is of formula (y-61). In certain embodiments -FG1is of formula (y-62). In certain embodiments -FG1is of formula (y- 63). In certain embodiments -FG1 is of formula (y-64). In certain embodiments -FG1 is of15 formula (y-64), wherein -R08is -H. In certain embodiments -FG1is of formula (y-65). In certain embodiments -FG1is of formula (y-66). In certain embodiments -FG1is of formula (y-67). In certain embodiments -FG1is of formula (y-67), wherein -R08is -H. In certain embodiments -FG1is of formula (y-68). In certain embodiments -FG1is of formula (y-68), wherein -R08 is -H. In certain embodiments -FG1 is of formula (y-69). In certain20 embodiments -FG1is of formula (y-70). In certain embodiments -FG1is of formula (y-71). In certain embodiments -FG1is of formula (y-72). In certain embodiments -FG1is of formula (y- 73). In certain embodiments -FG1is of formula (y-74). In certain embodiments -FG1is of formula (y-75). In certain embodiments -FG1is of formula (y-75), wherein -R08is -H. In certain embodiments -FG1is of formula (y-76). In certain embodiments -FG1is of formula (y-77). In 25 certain embodiments -FG1is of formula (y-77), wherein -R08is -H. In certain embodiments -FG1is of formula (y-78). In certain embodiments -FG1is of formula (y-79). In certain embodiments -FG1is of formula (y-79), wherein -R08is -H. In certain embodiments -FG1 is of formula (y-80). In certain embodiments -FG1 is of formula (y-81). Incertain embodiments -FG1 is of formula (y-81), wherein -R08 is -H. In certain30 embodiments -FG1is of formula (y-82). In certain embodiments -FG1is of formula (y-82), wherein -R08 is -H. In certain embodiments -FG1 s of formula (y-83). In certainembodiments -FG1 is of formula (y-83), wherein -R08 is -H. In certain embodiments -FG1 is offormula (y-84). In certain embodiments -FG1is of formula (y-84), wherein -R08and -R08aare both -H. In certain embodiments -FG1 is of formula (y-85). In certain embodiments -FG1 is ofAscendis Pharma A / S 80 CPX75149PC09 July 2025formula (y-85), wherein -R08 is -H. In certain embodiments -FG1 is of formula (y-86). In certainembodiments -FG1is of formula (y-87). In certain embodiments -FG1is of formula (y-88). In certain embodiments -FG1is of formula (y-87). In certain embodiments -FG1is of formula (y- 89). 5 In certain embodiments -FG2is of formula (y-1). In certain embodiments -FG2is of formula (y-1) wherein -R08is -H. In certain embodiments -FG2is of formula (y-2). In certain embodiments -FG2is of formula (y-3). In certain embodiments -FG2is of formula (y-3) wherein -R08 is -H. In certain embodiments -FG2 is of formula (y-4). In certainembodiments -FG2is of formula (y-4) wherein -R08is -H. In certain embodiments -FG2is of 10 formula (y-5). In certain embodiments -FG2is of formula (y-5) wherein -R08is -H. In certain embodiments -FG2is of formula (y-6). In certain embodiments -FG2is of formula (y-6) wherein -R08 and -R08a are both -H. In certain embodiments -FG2 is of formula (y-7). In certainembodiments -FG2is of formula (y-8). In certain embodiments -FG2is of formula (y-9). In certain embodiments -FG2is of formula (y-10). In certain embodiments -FG2is of formula (y-15 10) wherein -R08 is -H. In certain embodiments -FG2 is of formula (y-11). In certainembodiments -FG2 is of formula (y-11) wherein -Y01 is -F. In certain embodiments -FG2 is offormula (y-11) wherein -Y01 is -Br. In certain embodiments -FG2 is of formula (y-11)wherein -Y01 is -Cl. In certain embodiments -FG2 is of formula (y-11) wherein -Y01 is -I. Incertain embodiments -FG2is of formula (y-12). In certain embodiments -FG2is of formula (y-20 13). In certain embodiments -FG2 is of formula (y-13) wherein -R08 and -R08a are both -H. Incertain embodiments -FG2is of formula (y-14). In certain embodiments -FG2is of formula (y- 14) wherein -R08 and -R08a are both -H. In certain embodiments -FG2 is of formula (y-15). Incertain embodiments -FG2is of formula (y-16). In certain embodiments -FG2is of formula (y- 17). In certain embodiments -FG2is of formula (y-18). In certain embodiments -FG2is of25 formula (y-19). In certain embodiments -FG2is of formula (y-20). In certain embodiments -FG2is of formula (y-21). In certain embodiments -FG2is of formula (y-22). In certain embodiments -FG2is of formula (y-23). In certain embodiments -FG2is of formula (y-24). In certain embodiments -FG2is of formula (y-25). In certain embodiments -FG2is of formula (y- 26). In certain embodiments -FG2 is of formula (y-26) wherein -R08 and -R08a are both -H. In30 certain embodiments -FG2is of formula (y-27). In certain embodiments -FG2is of formula (y- 27) wherein -R08is -H. In certain embodiments -FG2is of formula (y-28). In certain embodiments -FG2 is of formula (y-28) wherein -R08 is -H. In certain embodiments -FG2 is offormula (y-29). In certain embodiments -FG2is of formula (y-29) wherein -R08is -H and -Y01Ascendis Pharma A / S 81 CPX75149PC09 July 2025is -F. In certain embodiments -FG2 is of formula (y-29) wherein -R08 is -H and -Y01 is -Cl. Incertain embodiments -FG2is of formula (y-29) wherein -R08is -H and -Y01is -Br. In certain embodiments -FG2is of formula (y-29) wherein -R08is -H and -Y01is -I. In certain embodiments -FG2is of formula (y-30). In certain embodiments -FG2is of formula (y-30) 5wherein -R08 is -H. In certain embodiments -FG2 is of formula (y-31). In certainembodiments -FG2 is of formula (y-31) wherein -R08 is -H. In certain embodiments -FG2 is offormula (y-32). In certain embodiments -FG2 is of formula (y-32) wherein -R08 is -H. In certainembodiments -FG2is of formula (y-33). In certain embodiments -FG2is of formula (y-33) wherein -R08 is -H. In certain embodiments -FG2 is of formula (y-34). In certain10 embodiments -FG2is of formula (y-35). In certain embodiments -FG2is of formula (y-35), wherein -Y01is -F. In certain embodiments -FG2is of formula (y-35), wherein -Y01is -Cl. In certain embodiments -FG2is of formula (y-35), wherein -Y01is -Br. In certain embodiments -FG2 is of formula (y-35), wherein -Y01 is -I. In certain embodiments -FG2 is offormula (y-36). In certain embodiments -FG2is of formula (y-37). In certain embodiments -FG215 is of formula (y-38). In certain embodiments -FG2is of formula (y-39). In certain embodiments -FG2is of formula (y-39), wherein n is 1. In certain embodiments -FG2is of formula (y-40). In certain embodiments -FG2is of formula (y-40), wherein -Y01is -F. In certain embodiments -FG2is of formula (y-40), wherein -Y01is -Cl. In certain embodiments -FG2is of formula (y-40), wherein -Y01is -Br. In certain embodiments -FG2is of formula (y-40),20 wherein -Y01 is -I. In certain embodiments -FG2 is of formula (y-41). In certainembodiments -FG2 is of formula (y-41) wherein -R08 is -H. In certain embodiments -FG2 is offormula (y-42). In certain embodiments -FG2 is of formula (y-42) wherein -R08 is -H. In certainembodiments -FG2is of formula (y-43). In certain embodiments -FG2is of formula (y-43) wherein -R08 is -H. In certain embodiments -FG2 is of formula (y-44). In certain25 embodiments -FG2is of formula (y-44) wherein -R08is -H. In certain embodiments -FG2is of formula (y-12). In certain embodiments -FG2is of formula (y-45). In certain embodiments -FG2is of formula (y-45) wherein -R08 and -R08a are both -H. In certain embodiments -FG2 is offormula (y-46). In certain embodiments -FG2 is of formula (y-46) wherein -R08 is -H. In certainembodiments -FG2is of formula (y-47). In certain embodiments -FG2is of formula (y-48). In30 certain embodiments -FG2is of formula (y-49). In certain embodiments -FG2is of formula (y- 49), wherein -R08, -R08aand -R08bare -H. In certain embodiments -FG2is of formula (y-50). In certain embodiments -FG2is of formula (y-51). In certain embodiments -FG2is of formula (y- 52). In certain embodiments -FG2is of formula (y-53). In certain embodiments -FG2is of formula (y-54). In certain embodiments -FG2is of formula (y-55). In certain embodiments -FG2Ascendis Pharma A / S 82 CPX75149PC09 July 2025is of formula (y-56). In certain embodiments -FG2is of formula (y-57). In certain embodiments -FG2is of formula (y-58). In certain embodiments -FG2is of formula (y-58), wherein both -Y02and -Y02aare both -H. In certain embodiments -FG2is of formula (y-58), wherein both -Y02 and -Y02a are both -Br. In certain embodiments -FG2 is of formula (y-58),5 wherein -Y02 is -H and -Y02a is -H. In certain embodiments -FG2 is of formula (y-59). In certainembodiments -FG2is of formula (y-60). In certain embodiments -FG2is of formula (y-61). In certain embodiments -FG2is of formula (y-62). In certain embodiments -FG2is of formula (y- 63). In certain embodiments -FG2is of formula (y-64). In certain embodiments -FG2is of formula (y-64), wherein -R08is -H. In certain embodiments -FG2is of formula (y-65). In certain 10 embodiments -FG2is of formula (y-66). In certain embodiments -FG2is of formula (y-67). In certain embodiments -FG2is of formula (y-67), wherein -R08is -H. In certain embodiments -FG2is of formula (y-68). In certain embodiments -FG2is of formula (y-68), wherein -R08 is -H. In certain embodiments -FG2 is of formula (y-69). In certainembodiments -FG2is of formula (y-70). In certain embodiments -FG2is of formula (y-71). In15 certain embodiments -FG2is of formula (y-72). In certain embodiments -FG2is of formula (y- 73). In certain embodiments -FG2is of formula (y-74). In certain embodiments -FG2is of formula (y-75). In certain embodiments -FG2is of formula (y-75), wherein -R08is -H. In certain embodiments -FG2is of formula (y-76). In certain embodiments -FG2is of formula (y-77). In certain embodiments -FG2is of formula (y-77), wherein -R08is -H. In certain 20 embodiments -FG2is of formula (y-78). In certain embodiments -FG2is of formula (y-79). In certain embodiments -FG2is of formula (y-79), wherein -R08is -H. In certain embodiments -FG2 is of formula (y-80). In certain embodiments -FG2 is of formula (y-81). Incertain embodiments -FG2 is of formula (y-81), wherein -R08 is -H. In certainembodiments -FG2is of formula (y-82). In certain embodiments -FG2is of formula (y-82),25 wherein -R08 is -H. In certain embodiments -FG2 s of formula (y-83). In certainembodiments -FG2 is of formula (y-83), wherein -R08 is -H. In certain embodiments -FG2 is offormula (y-84). In certain embodiments -FG2is of formula (y-84), wherein -R08and -R08aare both -H. In certain embodiments -FG2 is of formula (y-85). In certain embodiments -FG2 is offormula (y-85), wherein -R08 is -H. In certain embodiments -FG2 is of formula (y-86). In certain30 embodiments -FG2is of formula (y-87). In certain embodiments -FG2is of formula (y-88). In certain embodiments -FG2is of formula (y-89).Ascendis Pharma A / S 83 CPX75149PC09 July 2025In certain embodiments -L3- is absent.In certain embodiments -L3- is a spacer moiety, such as a spacer moiety selected from the groupconsisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, 5 -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl; wherein -T-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally interrupted by one or more groups selected from the group consisting 10 of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; -Ry1and -Ry1aare independently of each other selected from the group consisting of -H, -T, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T, C1-50 alkyl, C2-50 alkenyl, and C2-50 15 alkynyl are optionally substituted with one or more -Ry2, which are the same or different, and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry4)-, -S(O)2N(Ry4)-, -S(O)N(Ry4)-, -S(O)2-, -S(O)-, -N(Ry4)S(O)2N(Ry4a)-, -S-, -N(Ry4)-, -OC(ORy4)(Ry4a)-, -N(Ry4)C(O)N(Ry4a)-, and -OC(O)N(Ry4)-; 20 each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-memberedheterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl;wherein each T is independently optionally substituted with one or more -Ry2, which are the same or different; 25 each -Ry2is independently selected from the group consisting of halogen, -CN, oxo (=O), -COORy5, -ORy5, -C(O)Ry5, -C(O)N(Ry5Ry5a), -S(O)2N(Ry5Ry5a), -S(O)N(Ry5Ry5a), -S(O)2Ry5, -S(O)Ry5, -N(Ry5)S(O)2N(Ry5aRy5b), -SRy5, -N(Ry5Ry5a), -NO2, -OC(O)Ry5, -N(Ry5)C(O)Ry5a, -N(Ry5)S(O)2Ry5a, -N(Ry5)S(O)Ry5a, -N(Ry5)C(O)ORy5a, -N(Ry5)C(O)N(Ry5aRy5b), -OC(O)N(Ry5Ry5a), and C1-6 alkyl; wherein C1-6 alkyl is optionally30 substituted with one or more halogen, which are the same or different; and each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently selected from the group consisting of -H, and C1-6 alkyl, wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different.Ascendis Pharma A / S 84 CPX75149PC09 July 2025In certain embodiments -L3- is a spacer moiety selected from the group consistingof -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl; wherein -T-, C1-20alkyl, C2-205 alkenyl, and C2-20 alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-20alkyl, C2-20alkenyl, and C2-20alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; 10 -Ry1and -Ry1aare independently of each other selected from the group consisting of -H, -T, C1-10 alkyl, C2-10 alkenyl, and C2-10 alkynyl; wherein -T, C1-10 alkyl, C2-10 alkenyl, and C2-10 alkynyl are optionally substituted with one or more -Ry2, which are the same or different, and wherein C1-10alkyl, C2-10alkenyl, and C2-10alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, 15 -C(O)N(Ry4)-, -S(O)2N(Ry4)-, -S(O)N(Ry4)-, -S(O)2-, -S(O)-, -N(Ry4)S(O)2N(Ry4a)-, -S-, -N(Ry4)-, -OC(ORy4)(Ry4a)-, -N(Ry4)C(O)N(Ry4a)-, and -OC(O)N(Ry4)-; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-memberedheterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl;20 wherein each T is independently optionally substituted with one or more -Ry2, which are the same or different; -Ry2is selected from the group consisting of halogen, -CN, oxo (=O), -COORy5, -ORy5, -C(O)Ry5, -C(O)N(Ry5Ry5a), -S(O)2N(Ry5Ry5a), -S(O)N(Ry5Ry5a), -S(O)2Ry5, -S(O)Ry5, -N(Ry5)S(O)2N(Ry5aRy5b), -SRy5, -N(Ry5Ry5a), -NO2, -OC(O)Ry5, -N(Ry5) 25 C(O)Ry5a, -N(Ry5)S(O)2Ry5a, -N(Ry5)S(O)Ry5a, -N(Ry5)C(O)ORy5a, -N(Ry5)C(O)N(Ry5aRy5b), -OC(O)N(Ry5Ry5a), and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are the same or different; and each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently of each other selected from the group consisting of -H, and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one30 or more halogen, which are the same or different. In certain embodiments -L3- is a spacer moiety selected from the group consistingof -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-,Ascendis Pharma A / S 85 CPX75149PC09 July 2025C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T-, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, 5 -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; -Ry1and -Ry1aare independently selected from the group consisting of -H, -T, C1-10alkyl, C2-10alkenyl, and C2-10 alkynyl; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl,10 indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-memberedheterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl;each -Ry2is independently selected from the group consisting of halogen, and C1-6 alkyl; and each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently of each other selected from the group consisting of -H, and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one15 or more halogen, which are the same or different. In certain embodiments -L3- is a C1-20 alkyl chain, which is optionally interrupted by one ormore groups independently selected from -C(O)-, -N(Ry1)-,-O-, -S-, -T- and -C(O)N(Ry1)-; and which C1-20 alkyl chain is optionally substituted with oneor more groups independently selected from halogen, -OH, -T and -N(Ry1Ry1a); wherein -Ry120 and -Ry1a are independently selected from the group consisting of H and C1-4 alkyl and whereinT is selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl, which is optionallysubstituted with one or more oxo (=O) or halogen. 25 In certain embodiments -L3- has a molecular weight in the range of from 14 g / mol to 750 g / mol.In certain embodiments -L3- comprises a moiety selected fromAscendis Pharma A / S 86 CPX75149PC09 July 20255 wherein -R and -Raare independently of each other selected from the group consisting of -H, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, 2-methylbutyl, 2,2-Ascendis Pharma A / S 87 CPX75149PC09 July 2025dimethylpropyl, n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2-dimethylbutyl, 2,3- dimethylbutyl and 3,3-dimethylpropyl. In certain embodiments -L3- has a chain length of 1 to 20 atoms. In certain5 embodiments -L3- has a chain length of 2 to 10 atoms.In certain embodiments -L4- is absent.In certain embodiments -L4- is a spacer moiety, such as a spacer moiety selected from the group10 consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are 15 optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; -Ry1and -Ry1aare independently of each other selected from the group consisting of -H, -T,20 C1-50alkyl, C2-50alkenyl, and C2-50alkynyl; wherein -T, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally substituted with one or more -Ry2, which are the same or different, and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry4)-, -S(O)2N(Ry4)-, -S(O)N(Ry4)-, -S(O)2-, -S(O)-, -N(Ry4)S(O)2N(Ry4a)-, -S-,25 -N(Ry4)-, -OC(ORy4)(Ry4a)-, -N(Ry4)C(O)N(Ry4a)-, and -OC(O)N(Ry4)-; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-memberedheterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl;wherein each T is independently optionally substituted with one or more -Ry2, which are the30 same or different; each -Ry2is independently selected from the group consisting of halogen, -CN, oxo (=O), -COORy5, -ORy5, -C(O)Ry5, -C(O)N(Ry5Ry5a), -S(O)2N(Ry5Ry5a), -S(O)N(Ry5Ry5a), -S(O)2Ry5, -S(O)Ry5, -N(Ry5)S(O)2N(Ry5aRy5b), -SRy5, -N(Ry5Ry5a), -NO2, -OC(O)Ry5, -N(Ry5)C(O)Ry5a, -N(Ry5)S(O)2Ry5a, -N(Ry5)S(O)Ry5a, -N(Ry5)C(O)ORy5a,Ascendis Pharma A / S 88 CPX75149PC09 July 2025-N(Ry5)C(O)N(Ry5aRy5b), -OC(O)N(Ry5Ry5a), and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different; and each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently selected from the group consisting of -H, and C1-6alkyl, wherein C1-6alkyl is optionally substituted with one or more 5 halogen, which are the same or different. In certain embodiments -L4- is a spacer moiety selected from the group consistingof -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-,10 -OC(O)N(Ry1)-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl; wherein -T-, C1-20alkyl, C2-20alkenyl, and C2-20 alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-20 alkyl, C2-20 alkenyl, and C2-20 alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-,15 -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; -Ry1and -Ry1aare independently of each other selected from the group consisting of -H, -T, C1-10alkyl, C2-10alkenyl, and C2-10alkynyl; wherein -T, C1-10alkyl, C2-10alkenyl, and C2-10alkynyl are optionally substituted with one or more -Ry2, which are the same or different, and wherein C1-10alkyl, C2-10alkenyl, and C2-10alkynyl are optionally interrupted by one or more 20 groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry4)-, -S(O)2N(Ry4)-, -S(O)N(Ry4)-, -S(O)2-, -S(O)-, -N(Ry4)S(O)2N(Ry4a)-, -S-, -N(Ry4)-, -OC(ORy4)(Ry4a)-, -N(Ry4)C(O)N(Ry4a)-, and -OC(O)N(Ry4)-; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-membered25 heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl;wherein each T is independently optionally substituted with one or more -Ry2, which are the same or different; -Ry2is selected from the group consisting of halogen, -CN, oxo (=O), -COORy5, -ORy5, -C(O)Ry5, -C(O)N(Ry5Ry5a), -S(O)2N(Ry5Ry5a), -S(O)N(Ry5Ry5a),30 -S(O)2Ry5, -S(O)Ry5, -N(Ry5)S(O)2N(Ry5aRy5b), -SRy5, -N(Ry5Ry5a), -NO2, -OC(O)Ry5, -N(Ry5) C(O)Ry5a, -N(Ry5)S(O)2Ry5a, -N(Ry5)S(O)Ry5a, -N(Ry5)C(O)ORy5a, -N(Ry5)C(O)N(Ry5aRy5b), -OC(O)N(Ry5Ry5a), and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different; andAscendis Pharma A / S 89 CPX75149PC09 July 2025each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently of each other selected from the group consisting of -H, and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different. 