Methods of differentiating and breeding fungal chemovars

Abstract

Embodiments of the invention disclosed herein relate to using novel marker-assisted breeding technology to detect and classify biosynthetic genes for producing novel, non-natural, fungal chemovars with specific alkaloid content and ratios, including cultivars, varieties, and lines. Embodiments herein also provide an exon-by-exon genetic modification system guided by the classification system, enabling the creation of non-naturally occurring biosynthetic genes by combining exons from multiple genotypes. The combined detection, classification, and customization of these genes facilitate a genotype-based classification system for psilocybincontaining mushrooms, offering medical value. Additionally, embodiments disclosed herein provide methods to produce kits of novel markers and the methodology to automate the alkaloid biosynthetic genotyping process through robotics.

Description

METHODS OF DIFFERENTIATING AND BREEDING FUNGAL CHEMO VARSTECHNICAL FIELD OF THE INVENTION

[0001] The invention disclosed herein relates generally to the fields of genetic technology and mycology. In particular, the embodiments of the invention relate to secondary metabolite biosynthetic genes, paralogs thereof, and uses thereof.BACKGROUND TO THE INVENTION

[0002] Fungi have been an integral part of human history for at least 7,000 years, with early Chinese civilizations referring to them as an “elixir of life” due to their perceived health benefits (A Brief History of Medicinal Mushrooms). Throughout history, fungi have been utilized for various purposes, including food, medicine, and spiritual rituals. In contemporary times, research has increasingly focused on the secondary metabolites produced by fungi, which possess significant bioactive properties. A prime example is penicillin, an antibiotic derived from the fungus Penicillium, which has profoundly impacted medical treatments by providing an effective means to combat bacterial infections.

[0003] Fungi are known to produce a diverse array of secondary metabolites such as terpenoids, alkaloids, nucleosides, non-protein amino acids, cyclic peptides, and sphingolipids. These compounds play critical roles in the survival and reproduction of fungi and exhibit a range of effects on humans and other organisms, from therapeutic to toxic (Chen et cd.. 2017). These bioactive molecules have been harnessed in various pharmaceutical applications, leading to the development of drugs that treat a myriad of conditions. Among the myriad of fungal families, the Hymenogastraceae family, particularly the genera Psilocybe and Panaeolus. has garnered significant attention due to their medicinal and psychoactive properties. These species are renowned for their production of alkaloid secondary metabolites, such as psilocybin, which have been the subject of extensive preclinical and clinical research. Recent movements in the United States to decriminalize these naturally occurring plant-based medicines acknowledge their historical use in various cultures for spiritual and medicinal purposes.

[0004] Psilocybin biosynthesis in these fungi involves a multi-step enzymatic pathway that converts the precursor L-tryptophan to psilocybin. The pathway includes several key enzymes: PsiD, which converts L-tryptophan to tryptamine and can also use 4-hydroxy-L-tryptophan as a substrate; PsiH, which hydroxylates tryptamine to 4-hydroxytryptamine; PsiK, which phosphorylates 4-hydroxytryptamine to norbaeocystin in the presence of ATP; and PsiM,which methylates norbaeocystin to produce baeocystin and further methylates baeocystin to form psilocybin (Fricke et al.. 2017) and aeruginascin. Additionally, the conversion of psilocybin to psilocin and its subsequent re-phosphorylation back to psilocybin by PsiK suggests a protective mechanism within the cell, ensuring the stability of the bioactive compound (Fricke et al., 2017).

[0005] Despite the detailed understanding of the psilocybin biosynthetic pathway, there is limited literature on the variability of bioactive molecule profiles within Psilocybe and Panaeolus fungi. This gap in knowledge hampers the ability to achieve specific therapeutic effects, treat particular conditions, or selectively include or exclude certain compounds based on their bioactivity. Additionally, it also hampers the ability to reproducibly cultivate and formulate natural medicines. There is a critical need for accurate methods to identify distinct psilocybin synthase genes and to determine the genotype of these genes in Hymenogastraceae fungi, particularly the Psilocybe and Panaeolus species. Such methods would enable the selective cultivation and breeding of specialized fungal strains with specific and reproducible alkaloid contents, concentrations, and ratios. Additionally, targeting other genes within fungal alkaloid biosynthesis for their function would further refine the production and optimization of these bioactive compounds. Embodiments of the invention disclosed herein provide methodologies for stabilizing botanical drug substances using novel primers.SUMMARY OF INVENTION