5In certain embodiments -L4- is a spacer moiety selected from the group consistingof -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl; wherein -T-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally substituted with one or more -Ry2, which are the same or different and10wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; -Ry1and -Ry1aare independently selected from the group consisting of -H, -T, C1-10alkyl, C2-1015 alkenyl, and C2-10 alkynyl; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-memberedheterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl;each -Ry2is independently selected from the group consisting of halogen, and C1-6 alkyl; and 20 each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently of each other selected from the group consisting of -H, and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are the same or different. In certain embodiments -L4- is a C1-20 alkyl chain, which is optionally interrupted by one ormore groups independently selected from -C(O)-, -N(Ry1)-,25 -O-, -S-, -T- and -C(O)N(Ry1)-; and which C1-20 alkyl chain is optionally substituted with oneor more groups independently selected from halogen, -OH, -T and -N(Ry1Ry1a); wherein -Ry1and -Ry1a are independently selected from the group consisting of H and C1-4 alkyl and whereinT is selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to 11-membered heterobicyclyl, 8-to 30-30 membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl, which is optionallysubstituted with one or more oxo (=O) or halogen. In certain embodiments -L4- has a molecular weight in the range of from 14 g / mol to 750 g / mol.Ascendis Pharma A / S 90 CPX75149PC09 July 2025In certain embodiments -L4- comprises a moiety selected from5 whereinAscendis Pharma A / S 91 CPX75149PC09 July 2025-R and -Raare independently of each other selected from the group consisting of -H, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, 2-methylbutyl, 2,2- dimethylpropyl, n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2-dimethylbutyl, 2,3- dimethylbutyl and 3,3-dimethylpropyl. 5 In certain embodiments -L4- has a chain length of 1 to 20 atoms. In certainembodiments -L4- has a chain length of 2 to 10 atoms.The moiety -L5- is the reaction product of -FG and -FG2 and thus depends on the selection10 of -FG and -FG2. For example, if -FG is (y-58) withboth -Y02 and -Y02a being -H , the resulting moiety - , wherein the unmarked dashed line indicates attachment to -L4- and the dashed line marked with the asterisk indicatesattachment to -L2-. For example, if -FG is (y-58) with both -Y02 and -Y02abeing -H and -FG2 is (y-57), the resulting moiety , wherein the15 unmarked dashed line indicates attachment to -L2- and the dashed line marked with the asteriskindicates attachment to -L4-. In certain embodiments -L1- is a reversible prodrug linker from which a drug, e.g.., H-D-AB2,is released in its free form, i.e. it is a traceless prodrug linker. It is understood that the “H-” in 20 “H-D-AB” is a hydrogen. Suitable prodrug linkers are known in the art, such as for example the reversible prodrug linker moieties disclosed in WO 2005 / 099768 A2, WO 2006 / 136586 A2, WO 2011 / 089216 A1 and WO 2013 / 024053 A1, which are incorporated by reference herewith.Ascendis Pharma A / S 92 CPX75149PC09 July 2025In certain embodiments -L1- is disclosed in WO 2009 / 095479 A2. Accordingly, in certainembodiments the moiety -L1- is of formula (II): , 5 wherein the dashed line indicates attachment to a nitrogen, hydroxyl or thiol of -D-; -X- is selected from the group consisting of -C(R4R4a)-; -N(R4)-; -O-; -C(R4R4a)-C(R5R5a)-; -C(R5R5a)-C(R4R4a)-; -C(R4R4a)-N(R6)-; -N(R6)-C(R4R4a)-; -C(R4R4a)-O-; -O-C(R4R4a)-; and -C(R7R7a)-; X1is selected from the group consisting of C; and S(O);10 -X2- is selected from the group consisting of -C(R8R8a)-; and -C(R8R8a)-C(R9R9a)-;=X3is selected from the group consisting of =O; =S; and =N-CN; -R1, -R1a, -R2, -R2a, -R4, -R4a, -R5, -R5a, -R6, -R8, -R8a, -R9, and -R9aare independently selected from the group consisting of -H; and C1-6 alkyl; -R3, and -R3aare independently selected from the group consisting of -H; and C1-6alkyl, 15 provided that in case one of -R3, -R3aor both are other than -H they are connected to N to which they are attached through an SP3-hybridized carbon atom; -R7is selected from the group consisting of -N(R10R10a); and -NR10-(C=O)-R11; -R7a, -R10, -R10a, and -R11are independently of each other selected from the group consisting of -H; and C1-6 alkyl;20optionally, one or more of the pairs -R1a / -R4a, -R1a / -R5a, -R1a / -R7a, -R4a / -R5a, and -R8a / -R9aform a chemical bond; optionally, one or more of the pairs -R1 / -R1a, -R2 / -R2a, -R4 / -R4a, -R5 / -R5a, -R8 / -R8a, and -R9 / -R9aare joined together with the atom to which they are attached to form a C3- 10 cycloalkyl; or 3- to 10-membered heterocyclyl;25 optionally, one or more of the pairs -R1 / -R4, -R1 / -R5, -R1 / -R6, -R1 / -R7a, -R4 / -R5, -R4 / -R6, -R8 / -R9, and -R2 / -R3are joined together with the atoms to which they are attached to form a ring A; optionally, R3 / R3aare joined together with the nitrogen atom to which they are attached to form a 3- to 10-membered heterocycle;Ascendis Pharma A / S 93 CPX75149PC09 July 2025A is selected from the group consisting of phenyl; naphthyl; indenyl; indanyl; tetralinyl; C3-10 cycloalkyl; 3- to 10-membered heterocyclyl; and 8- to 11-memberedheterobicyclyl; and wherein -L1- is substituted with at least one -L2- and wherein -L1- is optionally further5 substituted, provided that the hydrogen marked with the asterisk in formula (II) is not replaced by -L2- or a substituent.In certain embodiments -L1- of formula (II) is substituted with one moiety -L2-.10 In certain embodiments -L1- of formula (II) is not further substituted.It is understood that if -R3 / -R3aof formula (II) are joined together with the nitrogen atom to which they are attached to form a 3- to 10-membered heterocycle, only such 3- to 10-memberedheterocycles may be formed in which the atoms directly attached to the nitrogen are SP3-15 hybridized carbon atoms. In other words, such 3- to 10-membered heterocycle formedby -R3 / -R3atogether with the nitrogen atom to which they are attached has the following structure: , wherein 20 the dashed line indicates attachment to the rest of -L1-; the ring comprises 3 to 10 atoms comprising at least one nitrogen; and R#and R##represent an sp3-hydridized carbon atom. It is also understood that the 3- to 10-membered heterocycle may be further substituted.25 Exemplary embodiments of suitable 3- to 10-membered heterocycles formed by -R3 / -R3a offormula (II) together with the nitrogen atom to which they are attached are the following:Ascendis Pharma A / S 94 CPX75149PC09 July 2025, wherein dashed lines indicate attachment to the rest of the molecule; and -R is selected from the group consisting of -H and C1-6alkyl. 5 -L1- of formula (II) may optionally be further substituted. In general, any substituent may beused as far as the cleavage principle is not affected, i.e., the hydrogen marked with the asterisk in formula (II) is not replaced and the nitrogen of the moiety 10 of formula (II) remains part of a primary, secondary or tertiary amine, i.e., -R3and -R3aare independently of each other -H or are connected to –N< through an sp3-hybridized carbon atom. In one embodiment -R1or -R1aof formula (II) is substituted with -L2-. In another embodiment -R2or -R2aof formula (II) is substituted with -L2-. In another embodiment -R315 or -R3aof formula (II) is substituted with -L2-. In another embodiment -R4of formula (II) is substituted with -L2-. In another embodiment -R5or -R5aof formula (II) is substituted with -L2-. In another embodiment -R6of formula (II) is substituted with -L2-. In another embodiment -R7or -R7a of formula (II) is substituted with -L2-. In another embodiment -R8 or -R8a of formula(II) is substituted with -L2-. In another embodiment -R9or -R9aof formula (II) is substituted 20 with -L2-. In another embodiment -R10is substituted with -L2-. In another embodiment -R11is substituted with -L2-. In certain embodiments -R3of formula (II) is substituted with -L2-. In certain embodiments -X- of formula (II) is selected from the group consistingof -C(R4R4a)-, -N(R4)- and -C(R7R7a)-. In certain embodiments -X- of formula (II)25 is -C(R4R4a)-. In certain embodiments -X- of formula (II) is -C(R7R7a)-.In certain embodiments -R7 of formula (II) is -NR10-(C=O)-R11.Ascendis Pharma A / S 95 CPX75149PC09 July 2025In certain embodiments -R7a of formula (II) is selected from -H, methyl and ethyl. In certainembodiments -R7aof formula (II) is -H. 5In certain embodiments -R10 is selected from -H, methyl and ethyl. In certain embodiments -R10is methyl. In certain embodiments -R11 is selected from -H, methyl and ethyl. In certain embodiments -R11is -H. In certain embodiments -R11 is substituted with -L2-.10 In certain embodiments -X- of formula (II) is -N(R4)-.In certain embodiments -R4is selected from the group consisting of -H, methyl and ethyl. In certain embodiments -R4is -H. 15 In certain embodiments X1 of formula (II) is C.In certain embodiments =X3 of formula (II) is =O.20 In certain embodiments -X2- of formula (II) is -C(R8R8a)-.In certain embodiments -R8and -R8aof formula (II) are independently selected from the group consisting of -H, methyl and ethyl. In certain embodiments at least one of -R8and -R8aof formula (II) is -H. In certain embodiments both -R8and -R8aof formula (II) are -H. 25 In certain embodiments -R1and -R1aof formula (II) are independently selected from the group consisting of -H, methyl and ethyl.In certain embodiments at least one of -R1and -R1aof formula (II) is -H. In certain30 embodiments -R1and -R1aof formula (II) are -H. In certain embodiments at least one of -R1and -R1aof formula (II) is methyl. In certain embodiments both -R1and -R1aof formula (II) are methyl.Ascendis Pharma A / S 96 CPX75149PC09 July 2025In certain embodiments -R2and -R2aof formula (II) are independently selected from the group consisting of -H, methyl and ethyl. In certain embodiments at least one of -R2and -R2aof formula (II) is -H. In certain embodiments both -R2and -R2aof formula (II) are H. 5 In certain embodiments -R3and -R3aof formula (II) are independently selected from the group consisting of -H, methyl, ethyl, propyl and butyl. In certain embodiments at least one of -R3and -R3aof formula (II) is methyl. In certain embodiments -R3of formula (II) is methyl and -R3aof formula (II) is -H. 10 In certain embodiments -R3and -R3aof formula (II) are both -H. In certain embodiments -D- is connected to -L1- through a nitrogen by forming an amide bond.15 In certain embodiments -L1- is of formula (II), wherein X is -C(R7R7a)-; X1 isC; -X2- is -C(R8R8a)-C(R9R9a)-; =X3 is =O; -R1 and -R1a are -H; -R2 and -R2a are -H; -R3and -R3aare methyl; -R7is -N(R10R10a); -R7ais -H; -R8, -R8a, -R9and -R9aare -H; and -R10is methyl and -R10ais -H.20 In certain embodiments -L1- is of formula (IIa) wherein the dashed line marked with the asterisk indicates attachment to a nitrogen of -D-; andthe unmarked dashed line indicates attachment to -L2-. 25 In certain embodiments -L1- is of formula (IIa-a) wherein the dashed line marked with the asterisk indicates attachment to a nitrogen of -D-; andAscendis Pharma A / S 97 CPX75149PC09 July 2025the unmarked dashed line indicates attachment to -L2-. In certain embodiments -L1- is of formula (IIa-b) 5 wherein the dashed line marked with the asterisk indicates attachment to a nitrogen of -D-; andthe unmarked dashed line indicates attachment to -L2-. The moiety of formula (IIa), (IIa-a) and (IIa-b) is connected to -D- via an amide bond formed10 by a nitrogen of an amine functional group and the carbonyl to the left of the dashed line markedwith the asterisk. In certain embodiments -L1- is of formula (II), wherein X is -C(R7R7a)-; X1 isC; -X2- is -C(R8R8a)-C(R9R9a)-; =X3 is =O; -R1 and -R1a are -H; -R2 and -R2a are -H; -R315 and -R3aare methyl; -R7is -NR10-(C=O)-R11; -R7ais -H; -R8, -R8a, -R9and -R9aare -H; and -R10is methyl and -R11is -H. In certain embodiments -L1- is of formula (II), wherein X is -C(R7R7a)-; X1 isC; -X2- is -C(R8R8a)-C(R9R9a)-; =X3 is =O; -R1 and -R1a are -H; -R2 and -R2a are -H; -R320 and -R3aare methyl; -R7is -NR10-(C=O)-R11; -R7ais -H; -R8, -R8a, -R9and -R9aare -H; and -R10is -H and -R11is -H. In certain embodiments -L1- is of formula (IIab) (IIab), 25 wherein the dashed line marked with the asterisk indicates attachment to a nitrogen of -D-; and the unmarked dashed line indicates attachment to -L2-. In certain embodiments -L1- is of formula (IIab-a)Ascendis Pharma A / S 98 CPX75149PC09 July 2025 wherein the dashed line marked with the asterisk indicates attachment to a nitrogen of -D-; and the unmarked dashed line indicates attachment to -L2-. 5 In certain embodiments -L1- is of formula (IIab-b) (IIab-b), wherein the dashed line marked with the asterisk indicates attachment to a nitrogen of -D-; and10the unmarked dashed line indicates attachment to -L2-. The moiety of formula (IIab), (IIab-a) and (IIab-b) is connected to -D- via an amide bondformed by a nitrogen of an amine functional group and the carbonyl to the left of the dashed line marked with the asterisk. 15 In certain embodiments -L1- is selected from the group consisting of , (IIab-dii),Ascendis Pharma A / S 99 CPX75149PC09 July 20255 In certain embodiments -L1- is of formula (IIab-c). In certain embodiments -L1- is of formula(IIab-ci), In certain embodiments -L1- is of formula (IIab-cii). In certain embodiments -L1- isof formula (IIab-d). In certain embodiments -L1- is of formula (IIab-di). In certain10 embodiments -L1- is of formula (IIab-dii). In certain embodiments -L1- is of formula (IIab-e).In certain embodiments -L1- is of formula (IIab-ei). In certain embodiments -L1- is of formula(IIab-eii). In certain embodiments -L1- is of formula (IIab-f). In certain embodiments -L1- is offormula (IIab-fi). In certain embodiments -L1- is of formula (IIab-fii). In certainembodiments -L1- is of formula (IIab-g). In certain embodiments -L1- is of formula (IIab-gi).15 In certain embodiments -L1- is of formula (IIab-gii).In certain embodiments -L1- is disclosed in WO2016 / 020373A1. Accordingly, in certainembodiments the moiety -L1- is of formula (III): Ascendis Pharma A / S 100 CPX75149PC09 July 2025wherein the dashed line indicates attachment to a primary or secondary amine or hydroxyl of -D- through an amide or ester linkage, respectively;-R1, -R1a, -R2, -R2a, -R3and -R3aare independently of each other selected from the group 5 consisting of -H, -C(R8R8aR8b), -C(=O)R8, -C≡N, -C(=NR8)R8a, -CR8(=CR8aR8b), -C≡CR8and -T; -R4, -R5and -R5aare independently of each other selected from the group consisting of -H, -C(R9R9aR9b) and -T; a1 and a2 are independently of each other 0 or 1; 10 each -R6, -R6a, -R7, -R7a, -R8, -R8a, -R8b, -R9, -R9a, and -R9bare independently of each other selected from the group consisting of -H, halogen, -CN, -COOR10, -OR10, -C(O)R10, -C(O)N(R10R10a), -S(O)2N(R10R10a), -S(O) N(R10R10a), -S(O)2R10, -S(O)R10, -N(R10)S(O)2N(R10aR10b), -SR10, -N(R10R10a), -NO2, -OC(O)R10, -N(R10)C(O)R10a, -N(R10)S(O)2R10a, -N(R10)S(O)R10a, 15 -N(R10)C(O)OR10a, -N(R10)C(O)N(R10aR10b),-OC(O)N(R10R10a), -T, C1-20 alkyl, C2-20 alkenyl, and C2-20 alkynyl; wherein -T, C1-20 alkyl, C2-20 alkenyl, and C2-20 alkynyl are optionally substituted with one or more -R11, which are the same or different and wherein C1-20 alkyl, C2-20 alkenyl, and C2-20 alkynyl are optionally interrupted by one ormore groups selected from the group consisting of -T-, -C(O)O-, -O-, 20 -C(O)-, -C(O)N(R12)-, -S(O)2N(R12)-, -S(O)N(R12)-, -S(O)2-, -S(O)-, -N(R12)S(O)2N(R12a)-,-S-, -N(R12)-, -OC(OR12)(R12a)-, -N(R12)C(O)N(R12a)-, and -OC(O)N(R12)-; each -R10, -R10a, and -R10bis independently selected from the group consisting of -H, -T, C1-20alkyl, C2-20alkenyl, and C2-20alkynyl; wherein -T, C1-20alkyl, C2-20alkenyl, and 25 C2-20 alkynyl are optionally substituted with one or more -R11, which are the same or different and wherein C1-20alkyl, C2-20alkenyl, and C2-20alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(R12)-, -S(O)2N(R12)-, -S(O)N(R12)-, -S(O)2-, -S(O)-, -N(R12)S(O)2N(R12a)-, -S-, -N(R12)-, -OC(OR12)(R12a)-, -N(R12)C(O)N(R12a)-,30 and -OC(O)N(R12)-; each T is independently of each other selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl,and 8- to 11-membered heterobicyclyl; wherein each T is independently optionallysubstituted with one or more -R11, which are the same or different;Ascendis Pharma A / S 101 CPX75149PC09 July 2025each -R11is independently of each other selected from halogen, -CN, oxo (=O), -COOR13, -OR13, -C(O)R13, -C(O)N(R13R13a), -S(O)2N(R13R13a), -S(O)N(R13R13a), -S(O)2R13, -S(O)R13, -N(R13)S(O)2N(R13aR13b), -SR13, -N(R13R13a), -NO2, -OC(O)R13, -N(R13)C(O)R13a, -N(R13)S(O)2R13a, 5 -N(R13)S(O)R13a, -N(R13)C(O)OR13a, -N(R13)C(O)N(R13aR13b), -OC(O)N(R13R13a), and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are the same or different; each -R12, -R12a, -R13, -R13a, and -R13bis independently selected from the group consisting of -H, and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one or10 more halogen, which are the same or different; optionally, one or more of the pairs -R1 / -R1a, -R2 / -R2a, -R3 / -R3a, -R6 / -R6a, and -R7 / -R7aare joined together with the atom to which they are attached to form a C3-10 cycloalkyl or a 3- to 10-membered heterocyclyl;optionally, one or more of the pairs -R1 / -R2, -R1 / -R3, -R1 / -R4, -R1 / -R5, -R1 / -R6, 15 -R1 / -R7, -R2 / -R3, -R2 / -R4, -R2 / -R5, -R2 / -R6, -R2 / -R7, -R3 / -R4, -R3 / -R5, -R3 / -R6, -R3 / -R7, -R4 / -R5, -R4 / -R6, -R4 / -R7, -R5 / -R6, -R5 / -R7, and -R6 / -R7are joint together with the atoms to which they are attached to form a ring A; A is selected from the group consisting of phenyl; naphthyl; indenyl; indanyl; tetralinyl; C3-10 cycloalkyl; 3- to 10-membered heterocyclyl; and 8- to 11-membered20 heterobicyclyl; wherein -L1- is substituted with at least one -L2- and wherein -L1- is optionally furthersubstituted. The optional further substituents of -L1- of formula (III) are in certain embodiments as25 described above. In certain embodiments -L1- of formula (III) is substituted with one moiety -L2-.In certain embodiments -L1- of formula (III) is not further substituted.30 In certain embodiments -L1- is as disclosed in EP1536334B1, WO2009 / 009712A1,WO2008 / 034122A1, WO2009 / 143412A2, WO2011 / 082368A2, and US8618124B2, which are herewith incorporated by reference in their entirety.Ascendis Pharma A / S 102 CPX75149PC09 July 2025In certain embodiments -L1- is as disclosed in US8946405B2 and US8754190B2, which areherewith incorporated by reference in their entirety. Accordingly, in certain embodiments -L1- is of formula (IV): 5 wherein the dashed line indicates attachment to -D- and wherein attachment is through afunctional group of -D- selected from the group consisting of -OH, -SH and -NH2;m is 0 or 1; at least one or both of -R1and -R2is / are independently of each other selected from10the group consisting of -CN, -NO2, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted alkenyl, optionally substituted alkynyl, -C(O)R3, -S(O)R3, -S(O)2R3, and -SR4, one and only one of -R1and -R2is selected from the group consisting of -H, optionally substituted alkyl, optionally substituted arylalkyl, and optionally15 substituted heteroarylalkyl; -R3is selected from the group consisting of -H, optionally substituted alkyl, optionally substituted aryl, optionally substituted arylalkyl, optionally substituted heteroaryl, optionally substituted heteroarylalkyl, -OR9 and -N(R9)2;-R4is selected from the group consisting of optionally substituted alkyl, optionally 20 substituted aryl, optionally substituted arylalkyl, optionally substituted heteroaryl, and optionally substituted heteroarylalkyl; each -R5is independently selected from the group consisting of -H, optionally substituted alkyl, optionally substituted alkenylalkyl, optionally substituted alkynylalkyl, optionally substituted aryl, optionally substituted arylalkyl, optionally 25 substituted heteroaryl and optionally substituted heteroarylalkyl; -R9is selected from the group consisting of -H and optionally substituted alkyl; -Y- is absent and –X- is -O- or -S-; or-Y- is -N(Q)CH2- and -X- is -O-;Q is selected from the group consisting of optionally substituted alkyl, optionally 30 substituted aryl, optionally substituted arylalkyl, optionally substituted heteroaryl and optionally substituted heteroarylalkyl;Ascendis Pharma A / S 103 CPX75149PC09 July 2025optionally, -R1and -R2may be joined to form a 3 to 8-membered ring; and optionally, both -R9together with the nitrogen to which they are attached form a heterocyclic ring; wherein -L1- is substituted with at least one -L2- and wherein -L1- is optionally5 further substituted. Only in the context of formula (IV) the terms used have the following meaning: The term “alkyl” as used herein includes linear, branched or cyclic saturated hydrocarbon10 groups of 1 to 8 carbons, or in certain embodiments 1 to 6 or 1 to 4 carbon atoms. The term “alkoxy” includes alkyl groups bonded to oxygen, including methoxy, ethoxy, isopropoxy, cyclopropoxy, cyclobutoxy, and similar. 