[0006] Embodiments of the invention disclosed herein relate to methods for analyzing a fungal cultivar for at least one alkaloid biosynthetic gene or paralog. In some embodiments, the methods include obtaining a nucleic acid sample from a fungal cultivar; amplifying the nucleic acid sample using at least one primer pair specific to a unique subsequence of an alkaloid gene or paralog to form an amplification product; and analyzing the amplification product to identify or quantify the gene or expression thereof.

[0007] In some embodiments, the alkaloid gene is selected from psilocybin biosynthesis genes PsiM, PsiD, PsiK, PsiTl, PsiT2, PsiL, or PsiH. In some embodiments, the at least one primer pair includes any of SEQ ID NOs: 001-081. In some embodiments, the amplifying is performed using qPCR, digital PCR, HRM, LAMP, CRISPR diagnostics, or next-generation sequencing. In some embodiments, the unique subsequence is in an exon or adjacent intronexon boundary.

[0008] In some embodiments, the method further includes sequencing the amplified product to detect variant alleles, including SNPs or indels. In some embodiments, multiple genes are analyzed simultaneously using multiplexed amplification. In some embodiments, the multiplexed amplification targets two or more of PsiM, PsiD, PsiK, PsiTl, PsiT2, PsiL, or PsiH.

[0009] In some embodiments, the fungal cultivar is of the genera Psilocybe or Panaeolus.

[0010] In some embodiments, the methods further include determining copy number variation or genetic stability across clonal generations.

[0011] In some embodiments, the methods further include selecting the cultivar for cultivation based on an alkaloid profile predictive of a therapeutic effect. In some embodiments, the therapeutic effect is chosen from anti-inflammatory, antioxidant, antidepressant, neuroprotective, anxiolytic, anti -addiction, analgesic, or gastroprotective effects. In some embodiments, the selecting is for a cultivar with reduced or increased psychoactivity while maintaining therapeutic effect.

[0012] In some embodiments, the amplification product is used as part of a quality control workflow to confirm genetic stability of the alkaloid biosynthetic region. In some embodiments, the workflow includes sequencing the region and comparing results to chemical assays of alkaloid yield.

[0013] In some embodiments, methods for producing a fungal cultivar by marker-assisted breeding are provided. In some embodiments the methods include analyzing parent cultivars using the methods and primers disclosed herein, selecting parents with desired genotypes, and breeding the selected parents to produce offspring. In some embodiments, the breeding includes inbreeding parents for homozygosity and phenotypic stability. In some embodiments, the breeding includes outcrossing parents with different alkaloid gene alleles to produce novel offspring profiles. In some embodiments, the breeding is selected from sibling crossing, backcrossing, three- or four-way crossing, selfing, or production of doubled haploids.

[0014] In some embodiments, the methods further include genotyping offspring using the method of claim 1 to verify inheritance of targeted genotypes. In some embodiments, the offspring have altered levels or ratios of norpsilocin, psilocybin, aeruginascin, norbaeocystin,or psilocin compared to the parents. In some embodiments, the offspring are selected for modified psychoactive properties based on alkaloid gene profiles. In some embodiments, the breeding improves medicinal efficacy or biomass stability of alkaloid production.

[0015] In some embodiments, kits including at least one primer specific to a unique subsequence of an alkaloid biosynthetic gene and instructions for its use in gene detection in a fungal cultivar are provided. In some embodiments, the at least one primer is selected from SEQ ID NOs: 001-081.

[0016] In some embodiments, an automated device for fungal cultivar analysis is provided. In some embodiments, the device includes a reaction chamber with primers, an amplification unit, and an analysis unit for gene identification or quantification. In some embodiments, the analysis unit performs qPCR, digital PCR, or sequencing. In some embodiments, the device further performs automated sample handling and precise thermal control. In some embodiments, the analysis is driven by Al for real-time genotype interpretation. In some embodiments, the device further includes a user interface to display results and provide cultivation or breeding recommendations.