15 The term “alkenyl” includes non-aromatic unsaturated hydrocarbons with carbon-carbon double bonds. The term “alkynyl” includes non-aromatic unsaturated hydrocarbons with carbon-carbon triple bonds. 20 The term “aryl” includes aromatic hydrocarbon groups of 6 to 18 carbons, such as 6 to 10 carbons, including groups such as phenyl, naphthyl, and anthracenyl. The term “heteroaryl” includes aromatic rings comprising 3 to 15 carbons containing at least one N, O or S atom, such as 3 to 7 carbons containing at least one N, O or S atom, including groups such as pyrrolyl, 25 pyridyl, pyrimidinyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, quinolyl, indolyl, indenyl, and similar. In some instance, alkenyl, alkynyl, aryl or heteroaryl moieties may be coupled to the remainder of the molecule through an alkylene linkage. Under those circumstances, the substituent will 30 be referred to as alkenylalkyl, alkynylalkyl, arylalkyl or heteroarylalkyl, indicating that an alkylene moiety is between the alkenyl, alkynyl, aryl or heteroaryl moiety and the molecule towhich the alkenyl, alkynyl, aryl or heteroaryl is coupled. The term “halogen” includes bromo, fluoro, chloro and iodo.Ascendis Pharma A / S 104 CPX75149PC09 July 2025The term “heterocyclic ring” refers to a 4 to 8 membered aromatic or non-aromatic ring comprising 3 to 7 carbon atoms and at least one N, O, or S atom. Examples are piperidinyl, piperazinyl, tetrahydropyranyl, pyrrolidine, and tetrahydrofuranyl, as well as the exemplary 5 groups provided for the term “heteroaryl” above. When a ring system is optionally substituted, suitable substituents are selected from the group consisting of alkyl, alkenyl, alkynyl, or an additional ring, each optionally further substituted. Optional substituents on any group, including the above, include halo, nitro,10 cyano, -OR, -SR, -NR2, -OCOR, -NRCOR, -COOR, -CONR2, -SOR, -SO2R, -SONR2, -SO2N R2, wherein each R is independently alkyl, alkenyl, alkynyl, aryl or heteroaryl, or two R groups taken together with the atoms to which they are attached form a ring. In certain embodiments -L1- of formula (IV) is substituted with one moiety -L2-.15 In certain embodiments -L1- of formula (IV) is not further substituted.In certain embodiments -L1- is as disclosed in WO2013 / 036857A1, which is herewithincorporated by reference in its entirety. Accordingly, in certain embodiments -L1- is of20 formula (V): wherein the dashed line indicates attachment to -D- through an amine functional group ofH-D-AB2; 25 -R1is selected from the group consisting of optionally substituted C1-C6linear, branched, or cyclic alkyl; optionally substituted aryl; optionally substituted heteroaryl; alkoxy; and -NR52; -R2is selected from the group consisting of -H; optionally substituted C1-C6 alkyl; optionally substituted aryl; and optionally substituted heteroaryl;30-R3is selected from the group consisting of -H; optionally substituted C1-C6 alkyl; optionally substituted aryl; and optionally substituted heteroaryl;Ascendis Pharma A / S 105 CPX75149PC09 July 2025-R4is selected from the group consisting of -H; optionally substituted C1-C6 alkyl; optionally substituted aryl; and optionally substituted heteroaryl; each -R5is independently of each other selected from the group consisting of -H; optionally substituted C1-C6 alkyl; optionally substituted aryl; and optionally5 substituted heteroaryl; or when taken together two -R5can be cycloalkyl or cycloheteroalkyl; wherein -L1- is substituted with at least one -L2- and wherein -L1- is optionally furthersubstituted. 10 Only in the context of formula (V) the terms used have the following meaning: “Alkyl”, “alkenyl”, and “alkynyl” include linear, branched or cyclic hydrocarbon groups of 1- 8 carbons or 1-6 carbons or 1-4 carbons wherein alkyl is a saturated hydrocarbon, alkenyl includes one or more carbon-carbon double bonds and alkynyl includes one or more carbon-15 carbon triple bonds. Unless otherwise specified these contain 1-6 C. “Aryl” includes aromatic hydrocarbon groups of 6-18 carbons, such as 6-10 carbons, including groups such as phenyl, naphthyl, and anthracene “Heteroaryl” includes aromatic rings comprising 3-15 carbons containing at least one N, O or S atom, such as 3-7 carbons containing 20 at least one N, O or S atom, including groups such as pyrrolyl, pyridyl, pyrimidinyl, imidazolyl, oxazolyl, isoxazolyl, thiszolyl, isothiazolyl, quinolyl, indolyl, indenyl, and similar. The term “substituted” means an alkyl, alkenyl, alkynyl, aryl, or heteroaryl group comprising one or more substituent groups in place of one or more hydrogen atoms. Substituents may25 generally be selected from halogen including F, Cl, Br, and I; lower alkyl including linear, branched, and cyclic; lower haloalkyl including fluoroalkyl, chloroalkyl, bromoalkyl, and iodoalkyl; OH; lower alkoxy including linear, branched, and cyclic; SH; lower alkylthio including linear, branched and cyclic; amino, alkylamino, dialkylamino, silyl including alkylsilyl, alkoxysilyl, and arylsilyl; nitro; cyano; carbonyl; carboxylic acid, carboxylic ester, 30 carboxylic amide, aminocarbonyl; aminoacyl; carbamate; urea; thiocarbamate; thiourea; ketone; sulfone; sulfonamide; aryl including phenyl, naphthyl, and anthracenyl; heteroaryl including 5-member heteroaryls including as pyrrole, imidazole, furan, thiophene, oxazole, thiazole, isoxazole, isothiazole, thiadiazole, triazole, oxadiazole, and tetrazole, 6-member heteroaryls including pyridine, pyrimidine, pyrazine, and fused heteroaryls includingAscendis Pharma A / S 106 CPX75149PC09 July 2025benzofuran, benzothiophene, benzoxazole, benzimidazole, indole, benzothiazole, benzisoxazole, and benzisothiazole. In certain embodiments -L1- of formula (V) is substituted with one moiety -L2-.5 In certain embodiments -L1- of formula (V) is not further substituted.In certain embodiments -L1- is as disclosed in US7585837B2, which is herewith incorporatedby reference in its entirety. Accordingly, in certain embodiments -L1- is of formula (VI):10 wherein the dashed line indicates attachment to -D- through an amine functional group ofH-D-AB2; R1and R2are independently selected from the group consisting of hydrogen, alkyl, 15 alkoxy, alkoxyalkyl, aryl, alkaryl, aralkyl, halogen, nitro, -SO3H, -SO2NHR5, amino, ammonium, carboxyl, PO3H2, and OPO3H2; R3, R4, and R5are independently selected from the group consisting of hydrogen, alkyl, and aryl; wherein -L1- is substituted with at least one -L2- and wherein -L1- is optionally further20 substituted. Suitable substituents for formulas (VI) are alkyl (such as C1-6 alkyl), alkenyl (such as C2-6 alkenyl), alkynyl (such as C2-6alkynyl), aryl (such as phenyl), heteroalkyl, heteroalkenyl, heteroalkynyl, heteroaryl (such as aromatic 4 to 7 membered heterocycle) or halogen moieties. 25 Only in the context of formula (VI) the terms used have the following meaning:The terms “alkyl”, “alkoxy”, “alkoxyalkyl”, “aryl”, “alkaryl” and “aralkyl” mean alkyl radicals of 1-8, such as 1-4 carbon atoms, e.g. methyl, ethyl, propyl, isopropyl and butyl, and arylAscendis Pharma A / S 107 CPX75149PC09 July 2025radicals of 6-10 carbon atoms, e.g. phenyl and naphthyl. The term “halogen” includes bromo, fluoro, chloro and iodo. In certain embodiments -L1- of formula (VI) is substituted with one moiety -L2-.5 In certain embodiments -L1- of formula (VI) is not further substituted.A further preferred embodiment for -L1- is disclosed in WO2002 / 089789A1, which is herewithincorporated by reference in its entirety. Accordingly, a preferred moiety -L1- is of formula10 (VII): wherein the dashed line indicates attachment to -D- through an amine functional group ofH-D-AB2; 15 L1is a bifunctional linking group, Y1 and Y2 are independently O, S or NR7; R2, R3, R4, R5, R6and R7are independently selected from the group consisting of hydrogen, C1-6alkyls, C3-12branched alkyls, C3-8cycloalkyls, C1-6substituted alkyls, C3-8 substituted cycloalkyls, aryls, substituted aryls, aralkyls, C1-6 heteroalkyls,20substituted C1-6 heteroalkyls, C1-6 alkoxy, phenoxy, and C1-6 heteroalkoxy; Ar is a moiety which when included in formula (VII) forms a multisubstituted aromatichydrocarbon or a multi-substituted heterocyclic group; X is a chemical bond or a moiety that is actively transported into a target cell, a hydrophobic moiety, or a combination thereof, 25 y is 0 or 1; wherein -L1- is substituted with at least one -L2- and wherein -L1- is optionally furthersubstituted. Only in the context of formula (VII) the terms used have the following meaning:Ascendis Pharma A / S 108 CPX75149PC09 July 2025The term “alkyl” shall be understood to include, e.g., straight, branched, substituted C1-12 alkyls, including alkoxy, C3-8cycloalkyls or substituted cycloalkyls, etc. 5 The term “substituted” shall be understood to include adding or replacing one or more atoms contained within a functional group or compounds with one or more different atoms. Substituted alkyls include carboxyalkyls, aminoalkyls, dialkylaminos, hydroxyalkyls and mercaptoalkyls; substituted cycloalkyls include moieties such as 4-chlorocyclohexyl; aryls 10 include moieties such as napthyl; substituted aryls include moieties such as 3-bromo-phenyl; aralkyls include moieties such as toluyl; heteroalkyls include moieties such as ethylthiophene; substituted heteroalkyls include moieties such as 3-methoxythiophone; alkoxy includes moieties such as methoxy; and phenoxy includes moieties such as 3-nitrophenoxy. Halo- shallbe understood to include fluoro, chloro, iodo and bromo. 15 In certain embodiments -L1- of formula (VII) is substituted with one moiety -L2-.In certain embodiments -L1- of formula (VII) is not further substituted.20 In certain embodiments -L1- comprises a substructure of formula (VIII) (VIII), wherein the dashed line marked with the asterisk indicates attachment to a nitrogen of -D- through an amide bond;25 the unmarked dashed lines indicate attachment to the remainder of -L1-; and wherein -L1- is substituted with at least one -L2- and wherein -L1- is optionally furthersubstituted. In certain embodiments -L1- of formula (VIII) is substituted with one moiety -L2-.30Ascendis Pharma A / S 109 CPX75149PC09 July 2025In certain embodiments -L1- of formula (VIII) is not further substituted.In certain embodiments -L1- comprises a substructure of formula (IX) 5 wherein the dashed line marked with the asterisk indicates attachment to a nitrogen of -D- through a carbamate bond;the unmarked dashed lines indicate attachment to the remainder of -L1-; and wherein -L1- is substituted with at least one -L2- and wherein -L1- is optionally further10 substituted. In certain embodiments -L1- of formula (IX) is substituted with one moiety -L2-.In certain embodiments -L1- of formula (IX) is not further substituted.15 In certain embodiments -L1- has a structure as disclosed in WO2020 / 206358 A1. Accordingly,in certain embodiments the moiety -L1- is of formula (X): wherein 20 the unmarked dashed line indicates attachment to -D-; the dashed line marked with the asterisk indicates attachment to -L2-; n is an integer selected from the group consisting of 0, 1, 2, 3, 4, 5 and 6; -R1and -R2are independently an electron-withdrawing group, alkyl, or -H, and wherein at least one of -R1or -R2is an electron-withdrawing group; 25 each -R4is independently C1-C3alkyl or the two -R4are taken together with the carbon atom to which they are attached to form a 3- to 6-membered ring; andAscendis Pharma A / S 110 CPX75149PC09 July 2025-Y- is absent when -D- is a drug moiety connected through an amine,or -Y- is -N(R6)CH2- when -D- is a drug moiety connected through a phenol, alcohol,thiol, thiophenol, imidazole, or non-basic amine; wherein -R6is optionally substituted C1-C6alkyl, optionally substituted aryl, or optionally substituted heteroaryl. 5 In certain embodiments n of formula (X) is an integer selected from 1, 2, 3, 4, 5 and 6. In certain embodiments n of formula (X) is an integer selected from 1, 2 and 3. In certain embodiments n of formula (X) is an integer from 0, 1, 2 and 3. In certain embodiments n of formula (X) is 1. In certain embodiments n of formula (X) is 2. In certain embodiments n of formula (X) is 3. 10 In certain embodiments the electron-withdrawing group of -R1and -R2of formula (X) is selected from the group consisting of -CN; -NO2; optionally substituted aryl; optionally substituted heteroaryl; optionally substituted alkenyl; optionally substituted alkynyl; -COR3, -SOR3, or -SO2R3, wherein -R3is -H, optionally substituted alkyl, optionally 15 substituted aryl, optionally substituted arylalkyl, optionally substituted heteroaryl, optionally substituted heteroarylalkyl, -OR8or -NR82, wherein each -R8is independently -H or optionally substituted alkyl, or both -R8groups are taken together with the nitrogen to which they are attached to form a heterocyclic ring; or -SR9, wherein -R9is optionally substituted alkyl, optionally substituted aryl, optionally substituted arylalkyl, optionally substituted heteroaryl, 20 or optionally substituted heteroarylalkyl. In certain embodiments the electron-withdrawing group of -R1and -R2of formula (X) is -CN. In certain embodiments the electron-withdrawing group of -R1and -R2of formula (X) is -NO2. In certain embodiments the electron-withdrawing group of -R1and -R2of formula (X) is25 optionally substituted aryl comprising 6 to 10 carbons. In certain embodiments the electron- withdrawing group of -R1and -R2of formula (X) is optionally substituted phenyl, naphthyl, or anthracenyl. In certain embodiments the electron-withdrawing group of -R1and -R2of formula (X) is optionally substituted heteroaryl comprising 3 to 7 carbons and comprising at least one N, O, or S atom. In certain embodiments the electron-withdrawing group of -R1and -R2of 30 formula (X) is optionally substituted pyrrolyl, pyridyl, pyrimidinyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, quinolyl, indolyl, or indenyl. In certain embodiments the electron-withdrawing group of -R1and -R2of formula (X) is optionally substituted alkenyl containing 2 to 20 carbon atoms. In certain embodiments the electron-withdrawing group of -R1and -R2of formula (X) is optionally substituted alkynyl comprising 2 to 20 carbon atoms. InAscendis Pharma A / S 111 CPX75149PC09 July 2025certain embodiments the electron-withdrawing group of -R1 and -R2 of formula (X)is -COR3, -SOR3, or -SO2R3, wherein -R3is -H, optionally substituted alkyl comprising 1 to 20 carbon atoms, optionally substituted aryl, optionally substituted arylalkyl, optionally substituted heteroaryl, optionally substituted heteroarylalkyl, -OR8or -NR82, wherein each -R85 is independently -H or optionally substituted alkyl comprising 1 to 20 carbon atoms, or both -R8groups are taken together with the nitrogen to which they are attached to form a heterocyclic ring. In certain embodiments the electron-withdrawing group of -R1and -R2of formula (X) is -SR9, wherein -R9is optionally substituted alkyl comprising 1 to 20 carbon atoms, optionally substituted aryl, optionally substituted arylalkyl, optionally substituted heteroaryl, or optionally 10 substituted heteroarylalkyl. In certain embodiments at least one of -R1or -R2of formula (X) is -CN, -SOR3or -SO2R3. In certain embodiments at least one of -R1and -R2of formula (X) is -CN or -SO2R3. In certain embodiments at least one of -R1and -R2of formula (X) is -CN or -SO2R3, wherein -R3is 15 optionally substituted alkyl, optionally substituted aryl, or -NR82. In certain embodiments at least one of -R1and -R2of formula (X) is -CN, -SO2N(CH3)2, -SO2CH3, phenyl substituted with -SO2, phenyl substituted with -SO2and -Cl, -SO2N(CH2CH2)2O, -SO2CH(CH3)2, -SO2N(CH3)(CH2CH3), or -SO2N(CH2CH2OCH3)2. 20 In certain embodiments each -R4of formula (X) is independently C1-C3alkyl. In certain embodiments both -R4are methyl. In certain embodiments -Y- of formula (X) is absent. In certain embodiments -Y- of formula(X) is -N(R6)CH2-. 25 In certain embodiments -L1- is of formula (X), wherein n is 1, -R1 is -CN, -R2 is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 1, -R1 is -SO2N(CH3)2, -R2is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 1, -R1 isSO2CH3, -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula (X), wherein n30 is 1, -R1 is -SO2N(CH2CH2)2CHCH3, -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- isof formula (X), wherein n is 1, -R1 is phenyl substituted with -SO2, -R2 is -H, and -R4 is -CH3.In certain embodiments -L1- is of formula (X), wherein n is 1, -R1 is phenyl substitutedwith -SO2 and -Cl, -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula (X),wherein n is 1, -R1is -SO2N(CH2CH2)2O, -R2is -H, and -R4is -CH3. In certainAscendis Pharma A / S 112 CPX75149PC09 July 2025embodiments -L1- is of formula (X), wherein n is 1, -R1 is -SO2CH(CH3)2, -R2 is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 1, -R1is -SO2N(CH3)(CH2CH3), -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula(X), wherein n is 1, -R1is -SO2N(CH2CH2OCH3)2, -R2is -H, and -R4is -CH3. In certain 5embodiments -L1- is of formula (X), wherein n is 1, -R1 is phenyl substituted with-SO2and -CH3, -R2is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 2, -R1 is -CN, -R2 is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 2, -R1 is -SO2N(CH3)2, -R210 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 2, -R1 isSO2CH3, -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula (X), wherein nis 2, -R1 is -SO2N(CH2CH2)2CHCH3, -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- isof formula (X), wherein n is 2, -R1 is phenyl substituted with -SO2, -R2 is -H, and -R4 is -CH3.In certain embodiments -L1- is of formula (X), wherein n is 2, -R1 is phenyl substituted15 with -SO2 and -Cl, -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula (X),wherein n is 2, -R1 is -SO2N(CH2CH2)2O, -R2 is -H, and -R4 is -CH3. In certainembodiments -L1- is of formula (X), wherein n is 2, -R1 is -SO2CH(CH3)2, -R2 is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 2, -R1is -SO2N(CH3)(CH2CH3), -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula20 (X), wherein n is 2, -R1is -SO2N(CH2CH2OCH3)2, -R2is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 2, -R1 is phenyl substituted with -SO2and -CH3, -R2is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 3, -R1 is -CN, -R2 is -H, and -R425 is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 3, -R1 is -SO2N(CH3)2, -R2is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 3, -R1 isSO2CH3, -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula (X), wherein nis 3, -R1 is -SO2N(CH2CH2)2CHCH3, -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- isof formula (X), wherein n is 3, -R1 is phenyl substituted with -SO2, -R2 is -H, and -R4 is -CH3.30 In certain embodiments -L1- is of formula (X), wherein n is 3, -R1 is phenyl substitutedwith -SO2 and -Cl, -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula (X),wherein n is 3, -R1is -SO2N(CH2CH2)2O, -R2is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 3, -R1 is -SO2CH(CH3)2, -R2 is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 3, -R1Ascendis Pharma A / S 113 CPX75149PC09 July 2025is -SO2N(CH3)(CH2CH3), -R2 is -H, and -R4 is -CH3. In certain embodiments -L1- is of formula(X), wherein n is 3, -R1is -SO2N(CH2CH2OCH3)2, -R2is -H, and -R4is -CH3. In certain embodiments -L1- is of formula (X), wherein n is 3, -R1 is phenyl substituted with -SO2and -CH3, -R2is -H, and -R4is -CH3. 5 Only in the context of formula (X) the terms used have the following meaning: The term "alkyl" refers to linear, branched, or cyclic saturated hydrocarbon groups of 1 to 20, 1 to 12, 1 to 8, 1 to 6, or 1 to 4 carbon atoms. In certain embodiments an alkyl is linear or 10 branched. Examples of linear or branched alkyl groups include methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, n-pentyl, n-hexyl, n-heptyl, n- octyl, n-nonyl,and n-decyl. In certain embodiments an alkyl is cyclic. Examples of cyclic alkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclopentadienyl, and cyclohexyl. 15 The term "alkoxy" refers to alkyl groups bonded to oxygen, including methoxy, ethoxy, isopropoxy, cyclopropoxy, and cyclobutoxy. The term "alkenyl" refers to non-aromatic unsaturated hydrocarbons with carbon-carbon double bonds and 2 to 20, 2 to 12, 2 to 8, 2 to 6, or 2 to 4 carbon atoms. 20 The term "alkynyl" refers to non-aromatic unsaturated hydrocarbons with carbon-carbon triple bonds and 2 to 20, 2 to 12, 2 to 8, 2 to 6, or 2 to 4 carbon atoms. The term "aryl" refers to aromatic hydrocarbon groups of 6 to 18 carbons, preferably 6 to 10 25 carbons, including groups such as phenyl, naphthyl, and anthracenyl. The term "heteroaryl" refers to aromatic rings comprising 3 to 15 carbons comprising at least one N, O or S atom, preferably 3 to 7 carbons comprising at least one N, O or S atom, including groups such as pyrrolyl, pyridyl, pyrimidinyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, quinolyl, indolyl, and indenyl. 30 In certain embodiments alkenyl, alkynyl, aryl or heteroaryl moieties may be coupled to the remainder of the molecule through an alkyl linkage. Under those circumstances, the substituent will be referred to as alkenylalkyl, alkynylalkyl, arylalkyl or heteroarylalkyl, indicating that anAscendis Pharma A / S 114 CPX75149PC09 July 2025alkylene moiety is between the alkenyl, alkynyl, aryl or heteroaryl moiety and the molecule to which the alkenyl, alkynyl, aryl or heteroaryl is coupled. The term "halogen" or "halo" refers to bromo, fluoro, chloro and iodo. 5 The term "heterocyclic ring" or "heterocyclyl" refers to a 3- to 15-membered aromatic or non-aromatic ring comprising at least one N, O, or S atom. Examples include piperidinyl, piperazinyl, tetrahydropyranyl, pyrrolidine, and tetrahydrofuranyl, as well as the exemplary groups provided for the term "heteroaryl" above. In certain embodiments a heterocyclic ring or 10 heterocyclyl is non-aromatic. In certain embodiments a heterocyclic ring or heterocyclyl is aromatic. The term "optionally substituted" refers to a group may be unsubstituted or substituted by one or more (e.g., 1, 2, 3, 4 or 5) of the substituents which may be the same or different. Examples 15 of substituents include alkyl, alkenyl, alkynyl, halogen, -CN, -ORaa, -SRaa, -NRaaRbb, -NO2, -C=NH(ORaa), -C(O)Raa, -OC(O)Raa, -C(O)ORaa, -C(O)NRaaRbb, -OC(O)NRaaRbb, -NRaaC(O)Rbb, -NRaaC(O)ORbb, -S(O)Raa, -S(O)2Raa, -NRaaS(O)Rbb, -C(O)NRaaS(O)Rbb, -NRaaS(O)2Rbb, -C(O)NRaaS(O)2Rbb, -S(O)NRaaRbb, -S(O)2NRaaRbb, -P(O)(ORaa)(ORbb), heterocyclyl, heteroaryl, or aryl, wherein the alkyl, alkenyl, alkynyl, 20 cycloalkyl, heterocyclyl, heteroaryl, and aryl are each independently optionally substituted by -Rcc, wherein -Raaand -Rbbare each independently -H, alkyl, alkenyl, alkynyl, heterocyclyl, heteroaryl, or aryl, or -Raaand -Rbbare taken together with the nitrogen atom to which they attach to form a heterocyclyl, which is optionally substituted by alkyl, alkenyl, alkynyl, halogen, hydroxyl, alkoxy, or -CN, and wherein: each -Rccis independently alkyl, alkenyl,25 alkynyl, halogen, heterocyclyl, heteroaryl, aryl, -CN, or -NO2. In certain embodiments -L1- has a structure as disclosed in formula I of WO2021 / 242756 A1.Accordingly, in certain embodiments the moiety -L1- is of formula (XIIa): (XIIa), 30 wherein the unmarked dashed line indicates attachment to -D-;Ascendis Pharma A / S 115 CPX75149PC09 July 2025the dashed line marked with the asterisk indicates attachment to -L2-; -R2, -R4and -R8are independently selected from the group consisting of -H or C1-4 alkyl; -R3is C1-4alkyl or -R3and -R4together with the atoms to which they are attached form a 5- or 6-membered heterocyclic ring;5 -R5is -NH2; with the proviso that when -R4and -R3together with the atoms to which they are attached from a 5- or 6-membered heterocyclic ring -R2 is not -H; andwherein the -L1- of formula (XIIa) is optionally substituted.10 In certain embodiments both -R4and -R8of formula (XIIa) are -H. In certain embodiments -R3 is methyl. In certain embodiments -R3 is -H.In certain embodiments -R2is -H. 15 In certain embodiments -L1- is of formula (XIIa-i) (XIIa-i), the unmarked dashed line indicates attachment to -D-; andthe dashed line marked with the asterisk indicates attachment to -L2-. 20 In certain embodiments -L1- is of formula (XIIa-ii) (XIIa-ii), the unmarked dashed line indicates attachment to -D-; and the dashed line marked with the asterisk indicates attachment to -L2-.25 In certain embodiments -L1- is of formula (XIIa-iii) (XIIa-iii), the unmarked dashed line indicates attachment to -D-; andAscendis Pharma A / S 116 CPX75149PC09 July 2025the dashed line marked with the asterisk indicates attachment to -L2-.In certain embodiments -L1- has a structure as disclosed in formula II of WO2022 / 096636 A1.Accordingly, in certain embodiments the moiety -L1- is of formula (XIIb):5 (XIIb), wherein the unmarked dashed line indicates attachment to -D-; and the dashed line marked with the asterisk indicates attachment to -L2-.10 In certain embodiments -D- is a drug moiety selected from the group consisting of smallmolecule drug moieties, medium size molecule drug moieties, oligonucleotide drug moieties, peptide nucleic acid drug moieties, peptide drug moieties and protein drug moieties. In certain embodiments -D- is a peptide drug moiety. In certain embodiments -D- is a small15 molecule drug moiety. In certain embodiments -D- is a medium size drug moiety. In certainembodiments -D- is an oligonucleotide drug moiety. In certain embodiments -D- is a peptidenucleic acid drug moiety. In certain embodiments -D- is a protein drug moiety.In certain embodiments -D- or -D-AB2 is a GLP-1 receptor agonist moiety. Accordingly, the20 conjugate of the present invention may be a GLP-1 receptor agonist conjugate. In certain embodiments -D- or -D-AB2 is a mono agonist of the GLP-1 receptor, i.e., onlyactivates the GLP-1 receptor.25 In certain embodiments -D- or -D-AB2 is an agonist of the GLP-1 receptor and an agonist of afurther receptor, i.e., -D- or -D-AB2 is a dual GLP-1 receptor agonist. Such further receptormay be selected from the group consisting of the GIP receptor, the GCG receptor, an amylinreceptor, a PYY receptor and the GLP-2 receptor.30 In certain embodiments -D- or -D-AB2 is an agonist of the GLP-1 receptor and of the GIPreceptor. In certain embodiments -D- or -D-AB2 is an agonist of the GLP-1 receptor and of theAscendis Pharma A / S 117 CPX75149PC09 July 2025GCG receptor. In certain embodiments -D- or -D-AB2 is an agonist of the GLP-1 receptor andof an amylin receptor. In certain embodiments -D- or -D-AB2 is an agonist of the GLP-1receptor and of a PYY receptor. In certain embodiments -D- or -D-AB2 is an agonist of theGLP-1 receptor and of the GLP-2 receptor. 5 In certain embodiments -D- or -D-AB2 is an agonist of the GLP-1 receptor andgrowth / differentiation factor 15 (GDF15). In certain embodiments -D- or -D- AB2 is an agonistof the GLP-1 receptor and fibroblast growth factor 21 (FGF21).10 In certain embodiments -D- or -D-AB2 is an agonist of the GLP-1 receptor and an agonist oftwo further receptors, i.e., -D- or -D-AB2 is a triple GLP-1 receptor agonist. These furtherreceptors are in certain embodiments selected from the group consisting of the GIP receptor (GIPR), the GCG receptor (GCGR), an amylin receptor, a PYY receptor (PYYR) and the GLP-2 receptor (GLP2R). 15 In certain embodiments -D- or -D-AB2 is a triple GLP-1 receptor agonist that activates theGLP-1 receptor, the GIP receptor and the GCG receptor. In certain embodiments -D- or -D-AB2is a triple GLP-1 receptor agonist that activates the GLP-1 receptor, the GIP receptor and an amylin receptor. In certain embodiments -D- or -D-AB2 is a triple GLP-1 receptor agonist that20 activates the GLP-1 receptor, the GIP receptor and a PYY receptor. In certainembodiments -D- or -D-AB2 is a triple GLP-1 receptor agonist that activates the GLP-1receptor, the GIP receptor and the GLP-2 receptor. In certain embodiments -D- or -D-AB2 is atriple GLP-1 receptor agonist that activates the GLP-1 receptor, the GCG receptor and an amylin receptor. In certain embodiments -D- or -D-AB2 is a triple GLP-1 receptor agonist that25 activates the GLP-1 receptor, the GCG receptor and a PYY receptor. In certainembodiments -D- or -D-AB2 is a triple GLP-1 receptor agonist that activates the GLP-1receptor, the GCG receptor and the GLP-2 receptor. In certain embodiments -D- or -D-AB2 isa triple GLP-1 receptor agonist that activates the GLP-1 receptor, an amylin receptor and aPYY receptor. In certain embodiments -D- or -D-AB2 is a triple GLP-1 receptor agonist that30 activates the GLP-1 receptor, an amylin receptor and the GLP-2 receptor. In certainembodiments -D- or -D-AB2 is a triple GLP-1 receptor agonist that activates the GLP-1receptor, a PYY receptor and the GLP-2 receptor.In certain embodiments -D- is a human GLP-1 of SEQ ID NO:1:Ascendis Pharma A / S 118 CPX75149PC09 July 2025HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG. In certain embodiments -D- is human GLP-1 analog of SEQ ID NO:1, which peptide sequencemay comprise one or more amino acid changes compared to SEQ ID NO:1. Such amino acid 5changes may be the addition of at least one amino acid residue, the deletion of at least oneamino acid residue, the replacement of at least one amino acid residue with a different aminoacid residue or may be any combination thereof. Such amino acid change may occur at the N-terminus, the C-terminus and / or at an internal site of the GLP-1 of SEQ ID NO:1. In certain embodiments such human GLP-1 analog has a maximum of 3 amino acid changes compared 10 to SEQ ID NO:1, i.e., a maximum of three amino acids of SEQ ID NO:1 are added to, deleted from and / or replaced with a different amine acid residue compared to the sequence of SEQ ID NO:1. In certain embodiments -D- has the sequence15 HX1EGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO:2), wherein X1 is 2-aminoisobutyric acid (Aib). In certain embodiments -D- has the sequenceHX1EGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO:3),20 wherein X1 is Aib and the C-terminal glycine, i.e., the glycine at position 31, is amidated as aC-terminal primary amide. In certain embodiments -D- is exenatide. Exenatide has the sequenceHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID NO:4). 25 In certain embodiments -D- has the sequenceHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID NO:5), wherein the C-terminal serine, i.e., the serine at position 39, is amidated as a C-terminal primaryamide. 30 In certain embodiments -D- is lixisenatide. Lixisenatide has the sequenceHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK (SEQ ID NO:6), wherein the C-terminal lysine, i.e., the lysine at position 44, is amidated as a C-terminalprimary amide.Ascendis Pharma A / S 119 CPX75149PC09 July 2025In certain embodiments -D- has the sequenceHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK (SEQ ID NO:7). 5In certain embodiments -D- has the sequenceHX1EGTFTSDLSKQX2EEEAVRLFIEWLKQGGPSSGAPPPC (SEQ ID NO:8), wherein X1is D-alanine and X2is norleucine (Nle). In certain embodiments -D- has the sequence10 HX1EGTFTSDLSKQX2EEEAVRLFIEWLKQGGPSSGAPPPC (SEQ ID NO:9), wherein X1 is D-alanine, X2 is Nle and the C-terminal cysteine, i.e., the cysteine at position 39, is amidated as a C-terminal primary amide. In certain embodiments -D- is PEG-loxenatide. PEG-loxenatide has the sequence15 HX1EGTFTSDLSKQX2EEEAVRLFIEWLKQGGPSSGAPPPC (SEQ ID NO:10), wherein X1 is D-alanine; X2 is Nle; the cysteine at position 39 is chemically modified through conjugation to the thiol group of the cysteine side-chain with , wherein 20 the dashed line indicates attachment to the thiol group of the cysteine side chain of the cysteine at position 39, and each mPEG is methoxypoly(ethylene glycol) with a molecular weight of approx.20 kDa. In certain embodiments -D- has the sequence25 HX1EGTFTSDLSKQX2EEEAVRLFIEWLKQGGPSSGAPPPC (SEQ ID NO:11), wherein X1is D-alanine; X2is Nle; the cysteine at position 39 is chemically modified through conjugation to the thiol group of the cysteine side-chain withAscendis Pharma A / S 120 CPX75149PC09 July 2025 , wherein the dashed line indicates attachment to the thiol group of the cysteine side chain of the cysteine at position 39, each mPEG is methoxypoly(ethylene glycol) with a molecular 5 weight of approx. 20 kDa, and the C-terminal cysteine, i.e., the cysteine at position 39, is amidated as a C-terminal primary amide. In certain embodiments -D- has the sequenceHAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO:12). 10 In certain embodiments -D- has the sequenceHAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO:13), and the C-terminal glycine, i.e., the glycine at position 31, is amidated as a C-terminal primaryamide. 15 In certain embodiments -D- has the sequenceHVEGTFTSDVSSYLEEQAAREFIKWLVRGRG (SEQ ID NO:14). In certain embodiments -D- has the sequence20 HVEGTFTSDVSSYLEEQAAREFIKWLVRGRG (SEQ ID NO:15), and the C-terminal glycine, i.e., the glycine at position 31, is amidated as a C-terminal primaryamide. In certain embodiments -D- has the sequence25 HGEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO:16). In certain embodiments -D- has the sequenceHGEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO:17), and the C-terminal glycine, i.e., the glycine at position 31, is amidated as a C-terminal primary30 amide.Ascendis Pharma A / S 121 CPX75149PC09 July 2025In certain embodiments -D- has the sequenceHX1EGTFTSDVSSYLEGQAAKEFIAWLVRGRGL (SEQ ID NO:18), wherein X1is Aib. 5 In certain embodiments -D- has the sequenceHX1EGTFTSDVSSYLEGQAAKEFIAWLVRGRGL (SEQ ID NO:19), wherein X1 is Aib and the C-terminal leucine, i.e., the leucine at position 32, is amidated as aC-terminal primary amide. 10 In certain embodiments -D- has the sequenceYX1EGTFTSDYSIX2LDKIAQKAFVQWLIAGGPSSGAPPPS (SEQ ID NO:20),wherein X1is Aib, X2is Aib and the C-terminal serine, i.e., the serine at position 39, is amidated as a C-terminal primary amide. 