[0017] In some embodiments, a computer-implemented method is provided, wherein the method includes receiving nucleic acid sequence data from a fungal sample, detecting alkaloid biosynthetic genes, classifying the fungal sample into genotypic groups, and generating a report of genotypic and phenotypic predictions. In some embodiments, the classification correlates genotype with alkaloid ratios, health biomarkers, or production stability. In some embodiments, the method suggests optimized breeding strategies based on genotype. In some embodiments, the method is implemented via a mobile or cloud-based application. In some embodiments, artificial intelligence (Al) uses machine learning models trained on one or more of the following: Genotype-phenotype datasets, Patient Outcome Data, Pharmacogenomic data, Microbiomic data, HRM melt profile sequences, and Amino acid substitution and translation. In some embodiments, the classification uses barcode clustering based on SEQ ID NOs: 001-081.BRIEF DESCRIPTION OF THE DRAWINGS

[0018] Figure l is a diagram illustrating the biosynthetic pathway that produces psilocybin, psilocin, and other major and minor tryptamines. This highlights the role of many key genes targeted in embodiments of the invention disclosed herein.

[0019] Figure 2 is a multi -gene genotyping report demonstrating an exemplary reduction in the practice of novel genotyping technology. The report shows both gene presence / absence reporting (qPCR Detection), as well as providing a genotypic classification (HRM Analyses)of that enzyme in the pathway. The exemplary genotypes shown represent the dikaryotic nature of fungi having two separate nuclei represented as a single numeric value that represents the genotypic cluster as determined through the composition and analyses of the exon-by-exon barcoding genotyping system disclosed herein.

[0020] Figure 3 is a diagram illustrating using exon-by-exon barcoding technology for targeting the SAM salvage cycle and the Adenine nucleotide pool regeneration system enzymes.DETAILS OF INVENTION:

[0021] Recent advances in genetic technologies provide new methods for breeding fungi to enhance or modify their production of specific secondary metabolites. Traditional breeding techniques have been supplemented with molecular approaches such as polymerase chain reaction (PCR), genetic engineering, and genome editing tools like CRISPR / Cas9. These technologies enable precise manipulation of fungal genomes, allowing for the targeted modification of genes involved in metabolite biosynthesis.

[0022] Embodiments of the invention disclosed herein provide novel exon-by-exon PCR- based approaches to selectively breed fungi for various tryptamine profiles. By targeting specific exons within the psilocybin biosynthetic pathway genes, these methods allow for the precise identification and amplification of genetic variants associated with desired metabolite profiles. This approach not only enhances the efficiency of breeding programs but also enables the development of fungal strains with tailored bioactive properties. Key enzymes involved in the psilocybin biosynthetic pathway, such as PsiD, PsiH, PsiK, PsiH, PsiL, PsiTl, PsiT2, and PsiM, can be targeted using this exon-by-exon PCR approach. By amplifying and sequencing specific exons, researchers can identify genetic variations that correlate with different metabolite profiles. This information can then be used to selectively breed fungi that produce higher concentrations of desired compounds or novel tryptamine derivatives.

[0023] In addition to PCR-based breeding, genetic engineering and genome editing technologies offer powerful tools for modifying fungal genomes. CRISPR / Cas9, for example, allows for precise, targeted modifications of DNA sequences, enabling the introduction of specific mutations or the insertion of new genetic material (Doudna and Charpentier, 2014). This technology can be used to enhance the production of psilocybin and other bioactive compounds by modifying key biosynthetic genes or regulatory elements. By combining PCR-based breeding with genetic engineering, it is possible to create fungal strains with optimized biosynthetic pathways. For instance, overexpression of PsiK or PsiM could increase the conversion of intermediate compounds to psilocybin, while knockout of competing pathways could redirect metabolic flux towards desired metabolites.