15 In certain embodiments -D- has the sequenceYX1EGTFTSDYSIX2LDKIAQKAFVQWLIAGGPSSGAPPPS (SEQ ID NO:21), wherein X1 is Aib and X2 is Aib.20 In certain embodiments -D- has the sequenceHSQGTFTSDKSEYLDSERARDFVAWLEAGG (SEQ ID NO:22). In certain embodiments -D- has the sequenceHSQGTFTSDKSEYLDSERARDFVAWLEAGG (SEQ ID NO:23),25 wherein the C-terminal glycine, i.e., the glycine at position 30, is amidated as a C-terminalprimary amide. In certain embodiments -D- has the sequenceHX1QGTFTSDYSKYLDERAAKDFIKWLESA (SEQ ID NO:24), 30 wherein X1is 1-amino-cyclobutanecarboxylic acid (Ac4c); and the C-terminal alanine, i.e. the alanine at position 29, is amidated as a C-terminal primary amide. In certain embodiments -D- has the sequenceHX1QGTFTSDYSKYLDERAAKDFIKWLESA (SEQ ID NO:25),Ascendis Pharma A / S 122 CPX75149PC09 July 2025wherein X1 is 1-amino-cyclobutanecarboxylic acid (Ac4c). In certain embodiments -D- has the sequenceHX1QGTFTSDYSKYLDEKAAKEFIQWLLQT (SEQ ID NO:26), 5 wherein X1 is Aib and the glutamic acid at position 16 and the lysine at position 20 are connected via a lactam bridge. In certain embodiments -D- has the sequenceHX1QGTFTSDYSKYLDEKAAKEFIQWLLQT (SEQ ID NO:27), 10 wherein X1is Aib, the glutamic acid at position 16 and the lysine at position 20 are connected via a lactam bridge and the C-terminal threonine, i.e., the threonine at position 29, is amidated as a C-terminal primary amide. In certain embodiments -D- has the sequence15 HX1QGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG (SEQ ID NO:28), wherein X1 is Aib and the C-terminal glycine, i.e., the glycine at position 34, is amidated as aC-terminal primary amide. In certain embodiments -D- has the sequence20 HX1QGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG (SEQ ID NO:29), wherein X1 is Aib. In certain embodiments -D- has the sequenceHX1EGSFTSELATILDKQAARDFIAWLIQHKITD (SEQ ID NO:30), 25 wherein X1 is Aib. In certain embodiments -D- has the sequenceHX1EGSFTSELATILDKQAARDFIAWLIQHKITD (SEQ ID NO:31), wherein X1 is Aib and the C-terminal aspartic acid, i.e., the aspartic acid at position 33, is 30 amidated as a C-terminal primary amide. In certain embodiments -D- has the sequenceYX1QGTFTSDYSIX2LDKKAQX3AFIEYLLEGGPSSGAPPPS (SEQ ID NO:32),Ascendis Pharma A / S 123 CPX75149PC09 July 2025wherein X1 is Aib, X2 is α-methyl-leucine (αMeL), X3 is Aib; and the C-terminal serine, i.e. the serine at position 39, is amidated as a C-terminal primary amide. In certain embodiments -D- has the sequence5 YX1QGTFTSDYSIX2LDKKAQX3AFIEYLLEGGPSSGAPPPS (SEQ ID NO:33), wherein X1is Aib, X2is α-methyl-leucine (αMeL) and X3is Aib. In certain embodiments -D- has the sequenceHX1EGTFTSDVSSYLEEEAAKEFIAWLVRGGPSSGAPPPSK (SEQ ID NO:54),10 wherein X1is Aib. In certain embodiments -D- has the sequenceHX1EGTFTSDVSSYLEEQAAKEFIAWLVRGGG (SEQ ID NO:55), wherein X1 is Aib. 15 In certain embodiments -D- has the sequenceHX1EGTFTSDVSSYLEEQAAKEFIAWLVRGGGGAQPGAQPGAQPGAQPGAQPGAQP GAQPGAQPGAQPGQKP (SEQ ID NO:56),wherein X1is Aib. 20 In certain embodiments -D- has the sequenceYX1EGTFTSDYSIX2LDKIAQKAFVQWLIAGGPSSGAPPPS (SEQ ID NO:57), wherein X1and X2are both Aib.25 In certain embodiments -D- is a drug selected from the group consisting of insulins; amylinand amylin / calcitonin; PYY; GIP; MSH; C5a binders; GDF15; PCSK9 I; immune stimulants; urocortin2; MIC-1; IL-1R antagonists; leptin; gastrin; glucagon; exendin-4; GLP-1; GLP-2; and GIP.30 In certain embodiments -D- is a drug moiety selected from the group consisting of insulin;insulin analogues; amylin; dual amylin / calcitonin agonists; PYY; GIP; MSH; C5 inhibitors ormodulators; GDF15; PCSK9 inhbitors; immune stimulants; urocortin II; MIC-1; IL-1R antagonists; leptin; gastrin; glucagon; oxyntomodulin; neurokinin A; tachykinin / neurokininreceptor 2 (NK2R) agonists; neurokinin receptor (NKR) agonists and GLP-2.Ascendis Pharma A / S 124 CPX75149PC09 July 2025In certain embodiments -D- is an insulin, such as insulin detemir, insulin degludec or insulin.In certain embodiments -D- is amylin or amylin / calcitonin, such as for example cagrilintide. Incertain embodiments -D- is PYY, such as NNC0165-1875. In certain embodiments -D- is GIP.5 In certain embodiments -D- is MSH. In certain embodiments -D- is a C5a binder, such aszilucoplan. In certain embodiments -D- is GDF15, such as NN LA-GDF15. In certainembodiments -D- is PCSK9 i. In certain embodiments -D- is an immune stimulant, such asromurtide or mifamurtide. In certain embodiments -D- is muramyl dipeptide. In certainembodiments -D- is urocortin2. In certain embodiments -D- is MIC-1. In certain10 embodiments -D- is an IL-1R antagonist. In certain embodiments -D- is leptin. In certainembodiments -D- is gastrin.In certain embodiments -D- is selected from the list consisting of growth hormones, such ashuman growth hormone; FGF21; EGF(a); and coagulations factors. 15 In certain embodiments -D- is a growth hormone, such as a human growth hormone, such assomapacitan. In certain embodiments -D- is FGF21, such as NNC0194 0499. In certainembodiments -D- is EGF(a). In certain embodiments -D- is a coagulation factor.20 In certain embodiments -D- is selected from cytotoxic small molecule drugs; chemotherapysmall molecule drugs; and immune activating small molecule drugs. In certain embodiments -D- is a cytotoxic small molecule drug. In certain embodiments -D- isa chemotherapy small molecule drug. In certain embodiments -D- is and immune activating25 small molecule drug, such as telratolimod. In certain embodiments -D- is paclitaxel. In certain embodiments -D- is doxorubicin. In certainembodiments -D- is 5-FU.30 In certain embodiments -D- is a PTH moiety.A moiety -AB1 is conjugated to -D- via -L2-L1-, wherein -L2- is conjugated to -AB1 and -L1- isconjugated to -D-. Upon cleavage of the linkage between -L1- and -D- the moiety -AB1 remainsconjugated to -L2-. A moiety -AB2is directly conjugated to -D-, such as through a stableAscendis Pharma A / S 125 CPX75149PC09 July 2025linkage. This means that upon cleavage of the linkage between -L1- and -D- a conjugate H-D-AB2 is released, wherein H- is hydrogen. Accordingly, the moiety “H-D-AB2” is also referredto as the corresponding free drug of a conjugated moiety -D-AB2. 5 In certain embodiments -D-AB2is selected from the group consisting of semaglutide, liraglutide, ecnoglutide, GZR18, GL0034, tirzepatide, cotadutide, BI-456906, pemvidutide, mazdutide, dapiglutide and retatrutide. In certain embodiments -D-AB2is selected from the group consisting of semaglutide, 10 liraglutide, ecnoglutide, GZR18 and GL0034. In certain embodiments -D-AB2is semaglutide. Semaglutide is a compound of formula HX1EGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO:40), wherein 15 X1 is α-aminoisobutyric acid (Aib); and the lysine at position 20 is chemically modified through conjugation to the epsilon-amine group of the lysine side-chain with wherein 20 the dashed line indicates attachment to the epsilon-amine group of the lysine side chain of the lysine at position 20. Semaglutide may be prepared using methods known to those skilled in the art, such as those described in WO2006 / 097537. 25 In certain embodiments -D-AB2is liraglutide. Liraglutide is a compound of formula HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO:41),wherein the lysine at position 20 is chemically modified through conjugation to the epsilon-amine 30 group of the lysine side chain withAscendis Pharma A / S 126 CPX75149PC09 July 2025 , wherein the dashed line indicates attachment to the epsilon-amine group of the lysine side chainof the lysine at position 20. 5 In certain embodiments -D-AB2is ecnoglutide. Ecnoglutide is a compound of formula HVEGTFTSDVSSYLEEQAAREFIKWLVRGRG (SEQ ID NO:42), wherein the lysine at position 24 is chemically modified through conjugation to the epsilon-amine 10 group of the lysine side chain with , wherein the dashed line indicates attachment to the epsilon-amine group of the lysine side chain of the lysine at position 24. 15 In certain embodiments -D-AB2is GZR18. GZR18 is a compound of formula HGEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO:43), wherein the lysine at position 20 is chemically modified through conjugation to the epsilon-amine group of the lysine side-chain with 20 , wherein the dashed line indicates attachment to the epsilon amine group of the lysine side chain of the lysine at position 20. In certain embodiments -D-AB2is GL0034. GL0034 is also known as utreglutide and is a 25 compound of formula HX1EGTFTSDVSSYLEGQAAKEFIAWLVRGRGL (SEQ ID NO:44), whereinAscendis Pharma A / S 127 CPX75149PC09 July 2025X1 is Aib; and the lysine at position 20 is chemically modified through conjugation to the epsilon-amine group of the lysine side-chain with , 5 wherein the dashed line indicates attachment to the epsilon amine group of the lysine side chain of the lysine at position 20. In certain embodiments -D-AB2is a dual GLP-1 receptor agonist selected from the group consisting of tirzepatide, cotadutide, BI-456906, pemvidutide and mazdutide. 10 In certain embodiments -D-AB2is a dual GLP-1 receptor agonist that activates the GLP-1 receptor and the GIP receptor. An example for such dual GLP-1 receptor agonist is tirzepatide. In certain embodiments -D-AB2is tirzepatide. Tirzepatide is a compound of formula 15 YX1EGTFTSDYSIX2LDKIAQKAFVQWLIAGGPSSGAPPPS (SEQ ID NO:45), wherein X1is Aib; X2 is Aib; the lysine at position 20 is chemically modified through conjugation to the epsilon-amine20 group of the lysine side-chain with ([2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(γGlu)1-CO- (CH2)18-CO2H; and the C-terminal serine, i.e. the serine at position 39, is amidated as a C-terminal primary amide. 25 The moiety ([2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(γGlu)1-CO-(CH2)18-CO2H has the following structure , wherein the dashed line indicates attachment to -D-.Ascendis Pharma A / S 128 CPX75149PC09 July 2025In certain embodiments -D-AB2is a dual GLP-1 receptor agonist that activates the GLP-1 receptor and the glucagon receptor selected from the group consisting of cotadutide, BI- 456906, pemvidutide and mazdutide. 5In certain embodiments -D-AB2 is cotadutide. Cotadutide is a compound of formulaHSQGTFTSDKSEYLDSERARDFVAWLEAGG (SEQ ID NO:46), wherein the lysine at position 10 is chemically modified through conjugation to the epsilon- amine group of the lysine side-chain with γ-Glu-palmitoyl. 10 The moiety γ-Glu-palmitoyl has the following structure: , wherein the dashed line indicates attachment to -D-.15 In certain embodiments -D-AB2is BI-456906. BI-456906 is also known as survodutide and is a compound of formula HX1QGTFTSDYSKYLDERAAKDFIKWLESA (SEQ ID NO:47), wherein X1 is 1-amino-cyclobutanecarboxylic acid (Ac4c); 20 the lysine at position 24 is chemically modified through conjugation to the epsilon-amine group of the lysine side-chain with [l7-carboxy-heptadecanoyl]-isoGlu-GSGSGG; and the C-terminal alanine, i.e. the alanine at position 29, is amidated as a C-terminal primary amide. 25 The moiety [l7-carboxy-heptadecanoyl]-isoGlu-GSGSGG has the following structure: ,Ascendis Pharma A / S 129 CPX75149PC09 July 2025wherein the dashed line indicates attachment to -D-.In certain embodiments -D-AB2is pemvidutide. Pemvidutide is a compound of formula HX1QGTFTSDYSKYLDEKAAKEFIQWLLQT (SEQ ID NO:48), 5 wherein X1 is Aib; the glutamic acid at position 16 and the lysine at position 20 are connected via a lactam bridge; the lysine at position 17 is chemically modified through conjugation to the epsilon-amine10 group of the lysine side-chain with glucuronic acid C-18, which is a moiety of formula , wherein the dashed line indicates attachment to the epsilon-amine group of the lysine at position 17; and 15 the C-terminal threonine, i.e., the threonine at position 29, is amidated as a C-terminal primary amide In certain embodiments -D-AB2is mazdutide. Mazdutide is a compound of formula HX1QGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG (SEQ ID NO:49),20 wherein X1is Aib, the lysine at position 20 is chemically modified by conjugation of the epsilon-amine group of the lysine side chain with ([2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(γ-Glu)-CO- (CH2)18-CO2H; and 25 the C-terminal glycine, i.e. the glycine at position 34, is amidated. The moiety ([2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(γ-Glu)-CO-(CH2)18-CO2H has thefollowing structure: ,30 wherein the dashed line indicates attachment to -D-.Ascendis Pharma A / S 130 CPX75149PC09 July 2025In certain embodiments -D-AB2is a dual GLP-1 receptor agonist that activates the GLP-1 receptor and the GLP-2 receptor, such as dapiglutide. Dapiglutide is a compound of formula HX1EGSFTSELATILDKQAARDFIAWLIQHKITD (SEQ ID NO:50), 5 wherein X1is Aib; and the lysine in position 16 is chemically modified by conjugation of the epsilon-amino- group of the lysine side chain with [17-carboxy-heptadecanoyl]-isoGlu.10 The moiety [17-carboxy-heptadecanoyl]-isoGlu has the following structure: , wherein the dashed line indicates attachment to -D-.In certain embodiments -D-AB2is retatrutide, which is a triple GLP-1 receptor agonist that 15 activates the GLP-1 receptor, the GIP receptor and the GCG receptor. Retatrutide is a compound of formula YX1QGTFTSDYSIX2LDKKAQX3AFIEYLLEGGPSSGAPPPS (SEQ ID NO:51), wherein X1 is Aib; 20 X2is α-methyl-leucine (αMeL); X3is Aib; the lysine at position 17 is chemically modified by conjugation of the epsilon-amine group of the lysine side chain with (2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)-(γGlu)-CO- (CH2)18-CO2H; and 25 the C-terminal serine, i.e. the serine at position 39, is amidated. Retatrutide can also be described as Y-Aib-QGTFTSDYSI-αMeL-LDKK ((2-[2-(2-amino- ethoxy)-ethoxy]-acetyl)-(γGlu)-CO-(CH2)18-CO2H) AQ-Aib-AFIEYLLEGGPSSGAPPPS- NH2 (SEQ ID NO:51). 30Ascendis Pharma A / S 131 CPX75149PC09 July 2025The moiety (2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)-(γGlu)-CO-(CH2)18-CO2H has the following structure: . 5 In certain embodiments -D-AB2is noiiglutide, also known as SHR20004. In certain embodiments -D-AB2is ZT002. In certain embodiments -D-AB2is of formula (b-1) 10 with Ph being phenyl. 15 The moiety -D- of formula (b-1) has the sequence of SEQ ID NO:57YX1EGTFTSDYSIX2LDKIAQKAFVQWLIAGGPSSGAPPPS, with X1and X2being Aib. 20 The compounds of formula (b-1) are disclosed in WO2022159395 and WO2023 / 044290, the content of which is herewith incorporated by reference in its entirety.Ascendis Pharma A / S 132 CPX75149PC09 July 2025In certain embodiments -D-AB is of formula (b-1) and X1- is and -X2 is . Incertain embodiments D-AB is of formula (b-1) and X1- is 5 . .10 of formula 15Ascendis Pharma A / S 133 CPX75149PC09 July 2025In certain embodiments -D-AB2is selected from the group consisting of semaglutide, liraglutide, ecnoglutide, GZR18, GL0034, tirzepatide, cotadutide, BI-456906, pemvidutide, mazdutide, dapiglutide and retatrutide. 5 In certain embodiments -D-AB2is petrelintide. In certain embodiments -D-AB2 is of formulak(γE-(miniPEG)2-γE-COC16H32CO2H)(N-Me)GSVSEIQLMHNLGKHLNSMERVEW LRKKLQDVHK(γE-(miniPEG)2-γE-COC16H32CO2H)-OH (SEQ ID NO:52), 10 wherein k is d-Lys; γE is the l-isomer of gamma, glutamic acid; miniPEG is COCH2OCH2CH2OCH2CH2NH; COC16H32CO2H is C18 diacid; 15 (N-Me)G is sarcosine; K is l-isomer of lysine; and -OH designates the C-terminal amino acid has a terminal carboxylic acid. In certain embodiments -D-AB2is of formula 20 k(γE-(miniPEG)2-γE-COC16H32CO2H)(N-Me)GSVSEIQLMHNLGKHLNSMERVEW LRKKLQDVHK(γE-(miniPEG)2-γE-COC16H32CO2H)-OH (SEQ ID NO:53), wherein k is d-Lys; γE is the l-isomer of gamma, glutamic acid; 25 (miniPEG)2 is COCH2OCH2CH2OCH2CH2NH; COC16H32CO2H is C18 diacid; (N-Me)G is sarcosine; K is l-isomer of lysine; and -OH designates the C-terminal amino acid has a terminal carboxylic acid. 30 If -D- is a peptide or protein drug moiety, -L1- is either conjugated to a functional group of aside chain of an amino acid residue of -D-, to the N-terminal amine functional group or to the C-terminal carboxyl functional group of -D- or to a nitrogen atom in the backbone chain of -D-.Ascendis Pharma A / S 134 CPX75149PC09 July 2025If -D- is a peptide or protein drug moiety, -L1- is in certain embodiments conjugated to afunctional group of -D- selected from the group consisting of carboxylic acid, primary amine,secondary amine, maleimide, thiol, sulfonic acid, carbonate, carbamate, hydroxyl, aldehyde, ketone, hydrazine, isocyanate, isothiocyanate, phosphoric acid, phosphonic acid, haloacetyl, 5 alkyl halide, acryloyl, aryl fluoride, hydroxylamine, sulfate, disulfide, vinyl sulfone, vinyl ketone, diazoalkane, oxirane, guanidine and aziridine. If -D- is a peptide or protein drugmoiety, -L1- is in certain embodiments conjugated to a functional group of -D- selected fromthe group consisting of hydroxyl, primary amine, secondary amine and guanidine. If -D- is apeptide or protein drug moiety, -L1- is in certain embodiments conjugated to a functional group10 of -D- selected from the group consisting of primary amine and secondary amine. If -D- is apeptide or protein drug moiety, -L1- is in certain embodiments conjugated to a primary amineof -D-. If -D- is a peptide or protein drug moiety, -L1- may be conjugated to a functional group of the15 side chain of an amino acid residue of -D-, which may be a proteinogenic amino acid residue or a non-proteinogenic amino acid residue. If -D- is a peptide or protein drug moiety, -L1- is in certain embodiments conjugated to afunctional group of the side chain of a proteinogenic amino acid residue of -D-. In certain 20 embodiments such amino acid residue is selected from the group consisting of histidine, lysine, tryptophan, serine, threonine, tyrosine, aspartic acid, glutamic acid and arginine. In certain embodiments such amino acid residue is selected from the group consisting of lysine, aspartic acid, arginine and serine. In certain embodiments such amino acid residue is selected from the group consisting of lysine, arginine and serine. 25 If -D- is a peptide or protein drug moiety, -L1- is in certain embodiments conjugated to afunctional group of a lysine residue of -D-. If -D- is a peptide or protein drug moiety, -L1- is incertain embodiments conjugated to a functional group of a histidine residue of -D-. If -D- is apeptide or protein drug moiety, -L1- is in certain embodiments conjugated to a functional group30 of a tryptophan residue of -D-. If -D- is a peptide or protein drug moiety, -L1- is in certainembodiments conjugated to a functional group of a serine residue of -D-. If -D- is a peptide orprotein drug moiety, -L1- is in certain embodiments conjugated to a functional group of athreonine residue of -D-. If -D- is a peptide or protein drug moiety, -L1- is in certainembodiments conjugated to a functional group of a tyrosine residue of -D-. If -D- is a peptideAscendis Pharma A / S 135 CPX75149PC09 July 2025or protein drug moiety, -L1- is in certain embodiments conjugated to a functional group of anaspartic acid residue of -D-. If -D- is a peptide or protein drug moiety, -L1- is in certainembodiments conjugated to a functional group of a glutamic acid residue of -D-. If -D- is apeptide or protein drug moiety, -L1- is in certain embodiments conjugated to a functional group5 of an arginine residue of -D-. If -D- is a peptide or protein drug moiety, -L1- is in certain embodiments conjugated to afunctional group of the side chain of a non-proteinogenic amino acid residue of -D-.10 It is understood that not every peptide or protein drug moiety -D- may comprise all of theseamino acid residues. If -D- is a peptide or protein drug moiety, -L1- is in certain embodiments conjugated to the N-terminal amine functional group of -D-. 15 If -D- is a peptide or protein drug moiety, -L1- is in certain embodiments conjugated to the C-terminal functional group of -D-. The moiety -L1- may be connected to -D- through any type of linkage, provided that it is20 reversible. In certain embodiments -L1- is connected to -D- through a linkage selected from thegroup consisting of amide, ester, carbamate, acetal, aminal, imine, oxime, hydrazone, disulfide and acylguanidine. In certain embodiments -L1- is connected to -D- through a linkage selectedfrom the group consisting of amide, ester, carbamate and acylguanidin. It is understood that some of these linkages per se are not reversible, but that in the present invention neighboring25 groups present in -L1- render these linkages reversible.In certain embodiments -L1- is connected to -D- through an amide linkage. In certainembodiments -L1- is connected to -D- through a carbamate linkage. In certainembodiments -L1- is connected to -D- through an ester linkage. In certain embodiments -L1- is30 connected to -D- through an acylguanidine linkage.In certain embodiments the reagent of formula (a) has the structure of (x-1)Ascendis Pharma A / S 136 CPX75149PC09 July 2025 wherein n ranges from 2 to about 500. 5 In certain embodiments n of formula (x-1) ranges from about 23 to about 220. In certain embodiments n of formula (x-1) is 2. In certain embodiments n of formula (x-1) is about 23. In certain embodiments n of formula (x-1) is about 79. In certain embodiments n of formula (x- 1) is about 108. In certain embodiments n of formula (x-1) is about 220. 10 In certain embodiments the reagent of formula (a) has the structure of (x-2) wherein n ranges from 2 to about 500. 15 In certain embodiments n of formula (x-2) ranges from about 23 to about 220. In certain embodiments n of formula (x-2) is 2. In certain embodiments n of formula (x-2) is about 23. In certain embodiments n of formula (x-2) is about 79. In certain embodiments n of formula (x- 2) is about 108. In certain embodiments n of formula (x-2) is about 220. 20 The invention is further described by the following non-limiting items. 1. A reagent of formula (Ia)(Ia), wherein 25 -AB1is an albumin-binding moiety; -L2- is spacer moiety comprising a polymeric moiety; and-FG is a functional group.Ascendis Pharma A / S 137 CPX75149PC09 July 20252. The reagent of item 1, wherein -FG is of formula (y-1).3. The reagent of item 1, wherein -FG is of formula (y-2).4. The reagent of item 1, wherein -FG is of formula (y-3).5. The reagent of item 1, wherein -FG is of formula (y-4).5 6. The reagent of item 1, wherein -FG is of formula (y-5).7. The reagent of item 1, wherein -FG is of formula (y-6).8. The reagent of item 1, wherein -FG is of formula (y-7).9. The reagent of item 1, wherein -FG is of formula (y-8).10. The reagent of item 1, wherein -FG is of formula (y-9).10 11. The reagent of item 1, wherein -FG is of formula (y-10).12. The reagent of item 1, wherein -FG is of formula (y-11).13. The reagent of item 1, wherein -FG is of formula (y-12).14. The reagent of item 1, wherein -FG is of formula (y-13).15. The reagent of item 1, wherein -FG is of formula (y-14).15 16. The reagent of item 1, wherein -FG is of formula (y-15).17. The reagent of item 1, wherein -FG is of formula (y-16).18. The reagent of item 1, wherein -FG is of formula (y-17).19. The reagent of item 1, wherein -FG is of formula (y-18).20. The reagent of item 1, wherein -FG is of formula (y-19).20 21. The reagent of item 1, wherein -FG is of formula (y-20).22. The reagent of item 1, wherein -FG is of formula (y-21).23. The reagent of item 1, wherein -FG is of formula (y-22).24. The reagent of item 1, wherein -FG is of formula (y-23).25. The reagent of item 1, wherein -FG is of formula (y-24).25 26. The reagent of item 1, wherein -FG is of formula (y-25).27. The reagent of item 1, wherein -FG is of formula (y-26).28. The reagent of item 1, wherein -FG is of formula (y-27).29. The reagent of item 1, wherein -FG is of formula (y-28).30. The reagent of item 1, wherein -FG is of formula (y-29).30 31. The reagent of item 1, wherein -FG is of formula (y-30).32. The reagent of item 1, wherein -FG is of formula (y-31).33. The reagent of item 1, wherein -FG is of formula (y-32).34. The reagent of item 1, wherein -FG is of formula (y-33).35. The reagent of item 1, wherein -FG is of formula (y-34).Ascendis Pharma A / S 138 CPX75149PC09 July 202536. The reagent of item 1, wherein -FG is of formula (y-35).37. The reagent of item 1, wherein -FG is of formula (y-36).38. The reagent of item 1, wherein -FG is of formula (y-37).39. The reagent of item 1, wherein -FG is of formula (y-38).5 40. The reagent of item 1, wherein -FG is of formula (y-39).41. The reagent of item 1, wherein -FG is of formula (y-40).42. The reagent of item 1, wherein -FG is of formula (y-41).43. The reagent of item 1, wherein -FG is of formula (y-42).44. The reagent of item 1, wherein -FG is of formula (y-43).10 45. The reagent of item 1, wherein -FG is of formula (y-44).46. The reagent of item 1, wherein -FG is of formula (y-45).47. The reagent of item 1, wherein -FG is of formula (y-46).48. The reagent of item 1, wherein -FG is of formula (y-47).49. The reagent of item 1, wherein -FG is of formula (y-48).15 50. The reagent of item 1, wherein -FG is of formula (y-49).51. The reagent of item 1, wherein -FG is of formula (y-50).52. The reagent of item 1, wherein -FG is of formula (y-51).53. The reagent of item 1, wherein -FG is of formula (y-52).54. The reagent of item 1, wherein -FG is of formula (y-53).20 55. The reagent of item 1, wherein -FG is of formula (y-54).56. The reagent of item 1, wherein -FG is of formula (y-55).57. The reagent of item 1, wherein -FG is of formula (y-56).58. The reagent of item 1, wherein -FG is of formula (y-57).59. The reagent of item 1, wherein -FG is of formula (y-58).25 60. The reagent of item 1, wherein -FG is of formula (y-59).61. The reagent of item 1, wherein -FG is of formula (y-60).62. The reagent of item 1, wherein -FG is of formula (y-61).63. The reagent of item 1, wherein -FG is of formula (y-62).64. The reagent of item 1, wherein -FG is of formula (y-63).30 65. The reagent of item 1, wherein -FG is of formula (y-64).66. The reagent of item 1, wherein -FG is of formula (y-65).67. The reagent of item 1, wherein -FG is of formula (y-66).68. The reagent of item 1, wherein -FG is of formula (y-67).69. The reagent of item 1, wherein -FG is of formula (y-68).Ascendis Pharma A / S 139 CPX75149PC09 July 202570. The reagent of item 1, wherein -FG is of formula (y-69).71. The reagent of item 1, wherein -FG is of formula (y-70).72. The reagent of item 1, wherein -FG is of formula (y-71).73. The reagent of item 1, wherein -FG is of formula (y-72).5 74. The reagent of item 1, wherein -FG is of formula (y-73).75. The reagent of item 1, wherein -FG is of formula (y-74).76. The reagent of item 1, wherein -FG is of formula (y-75).77. The reagent of item 1, wherein -FG is of formula (y-76).78. The reagent of item 1, wherein -FG is of formula (y-77).10 79. The reagent of item 1, wherein -FG is of formula (y-78).80. The reagent of item 1, wherein -FG is of formula (y-79).81. The reagent of item 1, wherein -FG is of formula (y-80).82. The reagent of item 1, wherein -FG is of formula (y-81).83. The reagent of item 1, wherein -FG is of formula (y-82).15 84. The reagent of item 1, wherein -FG is of formula (y-83).85. The reagent of item 1, wherein -FG is of formula (y-84).86. The reagent of item 1, wherein -FG is of formula (y-85).87. The reagent of item 1, wherein -FG is of formula (y-86).88. The reagent of item 1, wherein -FG is of formula (y-87).20 89. The reagent of item 1, wherein -FG is of formula (y-88).90. The reagent of any one of items 2, 4 to 6, 11, 28 to 34, 42 to 45, 65, 68, 69, 76, 78, 80,82 to 84 or 86, wherein -R08is halogen. 91. The reagent of any one of items 2, 4 to 6, 11, 28 to 34, 42 to 45, 65, 68, 69, 76, 78, 80,82 to 84 or 86, wherein -R08is -H.25 92. The reagent of any one of items 2, 4 to 6, 11, 28 to 34, 42 to 45, 65, 68, 69, 76, 78, 80,82 to 84 or 86, wherein -R08 is -CN.93. The reagent of any one of items 2, 4 to 6, 11, 28 to 34, 42 to 45, 65, 68, 69, 76, 78, 80,82 to 84 or 86, wherein -R08is methyl. 94. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein both -R08 and -R08a30 are halogen. 95. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein both -R08 and -R08aare -H. 96. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein both -R08 and -R08aare -CN.Ascendis Pharma A / S 140 CPX75149PC09 July 202597. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein both -R08 and -R08aare methyl. 98. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is halogenand -R08ais -H. 599. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is halogenand -R08ais -CN. 100. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is halogenand -R08ais methyl. 101. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is -H and -R08a10 is halogen. 102. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is -H and -R08ais -CN. 103. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is -H and -R08ais methyl.15 104. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is -CN and -R08ais halogen. 105. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is -CN and -R08ais -H. 106. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is -CN and -R08a20 is methyl. 107. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is methyland -R08ais halogen. 108. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is methyland -R08ais -H.25 109. The reagent of any one of items 7, 14, 15, 27, 46, 47 or 85, wherein -R08 is methyland -R08ais -CN. 110. The reagent of item 48, wherein -R08, -R08a and -R08b are halogen.111. The reagent of item 48, wherein -R08, -R08a and -R08b are -H.112. The reagent of item 48, wherein -R08, -R08a and -R08b are -CN.30 113. The reagent of item 48, wherein -R08, -R08a and -R08b are methyl.114. The reagent of any one of items 12, 36 or 41, wherein -Y01 is -F.115. The reagent of any one of items 12, 36 or 41, wherein -Y01 is -Cl.116. The reagent of any one of items 12, 36 or 41, wherein -Y01 is -Br.117. The reagent of any one of items 12, 36 or 41, wherein -Y01 is -I.Ascendis Pharma A / S 141 CPX75149PC09 July 2025118. The reagent of item 30, wherein -R08 is halogen and -Y01 is -F.119. The reagent of item 30, wherein -R08 is halogen and -Y01 is -Cl.120. The reagent of item 30, wherein -R08 is halogen and -Y01 is -Br.121. The reagent of item 30, wherein -R08 is halogen and -Y01 is -I.5 122. The reagent of item 30, wherein -R08 is -H and -Y01 is -F.123. The reagent of item 30, wherein -R08 is -H and -Y01 is -Cl.124. The reagent of item 30, wherein -R08 is -H and -Y01 is -Br.125. The reagent of item 30, wherein -R08 is -H and -Y01 is -I.126. The reagent of item 30, wherein -R08 is -CN and -Y01 is -F.10 127. The reagent of item 30, wherein -R08 is -CN and -Y01 is -Cl.128. The reagent of item 30, wherein -R08 is -CN and -Y01 is -Br.129. The reagent of item 30, wherein -R08 is -CN and -Y01 is -I.130. The reagent of item 30, wherein -R08 is methyl and -Y01 is -F.131. The reagent of item 30, wherein -R08 is methyl and -Y01 is -Cl.15 132. The reagent of item 30, wherein -R08 is methyl and -Y01 is -Br.133. The reagent of item 30, wherein -R08 is methyl and -Y01 is -I.134. The reagent of any one of items 21, 34 or 40, wherein n is 1.135. The reagent of any one of items 21, 34 or 40, wherein n is 2.136. The reagent of any one of items 21, 34 or 40, wherein n is3.20 137. The reagent of any one of items 21, 34 or 40, wherein n is 4.138. The reagent of item 59, wherein -Y02 and -Y02a are both -H.139. The reagent of item 59, wherein -Y02 and -Y02a are both -Br.140. The reagent of item 59, wherein -Y02 is -H and -Y02a is -Br.141. The reagent of item 59, wherein -Y02 is -Br and -Y02a is -H.25 142. The reagent of item 70, wherein -Y03 and -Y03a are both -F.143. The reagent of item 70, wherein -Y03 and -Y03a are both -Cl.144. The reagent of item 70, wherein -Y03 and -Y03a are both -Br.145. The reagent of item 70, wherein -Y03 and -Y03a are both -I.146. The reagent of item 70, wherein -Y03 and -Y03a are both -OR.30 147. The reagent of item 70, wherein -Y03 and -Y03a are both -NR011R011a.148. The reagent of item 70, wherein -Y03 and -Y03a are both -SR011.149. The reagent of item 147, wherein -R011 and -R011a are both -H.150. The reagent of item 148, wherein -R011 is -H.151. The reagent of item 82, wherein -Y04- is -O-.Ascendis Pharma A / S 142 CPX75149PC09 July 2025152. The reagent of item 82, wherein -Y04- is -S-.153. The reagent of item 82, wherein -Y04- is -NR011-.154. The reagent of item 82, wherein -Y04- is -CR011R011a-.155. The reagent of item 153 or 154, wherein -R011- is -H.5 156. The reagent of item 154, wherein R011 and -R011a are both -H.157. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of atleast 3 kDa. 158. The reagent of any one of items 1 to 157, wherein -L2- has a molecular weight of atleast 3.5 kDa.10 159. The reagent of any one of items 1 to 158, wherein -L2- has a molecular weight of atleast 4 kDa. 160. The reagent of any one of items 1 to 159, wherein -L2- has a molecular weight of atleast 4.5 kDa. 161. The reagent of any one of items 1 to 160, wherein -L2- has a molecular weight of at15 least 5 kDa. 162. The reagent of any one of items 1 to 161, wherein -L2- has a molecular weight of lessthan 100 kDa. 163. The reagent of any one of items 1 to 162, wherein -L2- has a molecular weight of lessthan 80 kDa.20 164. The reagent of any one of items 1 to 163, wherein -L2- has a molecular weight of lessthan 60 kDa. 165. The reagent of any one of items 1 to 164, wherein -L2- has a molecular weight of lessthan 40 kDa. 166. The reagent of any one of items 1 to 165, wherein -L2- has a molecular weight of less25 than 30 kDa. 167. The reagent of any one of items 1 to 166, wherein -L2- has a molecular weight of lessthan 20 kDa. 168. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight rangingfrom 2 kDa to 60 kDa.30 169. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight rangingfrom 2.5 kDa to 50 kDa. 170. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight rangingfrom 3 kDa to 40 kDa.Ascendis Pharma A / S 143 CPX75149PC09 July 2025171. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight rangingfrom 4 kDa to 30 kDa. 172. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight rangingfrom 4.5 kDa to 20 kDa. 5173. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight rangingfrom 5 kDa to 15 kDa. 174. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about4 kDa. 175. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about10 5 kDa. 176. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about6 kDa. 177. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about7 kDa.15 178. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about8 kDa. 179. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about9 kDa. 180. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about20 10 kDa. 181. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about11 kDa. 182. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about12 kDa.25 183. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about13 kDa. 184. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about14 kDa. 185. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about30 15 kDa. 186. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about16 kDa. 187. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about17 kDa.Ascendis Pharma A / S 144 CPX75149PC09 July 2025188. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about18 kDa. 189. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about19 kDa. 5190. The reagent of any one of items 1 to 156, wherein -L2- has a molecular weight of about20 kDa. 191. The reagent of any one of items 1 to 156, wherein -L2- is of formula (B) wherein10 the unmarked dashed line indicates attachment to -FG, -L3-, -L5- or -L1-, respectively;the dashed line marked with the asterisk indicates attachment to -AB1; -POL- is a polymeric moiety; and-LD- and -LE- are independently absent or selected from the group consistingof -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-,15-S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl; wherein -T-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50alkynyl are optionally interrupted by one or more groups selected 20 from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; -Ry1and -Ry1aare independently of each other selected from the group consisting of -H, -T, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T, C1-50 alkyl, C2-50 25 alkenyl, and C2-50 alkynyl are optionally substituted with one or more -Ry2, which are the same or different, and wherein C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry4)-, -S(O)2N(Ry4)-, -S(O)N(Ry4)-, -S(O)2-, -S(O)-, -N(Ry4)S(O)2N(Ry4a)-, -S-, -N(Ry4)-, -OC(ORy4)(Ry4a)-,30 -N(Ry4)C(O)N(Ry4a)-, and -OC(O)N(Ry4)-; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-Ascendis Pharma A / S 145 CPX75149PC09 July 2025membered heteropolycyclyl; wherein each T is independently optionally substituted with one or more -Ry2, which are the same or different; each -Ry2is independently selected from the group consisting of halogen, -CN, oxo (=O), -COORy5, -ORy5, -C(O)Ry5, -C(O)N(Ry5Ry5a), -S(O)2N(Ry5Ry5a), 5 -S(O)N(Ry5Ry5a), -S(O)2Ry5, -S(O)Ry5, -N(Ry5)S(O)2N(Ry5aRy5b), -SRy5, -N(Ry5Ry5a), -NO2, -OC(O)Ry5, -N(Ry5)C(O)Ry5a, -N(Ry5)S(O)2Ry5a, -N(Ry5)S(O)Ry5a, -N(Ry5)C(O)ORy5a, -N(Ry5)C(O)N(Ry5aRy5b), -OC(O)N(Ry5Ry5a), and C1-6alkyl; wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different; and 10 each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently selected from the group consisting of -H, and C1-6 alkyl, wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different. 192. The reagent of item 191, wherein -LD- and -LE- are independently selected from thegroup consisting of -T-, -C(O)O-, -O-, -C(O)-, 15 -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50 alkyl, C2- 50alkenyl, and C2-50alkynyl; wherein -T-, C1-20alkyl, C2-20alkenyl, and C2-20alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-20alkyl, C2-20alkenyl, and C2-20alkynyl are optionally interrupted by one or 20 more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; -Ry1and -Ry1aare independently of each other selected from the group consisting of -H, -T, C1-10 alkyl, C2-10 alkenyl, and C2-10 alkynyl; wherein -T, C1-10 alkyl, C2-1025 alkenyl, and C2-10 alkynyl are optionally substituted with one or more -Ry2, which are the same or different, and wherein C1-10alkyl, C2-10alkenyl, and C2-10alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry4)-, -S(O)2N(Ry4)-, -S(O)N(Ry4)-, -S(O)2-, -S(O)-, -N(Ry4)S(O)2N(Ry4a)-, -S-, -N(Ry4)-, -OC(ORy4)(Ry4a)-, -N(Ry4)C(O)N(Ry4a)-,30 and -OC(O)N(Ry4)-; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-Ascendis Pharma A / S 146 CPX75149PC09 July 2025membered heteropolycyclyl; wherein each T is independently optionally substituted with one or more -Ry2, which are the same or different; -Ry2is selected from the group consisting of halogen, -CN, oxo (=O), -COORy5, -ORy5, -C(O)Ry5, -C(O)N(Ry5Ry5a), -S(O)2N(Ry5Ry5a), 5 -S(O)N(Ry5Ry5a), -S(O)2Ry5, -S(O)Ry5, -N(Ry5)S(O)2N(Ry5aRy5b), -SRy5, -N(Ry5Ry5a), -NO2, -OC(O)Ry5, -N(Ry5)C(O)Ry5a, -N(Ry5)S(O)2Ry5a, -N(Ry5)S(O)Ry5a, -N(Ry5)C(O)ORy5a, -N(Ry5)C(O)N(Ry5aRy5b), -OC(O)N(Ry5Ry5a), and C1-6 alkyl;wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different; and 10 each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently of each other selected from the group consisting of -H, and C1-6 alkyl; wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different. 193. The reagent of item 192 or 192, wherein -LD- and -LE- are independently selected fromthe group consisting of -T-, -C(O)O-, -O-, -C(O)-, 15 -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50 alkyl, C2-50alkenyl, and C2-50alkynyl; wherein -T-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally substituted with one or more -Ry2, which are the same or different and wherein C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally interrupted by one or 20 more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; -Ry1and -Ry1aare independently selected from the group consisting of -H, -T, C1-1025 alkyl, C2-10 alkenyl, and C2-10 alkynyl; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl; 30 each -Ry2is independently selected from the group consisting of halogen, and C1-6alkyl; and each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently of each other selected from the group consisting of -H, and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are the same or different.Ascendis Pharma A / S 147 CPX75149PC09 July 2025194. The reagent of any one of items 191 to 193, wherein are independently a C1-20 alkylchain, which is optionally interrupted by one or more groups independently selected from -C(O)-, -N(Ry1)-, -O-, -S-, -T- and -C(O)N(Ry1)-; and which C1-20 alkyl chain isoptionally substituted with one or more groups independently selected from 5 halogen, -OH, -T and -N(Ry1Ry1a); wherein -Ry1and -Ry1aare independently selected from the group consisting of H and C1-4alkyl and wherein T is selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to10-membered heterocyclyl, 8- to 11-membered heterobicyclyl, 8-to 30-memberedcarbopolycyclyl, and 8- to 30-membered heteropolycyclyl, which is optionally10 substituted with one or more oxo (=O) or halogen. 