[0024] Several methodologies have been developed for the genetic engineering of fungi. These include transformation techniques such as Agrobacterium-mediated transformation, electroporation, and protoplast fusion. Each method has its advantages and limitations, and the choice of technique depends on the fungal species and the specific genetic modifications required. Agrobacterium-mediated transformation involves the use of the bacterium Agrobacterium tumefaciens to transfer DNA into fungal cells. This method is particularly effective for introducing large DNA constructs and has been successfully used in various fungal species (Michielse et al., 2005). Electroporation, on the other hand, uses an electrical field to increase cell membrane permeability, allowing DNA to enter the cell. This technique is efficient for smaller DNA fragments and is widely used in fungal transformation (Neumann et al., 1982). Protoplast fusion involves the fusion of fungal protoplasts (cells without cell walls) from different strains, allowing for the exchange of genetic material. This method can be used to create hybrid strains with desirable traits from both parent strains (Peberdy, 1991). By integrating these genetic engineering techniques with PCR-based breeding, it is possible to develop fungal strains with novel tryptamine profiles and enhanced bioactive properties.

[0025] The ability to selectively breed and genetically engineer fungi for specific tryptamine profiles has numerous applications in medicine, biotechnology, and pharmacology. Psilocybin, for instance, has shown promise in the treatment of various psychiatric disorders, including depression, anxiety, and post-traumatic stress disorder (PTSD) (Carhart-Harris et al., 2016). By developing fungal strains that produce higher concentrations of psilocybin or novel tryptamine derivatives, it is possible to create more effective and targeted therapies. Additionally, the production of other bioactive compounds can be optimized for therapeutic use. For example, enhancing the production of aeruginascin, a psilocybin derivative, could provide a novel treatment for neurological disorders. Moreover, the ability to manipulate fungal metabolite profiles opens up new possibilities for the development of natural product-based drugs with unique mechanisms of action.

[0026] The invention disclosed herein leverages advanced genetic technologies and methodologies to selectively breed and genetically engineer fungi for specific tryptamine profiles. By utilizing an exon-by-exon PCR-based approach, coupled with genetic engineeringand genome editing techniques, it is possible to develop fungal strains with tailored bioactive properties. These advancements hold significant potential for the development of novel therapies and natural product-based drugs, addressing a wide range of medical and biotechnological needs.

[0027] Basidiomycota, also known as club fungi, constitutes a diverse group of fungi integral to ecosystem functioning and human life. These fungi exhibit a wide array of bioactivities, including the production of deadly toxins and hallucinogens. Additionally, certain Basidiomycota species have been utilized as medicinal mushrooms for thousands of years due to their therapeutic properties. Examples of these basidiomycota psilocybin-producing species include the following list: Psilocybe cubensis, Psilocybe semilanceata, Psilocybe cyanescens, Psilocybe azurescens, Psilocybe tampanensis, Psilocybe mexicana, Psilocybe baeocystis, Psilocybe stuntzii, Psilocybe pelliculosa, Psilocybe weilii, Psilocybe caerulipes, Psilocybe hoogshagenii, Psilocybe zapotecorum, Psilocybe ovoideocystidiata, Psilocybe subaeruginosa, Psilocybe caerulescens, Psilocybe allenii, Psilocybe angulospora, Psilocybe aucklandii, Psilocybe bohemica, Psilocybe galindoi, Psilocybe hispanica, Psilocybe liniformans, Psilocybe meridionalis, Psilocybe muliercula, Psilocybe quebecensis, Psilocybe samuiensis, Psilocybe subcubensis, Psilocybe tampanensis, Gymnopilus aeruginosus, Gymnopilus luteofolius, Gymnopilus purpuratus, Gymnopilus junonius, Gymnopilus braendlei, Gymnopilus subpurpuratus, Panaeolus cyanescens, Panaeolus cambodginiensis, Panaeolus tropicalis, Panaeolus bisporus, Panaeolus subbalteatus, Pluteus salicinus, Pluteus cyanopus, Inocybe aeruginascens, Inocybe coelestium, Inocybe corydalina, Inocybe haemacta, Inocybe tricolor.

[0028] The medicinal use of mushrooms, particularly psilocybin-producing species, has a long history dating back thousands of years. These mushrooms are renowned for their medicinal, recreational, spiritual, religious, and psychoactive properties. The pharmacological utility of secondary metabolites produced by these mushrooms is of significant interest due to their potential medicinal benefits.

[0029] Secondary metabolites are compounds produced by organisms that are not directly involved in their growth, development, or reproduction. In the context of medicinal mushrooms, these metabolites often have potent pharmacological effects. Psilocybin, the primary psychoactive compound in certain mushroom species, is one such secondary metabolite. The pharmacological effects of psilocybin and other related compounds have been studied extensively for their potential therapeutic applications in treating conditions such as depression, anxiety, and PTSD.

[0030] The biosynthetic pathways leading to the production of secondary metabolites in mushrooms involve a series of enzymatic reactions. These pathways are encoded by protein coding sequences and are often regulated by specific genes, transcription factors, that encode the necessary enzymes to express the protein coding gene. Identifying genetic markers associated with these biosynthetic genes and promoter regions can provide valuable information for predicting and developing novel alkaloid profiles in different mushroom varieties. This knowledge can be utilized to enhance the production of desired metabolites and improve the therapeutic efficacy of psilocybin-producing mushrooms.

[0031] The medicinal benefits of tryptamine compounds found in psilocybin-containing species of mushrooms have garnered significant scientific interest, with recent studies emphasizing their therapeutic potential for depression and anxiety. Psilocybin and its related compounds such as psilocin, norbaeocystin, and aeruginascin have been shown to possess various pharmacological activities beneficial for other mental and physical health. Gotvaldova et al. (2022) highlighted the variability in tryptamine concentrations in wild mushrooms, noting the therapeutic implications and potential risks of overdose due to the naturally occurring variability. Venturella et al. (2021) reviewed the broad spectrum of health benefits offered by medicinal mushrooms, including their neuroprotective and antidepressant properties. Goel and Zilate (2022) conducted a systematic review on psilocybin, confirming its effectiveness in reducing depression and anxiety, especially in cancer-related psychological distress. Chue et al. (2022) discussed the potential entourage effect of aeruginascin, though limited data exist on its pharmacology compared to psilocybin. A review in The Meducator (2023) emphasized psilocybin’s ability to foster neural plasticity, aiding in the treatment of major depressive disorder, anxiety, PTSD, OCD, and addiction disorders. Finally, Shahar et al. (2024) observed more potent and prolonged effects on synaptic plasticity in mice for extracts of Psilocybe cubensis compared to chemically synthesized psilocybin. These studies collectively underscore the promising therapeutic applications of fungal derived psilocybin and related tryptamines, advocating for further research into their medicinal benefits.

[0032] In recent years, the understanding of psilocybin synthases and their biosynthetic pathways has advanced significantly, enabling the production of transgenic organisms capable of synthesizing psilocybin (Fricke, 2019 / 2020; Milne, 2020). While these enzymes have been characterized in various fungal species, the diversity of these enzymes within a single species, such as Psilocybe cubensis, remains largely unexplored. Furthermore, there are currently no tools available to identify or select for this diversity within species.

[0033] Embodiments of the invention disclosed herein relate to testing multiple regions within the synthase paralogs of Psilocybe cubensis and other psilocybin-producing species. It has been found that certain primer sets, targeting specific exonic regions, show different degrees of variation among cultivars. This indicates that some regions of the paralogs are more effective indicators of phylogeny within the species. While psilocybin synthase enzymes are critical for alkaloid bioaccumulation, other genomic regions also play significant roles, particularly those encoding enzymes responsible for upstream precursors such as 4-OH- tryptamine and L-tryptophan (Fricke, 2017; Fricke, 2019). Additionally, understanding the production of other bioactive compounds — including alkaloids, nucleosides, terpenoids, carbolines, and sterols — is essential for predicting the effects of a given fungus consistently and accurately.