195. The reagent of any one of items 191 to 194, wherein -LD- and -LE- have independentlyof each other a molecular weight in the range of from 14 g / mol to 750 g / mol. 196. The reagent of any one of items 191 to 195, wherein LD- and -LE- independentlycomprise a moiety selected from15 Ascendis Pharma A / S 148 CPX75149PC09 July 2025 ; wherein 5 -R and -Raare independently of each other selected from the group consisting of -H, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, 2-methylbutyl, 2,2-dimethylpropyl, n-hexyl, 2-methylpentyl, 3-methylpentyl, 2,2- dimethylbutyl, 2,3-dimethylbutyl and 3,3-dimethylpropyl. 197. The reagent of any one of items 191 to 196, wherein -LD- and -LE- have independently10 a chain length of 1 to 20 atoms. 198. The reagent of any one of items 191 to 197, wherein -LD- and -LE- have independentlya chain length of 2 to 10 atoms.199. The reagent of any one of items 191 to 198, wherein -LD- is absent.200. The reagent of any one of items 191 to 198, wherein -LD- is -N(Ry1)-.15 201. The reagent of item 200, wherein -Ry1 is -H.202. The reagent of item 200, wherein -Ry1 is methyl.203. The reagent of item 200, wherein -Ry1 is ethyl.204. The reagent of item 200, wherein -Ry1 is propyl.Ascendis Pharma A / S 149 CPX75149PC09 July 2025205. The reagent of item 200, wherein -Ry1 is isopropyl.206. The reagent of any one of items 191 to 198, wherein -LD- is -C(O)-.207. The reagent of any one of 191 to 206, wherein -LE- is absent.208. The reagent of any one of 191 to 206, wherein -LE- is is of formula (B-a).5 209. The reagent of item 208, wherein d1 of formula (B-a) is 0.210. The reagent of item 208, wherein d1 of formula (B-a) is 1.211. The reagent of item 208, wherein d1 of formula (B-a) is 2.212. The reagent of item 208, wherein d1 of formula (B-a) is 3.213. The reagent of item 208, wherein d1 of formula (B-a) is 4.10 214. The reagent of item 208, wherein d1 of formula (B-a) is 5.215. The reagent of item 208, wherein d1 of formula (B-a) is 6.216. The reagent of item 208, wherein d1 of formula (B-a) is 7.217. The reagent of item 208, wherein d1 of formula (B-a) is 8.218. The reagent of item 208, wherein d1 of formula (B-a) is 9.15 219. The reagent of item 208, wherein d1 of formula (B-a) is 10.220. The reagent of item 208, wherein d1 of formula (B-a) is 11.221. The reagent of item 208, wherein d1 of formula (B-a) is 12.222. The reagent of item 208, wherein d1 of formula (B-a) is 13.223. The reagent of item 208, wherein d1 of formula (B-a) is 14.20 224. The reagent of item 208, wherein d1 of formula (B-a) is 15.225. The reagent of item 208, wherein d1 of formula (B-a) is 16.226. The reagent of item 208, wherein d1 of formula (B-a) is 17.227. The reagent of item 208, wherein d1 of formula (B-a) is 18.228. The reagent of item 208, wherein d1 of formula (B-a) is 19.25 229. The reagent of item 208, wherein d1 of formula (B-a) is 20.230. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 0.231. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 1.232. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 2.233. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 3.30 234. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 4.235. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 5.236. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 6.237. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 7.238. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 8.Ascendis Pharma A / S 150 CPX75149PC09 July 2025239. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 9.240. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 10.241. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 11.242. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 12.5 243. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 13.244. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 14.245. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 15.246. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 16.247. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 17.10 248. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 18.249. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 19.250. The reagent of any one of items 208 to 229, wherein d2 of formula (B-a) is 20.251. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e1).15 252. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e2). 253. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e3). 254. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula20 (e4). 255. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e5). 256. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e6).25 257. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e7). 258. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e8). 259. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula30 (e9). 260. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e10). 261. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e11).Ascendis Pharma A / S 151 CPX75149PC09 July 2025262. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e12). 263. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e13). 5264. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e14). 265. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e15). 266. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula10 (e16). 267. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e17). 268. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e18).15 269. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e19). 270. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e20). 271. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula20 (e21). 272. The reagent of any one of items 208 to 250, wherein -Z1- of formula (B-a) is of formula(e22). 273. The reagent of item 208, wherein -LE- is of formula (B-b).274. The reagent of item 273, wherein d1 of formula (B-b) is 0.25 275. The reagent of item 273, wherein d1 of formula (B-b) is 1.276. The reagent of item 273, wherein d1 of formula (B-b) is 2.277. The reagent of item 273, wherein d1 of formula (B-b) is 3.278. The reagent of item 273, wherein d1 of formula (B-b) is 4.279. The reagent of item 273, wherein d1 of formula (B-b) is 5.30 280. The reagent of item 273, wherein d1 of formula (B-b) is 6.281. The reagent of item 273, wherein d1 of formula (B-b) is 7.282. The reagent of item 273, wherein d1 of formula (B-b) is 8.283. The reagent of item 273, wherein d1 of formula (B-b) is 9.284. The reagent of item 273, wherein d1 of formula (B-b) is 10.Ascendis Pharma A / S 152 CPX75149PC09 July 2025285. The reagent of item 273, wherein d1 of formula (B-b) is 11.286. The reagent of item 273, wherein d1 of formula (B-b) is 12.287. The reagent of item 273, wherein d1 of formula (B-b) is 13.288. The reagent of item 273, wherein d1 of formula (B-b) is 14.5 289. The reagent of item 273, wherein d1 of formula (B-b) is 15.290. The reagent of item 273, wherein d1 of formula (B-b) is 16.291. The reagent of item 273, wherein d1 of formula (B-b) is 17.292. The reagent of item 273, wherein d1 of formula (B-b) is 18.293. The reagent of item 273, wherein d1 of formula (B-b) is 19.10 294. The reagent of item 273, wherein d1 of formula (B-b) is 20.295. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 0.296. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 1.297. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 2.298. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 3.15 299. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 4.300. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 5.301. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 6.302. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 7.303. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 8.20 304. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 9.305. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 10.306. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 11.307. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 12.308. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 13.25 309. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 14.310. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 15.311. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 16.312. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 17.313. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 18.30 314. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 19.315. The reagent of any one of items 273 to 294, wherein d2 of formula (B-b) is 20.316. The reagent of any one of items 273 to 315, wherein -R of formula (B-b) is -H.317. The reagent of any one of items 273 to 315, wherein -R of formula (B-b) is methyl.318. The reagent of any one of items 273 to 315, wherein -R of formula (B-b) is ethyl.Ascendis Pharma A / S 153 CPX75149PC09 July 2025319. The reagent of any one of items 273 to 315, wherein -R of formula (B-b) is propyl.320. The reagent of any one of items 273 to 315, wherein -R of formula (B-b) is isopropyl.321. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) is apolymeric moiety with a molecular weight of at least 3 kDa. 5322. The reagent of any one of items 191 to 321, wherein -POL- of formula (B) is apolymeric moiety with a molecular weight of at least 3.5 kDa. 323. The reagent of any one of items 191 to 322, wherein -POL- of formula (B) is apolymeric moiety with a molecular weight of at least 4 kDa. 324. The reagent of any one of items 191 to 323, wherein -POL- of formula (B) is a10 polymeric moiety with a molecular weight of at least 4.5 kDa. 325. The reagent of any one of items 191 to 324, wherein -POL- of formula (B) is apolymeric moiety with a molecular weight of at least 5 kDa. 326. The reagent of any one of items 191 to 325, wherein -POL- of formula (B) has amolecular weight of less than 100 kDa.15 327. The reagent of any one of items 191 to 326, wherein -POL- of formula (B) has amolecular weight of less than 80 kDa. 328. The reagent of any one of items 191 to 327, wherein -POL- of formula (B) has amolecular weight of less than 60 kDa. 329. The reagent of any one of items 191 to 328, wherein -POL- of formula (B) has a20 molecular weight of less than 40 kDa. 330. The reagent of any one of items 191 to 329, wherein -POL- of formula (B) has amolecular weight of less than 20 kDa. 331. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight ranging from 1 kDa to 80 kDa.25 332. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight ranging from 2 kDa to 60 kDa. 333. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight ranging from 2.5 kDa to 50 kDa. 334. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has a30 molecular weight ranging from 3 kDa to 40 kDa. 335. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight ranging from 4 kDa to 30 kDa. 336. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight ranging from 4.5 kDa to 20 kDa.Ascendis Pharma A / S 154 CPX75149PC09 July 2025337. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight ranging from 5 kDa to 15 kDa. 338. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 2 kDa. 5339. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 2.5 kDa. 340. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 3 kDa. 341. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has a10 molecular weight of about 3.5 kDa. 342. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 4 kDa. 343. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 4.5 kDa.15 344. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 5 kDa. 345. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 6 kDa. 346. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has a20 molecular weight of about 7 kDa. 347. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 8 kDa. 348. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 9 kDa.25 349. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 10 kDa. 350. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 11 kDa. 351. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has a30 molecular weight of about 12 kDa. 352. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 13 kDa. 353. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 14 kDa.Ascendis Pharma A / S 155 CPX75149PC09 July 2025354. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 15 kDa. 355. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 16 kDa. 5356. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 17 kDa. 357. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 18 kDa. 358. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has a10 molecular weight of about 19 kDa. 359. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) has amolecular weight of about 20 kDa. 360. The reagent of any one of items 191 to 359, wherein -POL- of formula (B) comprisesa polymer selected from the group consisting of poly(2-methacryloyl-oxyethyl 15 phosphoyl cholins), poly(acrylic acids), poly(acrylates), poly(acrylamides), poly(alkyloxy) polymers, poly(amides), poly(amidoamines), poly(amino acids), poly(anhydrides), poly(aspartamides), poly(butyric acids), poly(glycolic acids), polybutylene terephthalates, poly(caprolactones), poly(carbonates), poly(cyanoacrylates), poly(dimethylacrylamides), poly(esters), poly(ethylenes), 20 poly(ethyleneglycols), poly(ethylene oxides), poly(ethyl phosphates), poly(ethyloxazolines), poly(glycolic acids), poly(hydroxyethyl acrylates), poly(hydroxyethyl-oxazolines), poly(hydroxymethacrylates), poly(hydroxypropylmethacrylamides), poly(hydroxypropyl methacrylates), poly(hydroxypropyloxazolines), poly(iminocarbonates), poly(lactic acids), poly(lactic- 25 co-glycolic acids), poly(methacrylamides), poly(methacrylates), poly(methyloxazolines), poly(organophosphazenes), poly(ortho esters), poly(oxazolines), poly(propylene glycols), poly(siloxanes), poly(urethanes), poly(vinyl alcohols), poly(vinyl amines), poly(vinylmethylethers), poly(vinylpyrrolidones), silicones, celluloses, carbomethyl celluloses, hydroxypropyl methylcelluloses, chitins, 30 chitosans, dextrans, dextrins, gelatins, hyaluronic acids and derivatives, functionalized hyaluronic acids, alginate, mannans, pectins, rhamnogalacturonans, starches, hydroxyalkyl starches, hydroxyethyl starches and other carbohydrate-based polymers, xylans and copolymers thereof.Ascendis Pharma A / S 156 CPX75149PC09 July 2025361. The reagent of any one of items 191 to 360, wherein -POL- of formula (B) is a PEG-based polymer. 362. The reagent of any one of items 191 to 320, wherein -POL- of formula (B) is of formula(XII-i). 5363. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 3 kDa.364. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 3.5 kDa.365. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecular10 weight of -POL- is about 4 kDa.366. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 4.5 kDa.367. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 5 kDa.15 368. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 6 kDa.369. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 7 kDa.370. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecular20 weight of -POL- is about 8 kDa.371. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 9 kDa.372. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 10 kDa.25 373. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 11 kDa.374. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 12 kDa.375. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecular30 weight of -POL- is about 13 kDa.376. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 14 kDa.377. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 15 kDa.Ascendis Pharma A / S 157 CPX75149PC09 July 2025378. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 16 kDa.379. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 17 kDa.5 380. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 18 kDa.381. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecularweight of -POL- is about 19 kDa.382. The reagent of item 362, wherein y of formula (XII-i) is selected such that the molecular10 weight of -POL- is about 20 kDa.383. The reagent of item 362, wherein y of formula (XII-i) is an integer ranging from 68 to1000. 384. The reagent of item 362, wherein y of formula (XII-i) is an integer ranging from 79 to800.15 385. The reagent of item 362, wherein y of formula (XII-i) is an integer ranging from 90 to600. 386. The reagent of item 362, wherein y of formula (XII-i) is an integer ranging from 90 to600. 387. The reagent of item 362, wherein y of formula (XII-i) is an integer ranging from 102 to20 500. 388. The reagent of item 362, wherein y of formula (XII-i) is an integer ranging from 113 to450. 389. The reagent of any one of items 1 to 388, wherein -AB2 has the structure of formula(A) 25 wherein the dashed line indicates attachment to -D-; -F0is of formula (a-1) 30 wherein the dashed line indicates attachment to -LA-; -R0is selected from the group consisting of -CR1R1aR1b, -COOR1,Ascendis Pharma A / S 158 CPX75149PC09 July 2025and ; -R1, -R1aand -R1bare selected from the group consisting of -H, methyl, ethyl, propyl and isopropyl; n is 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24; 5-LA- is absent or is of formula (a-2) wherein the unmarked dashed line indicates attachment to -LB-; the dashed line marked with the asterisk indicates attachment to -F0;10 -Ra- is selected from the group consisting wherein the dashed line marked with the asterisk indicates attachment to -F0; the unmarked dashed line indicates attachment to the remainder of -LA- ; 15 m is an integer selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10 p is an integer selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10; -LB- is absent or is of formula (a-3) wherein 20 the unmarked dashed line indicates attachment to -D-; the dashed line marked with the asterisk indicates attachment to -LA; -Rd- is selected from the group consisting of C1-50 alkyl, C2-50 alkenyl and C2-50 alkynyl,wherein C1-50 alkyl, C2-50 alkenyl and C2-50 alkynyl may be substituted with one 25 or more -R1, which may be the same or different, and which C1-50 alkyl, C2-50 alkenyl or C2-50 alkynyl may be interrupted by one or more groups selected fromAscendis Pharma A / S 159 CPX75149PC09 July 2025the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(R2)-, -S(O)2N(R2)-, -S(O)N(R2)-, -S(O)2-, -S(O)-, -N(R2)S(O)2N(R2a)-, -S-, -N(R2)-, -OC(OR2)(R2a)-, -N(R2)C(O)N(R2a)-, and -OC(O)N(R2)-; 5each -T- is independently selected from the group consisting of phenyl, naphthyl,indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl,8- to 11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8-to 30-membered heteropolycyclyl; wherein each -T- may independently besubstituted with one or more -R1, which may be the same or different; 10 each -R1is independently selected from the group consisting of halogen, -CN, oxo (=O), -COOR3, -OR3, -C(O)R3, -C(O)N(R3R3a), -S(O)2N(R3R3a), -S(O)N(R3R3a), -S(O)2R3, -S(O)R3, -N(R3)S(O)2N(R3aR3b), -SR3,-N(R3R3a), -NO2, -OC(O)R3, -N(R3)C(O)R3a, -N(R3)S(O)2R3a, -N(R3)S(O)R3a, -N(R3)C(O)OR3a, -N(R3)C(O)N(R3aR3b), -OC(O)N(R3R3a), and C1-6 alkyl; 15 wherein C1-6 alkyl is optionally substituted with one or more halogen, which are the same or different; each -R2, -R2a, -R3, -R3aand -R3bis independently selected from the group consisting of -H, and C1-6 alkyl, wherein C1-6 alkyl may be substituted with one or more halogen, which may be the same or different; and 20-Re- is selected from the group consisting of -CH2-, . 390. The reagent of item 389, wherein -R0 of formula (a-1) is -COOR1.391. The reagent of item 389, wherein -R0 of formula (a-1) is -CR1R1aR1b.392. The reagent of item 389, wherein -R0 of formula 393. The reagent of item 389, wherein -R0 of formula 25 394. The reagent of any one of items 389 to 393, wherein -R1 of formula (a-1) is -H.395. The reagent of any one of items 389 to 393, wherein -R1 of formula (a-1) is methyl.396. The reagent of any one of items 389 to 393, wherein -R1 of formula (a-1) is ethyl.397. The reagent of any one of items 389 to 393, wherein -R1 of formula (a-1) is propyl.Ascendis Pharma A / S 160 CPX75149PC09 July 2025398. The reagent of any one of items 389 to 393, wherein -R1 of formula (a-1) is isopropyl.399. The reagent of any one of items 389, 390 or 392 to 399, wherein -R1a of formula (a-1)is -H. 400. The reagent of any one of items 389, 390 or 392 to 399, wherein -R1a of formula (a-1)5 is methyl. 401. The reagent of any one of items 389, 390 or 392 to 399, wherein -R1a of formula (a-1)is ethyl. 402. The reagent of any one of items 389, 390 or 392 to 399, wherein -R1a of formula (a-1)is propyl.10 403. The reagent of any of items 389, 390 or 392 to 399, wherein -R1a of formula (a-1) isisopropyl. 404. The reagent of any one of items 389, 390 or 392 to 404, wherein -R1b of formula (a-1)is -H. 405. The reagent of any one of items 389, 390 or 392 to 404, wherein -R1b of formula (a-1)15 is methyl. 406. The reagent of any one of items 389, 390 or 392 to 404, wherein -R1b of formula (a-1)is ethyl. 407. The reagent of any one of items 389, 390 or 392 to 404, wherein -R1b of formula (a-1)is propyl.20 408. The reagent of any one of items 389, 390 or 392 to 404, wherein -R1b of formula (a-1)is isopropyl. 409. The reagent of any one of items 389 to 408, wherein -LA- of formula (A) is of formula(a-2). 410. The reagent of any one of items 389 to 409, wherein -Ra- of formula 25 , wherein the unmarked dashed line indicates attachment to -LB- and the dashed linemarked with the asterisk indicates attachment to -F0. a 411. The reagent of any one of items 389 to 409, wherein -R - of formula (a-2) is, wherein the unmarked dashed line indicates attachment to -LB- and the dashed linemarked with the asterisk indicates attachment to -F0.30 412. The reagent of any one of items 389 to 411, wherein -Rb- of formula (a-2) is .Ascendis Pharma A / S 161 CPX75149PC09 July 2025413. The reagent of any one of items 389 to 411, wherein -Rb- of formula (a-2) is .414. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 1.415. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 2.416. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 3.5 417. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 4.418. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 5.419. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 6.420. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 7.421. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 8.10 422. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 9.423. The reagent of any one of items 389 to 413, wherein m of formula (a-2) is 10.424. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 1.425. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 2.426. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 3.15 427. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 4.428. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 5.429. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 6.430. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 7.431. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 8.20 432. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 9.433. The reagent of any one of items 389 to 423, wherein p of formula (a-2) is 10.434. The reagent of item 389 or 390, wherein -LA- of formula (A) is absent.435. The reagent of any one of items 389 to 434, wherein -LB- of formula (A) is of formula(a-3).25 436. The reagent of any one of items 389 to 435, wherein -Rc- of formula (a-3) is .437. The reagent of any one of items 389 to 435, wherein -Rc- of formula (a-3) is .438. The reagent of any one of items 389 to 437, wherein -Re- of formula (a-3) is -CH2-.O 439. The reagent of any one of items 389 to 437, wherein -Re- of formula (a-3) is.Ascendis Pharma A / S 162 CPX75149PC09 July 2025440. The reagent of any one of items 389 to 437, wherein -Re- of formula (a-3) is . 441. The reagent of any one of items 389 to 434, wherein -LB- of formula (A) is absent.442. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-4).5 443. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-5).444. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-6).445. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-7).446. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-8).447. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-9).10 448. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-10).449. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-11).450. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-12).451. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-13).452. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-14).15 453. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-15).454. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-16).455. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-17).456. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-18).457. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-19).20 458. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-20).459. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-21).460. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-22).461. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-23).462. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-24).25 463. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-25).464. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-26).465. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-27).466. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-28).467. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-29).30 468. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-30).469. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-31).470. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-32).Ascendis Pharma A / S 163 CPX75149PC09 July 2025471. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-33).472. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-34).473. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-35).474. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-36).5 475. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-37).476. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-38).477. The reagent of item 389, wherein -F0 of formula (A) is of formula (a-39).478. The reagent of any one of items 389 to 477, wherein both -LA- and -LB- of formula (A)are absent.10 479. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-40). 480. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-41). 481. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is of15 formula (a-42). 482. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-43). 483. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-44).20 484. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-45). 485. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-46). 486. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is of25 formula (a-47). 487. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-48). 488. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-49).30 489. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-50). 490. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-51).Ascendis Pharma A / S 164 CPX75149PC09 July 2025491. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-52). 492. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-53). 5493. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-54). 494. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-55). 495. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is of10 formula (a-56). 496. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-57). 497. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-58).15 498. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-59). 499. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is offormula (a-60). 500. The reagent of any one of items 389 or 442 to 477, wherein -LA- of formula (A) is of20 formula (a-61). 501. The reagent of any one of items 389...

Claims

Ascendis Pharma A / S 211 CPX75149PC09 July 2025Claims 1. A reagent of formula (Ia)(Ia), 5 wherein -AB1is an albumin-binding moiety; -L2- is spacer moiety comprising a polymeric moiety; and-FG is a functional group.10 2. The reagent of claim 1, wherein -AB1 is of formula (A):wherein the dashed line indicates attachment to -L2-; -F0is of formula (a-1) 15wherein the dashed line indicates attachment to -LA-; -R0is selected from the group consisting of -CR1R1aR1b, -COOR1,20 -R1, -R1aand -R1bare selected from the group consisting of -H, methyl, ethyl, propyl and isopropyl; n is 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24; -LA- is absent or is of formula (a-2)25 wherein the unmarked dashed line indicates attachment to -LB-; the dashed line marked with the asterisk indicates attachment to -F0;Ascendis Pharma A / S 212 CPX75149PC09 July 2025a-R - is selected from the group consisting of and ,wherein the dashed line marked with the asterisk indicates attachment to -F0; the unmarked dashed line indicates attachment to the remainder of -LA- ;5mis an integer selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10p is an integer selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10; -LB- is absent or is of formula (a-3)10 wherein the unmarked dashed line indicates attachment to -L2- or -D-;the dashed line marked with the asterisk indicates attachment to -LA;-Rd- is selected from the group consisting of C1-50 alkyl, C2-50 alkenyl or C2-5015 alkynyl, wherein C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl may be substituted with one or more -R1, which may be the same or different, and which C1-50alkyl, C2-50 alkenyl or C2-50 alkynyl may be interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(R2)-, -S(O)2N(R2)-, -S(O)N(R2)-, -S(O)2-, -S(O)-, 20 -N(R2)S(O)2N(R2a)-, -S-, -N(R2)-, -OC(OR2)(R2a)-, -N(R2)C(O)N(R2a)-, and -OC(O)N(R2)-; each -T- is independently selected from the group consisting of phenyl,naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-memberedheterocyclyl, 8- to 11-membered heterobicyclyl, 8-to 30-membered25 carbopolycyclyl, and 8- to 30-membered heteropolycyclyl; whereineach -T- may independently be substituted with one or more -R1, which may bethe same or different; each -R1is independently selected from the group consisting of halogen, -CN, oxo (=O), -COOR3, -OR3, -C(O)R3, -C(O)N(R3R3a), -S(O)2N(R3R3a), -S(O)N(Ascendis Pharma A / S 213 CPX75149PC09 July 2025R3R3a), -S(O)2R3, -S(O)R3, -N(R3)S(O)2N(R3aR3b), -SR3,-N(R3R3a), -NO2, -OC(O)R3, -N(R3)C(O)R3a, -N(R3)S(O)2R3a, -N(R3)S(O)R3a, -N(R3)C(O)OR3a, -N(R3)C(O)N(R3aR3b), -OC(O)N(R3R3a), and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are 5 the same or different; each -R2, -R2a, -R3, -R3aand -R3bis independently selected from the group consisting of -H, and C1-6alkyl, wherein C1-6alkyl may be substituted with one or more halogen, which may be the same or different; and -Re- is selected from the group consisting of -CH2-,. 10 3. The reagent of claim 1 or 2, wherein -FG is selected from the group consisting of15Ascendis Pharma A / S 214 CPX75149PC09 July 2025(y 2 5 (y (y 4Ascendis Pharma A / S 215 CPX75149PC09 July 20255Ascendis Pharma A / S 216 CPX75149PC09 July 20255wherein the dashed line indicates attachment to -L2-; each -R08, -R08aand -R08bis independently selected from the group consisting of 10 halogen, -H, -CN, -T0, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T0, C1-50 alkyl, C2-50alkenyl, and C2-50alkynyl are optionally substituted with one or more -R09, which are the same or different, and wherein C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally interrupted by one or more groups selected from the group15 consisting of -T0-, -C(O)O-, -O-, -C(O)-, -C(O)N(R010)-,-S(O)2N(R010)-, -S(O)N(R010)-, -S(O)2-, -S(O)-, -N(R010)S(O)2N(R010a)-, -S-, -N(R010)-, -OC(OR010)(R010a)-, -N(R010)C(O)N(R010a)-, and -OC(O)N(R010)-; each T0is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, andAscendis Pharma A / S 217 CPX75149PC09 July 20258- to 11-membered heterobicyclyl; wherein each T0 is independently optionallysubstituted with one or more -R09, which are the same or different; each -R09, -R010and -R010ais independently selected from the group consisting of -H and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more 5 halogen, which are the same or different; each -Y01is independently selected from the group consisting of -F, -Cl, -Br and -I; each n is independently 1, 2, 3 or 4; each -Y02and -Y02ais independently selected from the group consisting of -H and -Br; 10 each -Y03and -Y03ais independently selected from the group consisting of -F, -Cl, -Br, -I, -OR, -NR011R011aand -SR011; each -Y04- is independently selected from -O-, -S-, -NR011-, -CR011R011a-; andeach -R011and -R011ais independently selected from the group consisting of halogen, -H, -CN, -T0, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T0, 15 C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally substituted with one or more -R012, which are the same or different, and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T0-, -C(O)O-, -O-, -C(O)-, -C(O)N(R013)-, -S(O)2N(R013)-, -S(O)N(R013)-, -S(O)2-, -S(O)-, -N(R013)S(O)2N(R013a)-,20 -S-, -N(R013)-, -OC(OR013)(R013a)-, -N(R013)C(O)N(R013a)-, and -OC(O)N(R013)-; each T0is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, and8- to 11-membered heterobicyclyl; wherein each T0 is independently optionallysubstituted with one or more -R012, which are the same or different; and 25 each -R12, -R013and -R013ais independently selected from the group consisting of -H and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are the same or different.

4. The reagent of claim 3, wherein -FG is selected from the group consisting of formula30 (y-1), (y-2), (y-6) , (y-7), (y-8), (y-9), (y-16), (y-17), (y-18), (y-19), (y-21), (y-22), (y- 23), (y-24), (y-27), (y-30), (y-31), (y-32), (y-36), (y-38), (y-40), (y-45), (y-46), (y-47), (y-48), (y-50), (y-57), (y-58), (y-59), (y-61), (y-62), (y-64), (y-70), (y-71), (y-72), (y- 73), (y-74), (y-75), (y-76), (y-77), (y-78), (y-80), (y-81), (y-82), (y-83), (y-86), (y-87) and (y-89).Ascendis Pharma A / S 218 CPX75149PC09 July 20255. The reagent of claim 3 or 4, wherein -FG and / or -FG1 are of formula (y-89).

6. The reagent of any one of claims 1 to 5, wherein -L2- is of formula (B)5wherein the unmarked dashed line indicates attachment to -FG; the dashed line marked with the asterisk indicates attachment to -AB1; -POL- is a polymeric moiety; and10 -LD- and -LE- are independently absent or selected from the group consistingof -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry1)-, -S(O)2N(Ry1)-, -S(O)N(Ry1)-, -S(O)2-, -S(O)-, -N(Ry1)S(O)2N(Ry1a)-, -S-, -N(Ry1)-, -OC(ORy1)(Ry1a)-, -N(Ry1)C(O)N(Ry1a)-, -OC(O)N(Ry1)-, C1-50alkyl, C2-50alkenyl, and C2-50alkynyl; wherein -T-, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally substituted15with one or more -Ry2, which are the same or different and wherein C1-50 alkyl, C2-50 alkenyl, and C2-50alkynyl are optionally interrupted by one or more groups selected from the group consisting of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry3)-, -S(O)2N(Ry3)-, -S(O)N(Ry3)-, -S(O)2-, -S(O)-, -N(Ry3)S(O)2N(Ry3a)-, -S-, -N(Ry3)-, -OC(ORy3)(Ry3a)-, -N(Ry3)C(O)N(Ry3a)-, and -OC(O)N(Ry3)-; 20 -Ry1and -Ry1aare independently of each other selected from the group consisting of -H, -T, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl; wherein -T, C1-50 alkyl, C2-50 alkenyl, and C2-50 alkynyl are optionally substituted with one or more -Ry2, which are the same or different, and wherein C1-50alkyl, C2-50alkenyl, and C2-50alkynyl are optionally interrupted by one or more groups selected from the group consisting 25 of -T-, -C(O)O-, -O-, -C(O)-, -C(O)N(Ry4)-, -S(O)2N(Ry4)-, -S(O)N(Ry4)-, -S(O)2-, -S(O)-, -N(Ry4)S(O)2N(Ry4a)-, -S-, -N(Ry4)-, -OC(ORy4)(Ry4a)-, -N(Ry4)C(O)N(Ry4a)-, and -OC(O)N(Ry4)-; each T is independently selected from the group consisting of phenyl, naphthyl, indenyl, indanyl, tetralinyl, C3-10 cycloalkyl, 3- to 10-membered heterocyclyl, 8- to30 11-membered heterobicyclyl, 8-to 30-membered carbopolycyclyl, and 8- to 30-membered heteropolycyclyl; wherein each T is independently optionally substituted with one or more -Ry2, which are the same or different;Ascendis Pharma A / S 219 CPX75149PC09 July 2025each -Ry2is independently selected from the group consisting of halogen, -CN, oxo (=O), -COORy5, -ORy5, -C(O)Ry5, -C(O)N(Ry5Ry5a), -S(O)2N(Ry5Ry5a), -S(O)N(Ry5Ry5a), -S(O)2Ry5, -S(O)Ry5, -N(Ry5)S(O)2N(Ry5aRy5b), -SRy5, -N(Ry5Ry5a), -NO2, -OC(O)Ry5, -N(Ry5)C(O)Ry5a, -N(Ry5)S(O)2Ry5a, 5 -N(Ry5)S(O)Ry5a, -N(Ry5)C(O)ORy5a, -N(Ry5)C(O)N(Ry5aRy5b), -OC(O)N(Ry5Ry5a), and C1-6alkyl; wherein C1-6alkyl is optionally substituted with one or more halogen, which are the same or different; and each -Ry3, -Ry3a, -Ry4, -Ry4a, -Ry5, -Ry5aand -Ry5bis independently selected from the group consisting of -H, and C1-6 alkyl, wherein C1-6 alkyl is optionally substituted10 with one or more halogen, which are the same or different.

7. The reagent of any one of claims 1 to 6, wherein -L2- is of formula (XII-ii)wherein 15 the dashed line marked with the asterisk indicates attachment to -FG; the unmarked dashed line indicates attachment to -AB1; b is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15; c is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15; xranges from 2 to 1000;20 -R1and -R2are independent of each other selected from the group consisting of -H and C1-6alkyl.

8. The reagent of any one of claims 1 to 7, wherein the reagent has the structure of formula(x-1) 25wherein n ranges from 2 to about 500.Ascendis Pharma A / S 220 CPX75149PC09 July 20259. The reagent of any one of claims 1 to 7, wherein the reagent has the structure of formula(x-2)wherein 5 n ranges from 2 to about 500.

10. The reagent of claim 8 or 9, wherein n ranges from about 23 to about 220.

11. The reagent of any one of claims 8 to 10, wherein n is about 23.10 12. The reagent of any one of claims 8 to 10, wherein n is about 79.

13. The reagent of any one of claims 8 to 10, wherein n is about 108.15 14. The reagent of any one of claims 8 to 10, wherein n is about 220.

Images