[0034] The concept of the “entourage effect”, where various compounds interact to modulate effects, is gaining attention. Our technology allows for the design of specific entourage effects by selecting for various ratios of terminal alkaloids tailored to specific treatments. For instance, to minimize hallucinations while maintaining therapeutic effects, one could produce a fungal organism with a version of PsiM that does not convert norbaeocystin to psilocybin, resulting in psilocybin-free mushrooms. Alternatively, for a higher baeocystin- to-other-alkaloid ratio, genotypes of the PsiM gene family that produce the desired chemotype can be selected. Similarly, to achieve longer therapeutic effects, one could select for fungal organisms producing higher concentrations of carboline compounds known for monoamine oxidase inhibition.

[0035] The technology disclosed herein provides methodologies to analyze the diverse and variable psilocybin biosynthesis genes. Through the development of this genetic classification, genotyping and barcoding system disclosed within, one skilled in the art would be able to rapidly breed Psilocybe species mushrooms to provide novel and reproducible chemical profiles through genetic selection and optimization of the psilocybin biosynthesis pathway.

[0036] The paralog identification markers disclosed herein can be used by breeders to control synthase activities within their cultivars, dramatically increasing the speed of selective breeding. These markers can be implemented in high-throughput screening protocols such as qPCR, HRM, DGGE, and other amplicon-based methodologies. Additionally, these markers can aid in identifying and cloning novel synthase genes for transgenic biosynthetic production and can be used by governmental agencies to identify drug-producing cultivars in regions where such fungi are illegal.

[0037] To facilitate an understanding of the present invention, a number of terms and phrases are defined below:

[0038] The use of the article “a” or “an” is intended to include one or more.

[0039] As used herein, the term “fungus” refers to a unicellular fungus (e.g., monokaryotic fungi) and a plurality of diploid fungal cells that are largely differentiated into a colony (e.g., mycelium) or a structure that is present at any stage of fungus development Such structures include, but are not limited to, a spore, a hyphae, a mycelium, a mycorrhizae, a fruiting body, and a scolertia.

[0040] In some embodiments, the term “fungus” is used in its broadest sense to include, but not limited to, any species of the Division / Phylum Basidiomycota or more specifically of the Class Agaricomycetes.

[0041] In some embodiments, the term “fungus” refers to any fungal species in the family Hymenogastraceae, including, for example, but not limited to, the species Psilocybe cubensis, Psilocybe natalensis, Psilocybe semilanceata, Psiocybe fuscofulva, Psilocybe atrobrunnea, Psilocybe cyanescens, Psilocybe Serbia, Panaeolus acidus, Panaeolus acuminatus, Panaeolus affinis, Panaeolus africanus, Panaeolus albellus, Panaeolus albidocinereus, Panaeolus albovelutinus, Panaeolus alcis, Panaeolus alveolatus, Panaeolus annulatus, Panaeolus anomalus, Panaeolus antillarum, Panaeolus atomatus, Panaeolus atrobalteatus, Panaeolus bernicis, Panaeolus bisporus, Panaeolus bolombensis, Panaeolus bubalorum, Panaeolus cambodginiensis, Panaeolus campanulatus, Panaeolus campanuloides, Panaeolus castaneifolius, Panaeolus cinctulus, Panaeolus chlorocystis, Panaeolus cinereofuscus, Panaeolus clelandii, Panaeolus conicodiffractus, Panaeolus convexulus, Panaeolus cyanescens, Panaeolus deviellus, Panaeolus diffractus, Panaeolus digressus, Panaeolus eburneus, Panaeolus epimyces, Panaeolus expromptus, Panaeolus exsignatus, Panaeolus fimbriatus, Panaeolus fimicola, Panaeolus fimicoloides, Panaeolus fimiputris, Panaeolus foenisecii, Panaeolus fontinalis, Panaeolus fraxinophilus, Panaeolus georgii, Panaeolus gomphodes, Panaeolus goossensiae, Panaeolus griseofibrillosus, Panaeolus guttulatus, Panaeolus hippophilus, Panaeolus hygrophanus, Panaeolus hypomelas, Panaeolus incanus, Panaeolus indicus, Panaeolus intermedius, Panaeolus lentisporus, Panaeolus lerchenfeldii, Panaeolus leucophanes, Panaeolus lignicola, Panaeolus linnaeanus, Panaeolus longiguus, Panaeolus microsporus, Panaeolus moellerianus, Panaeolus niveus, Panaeolus obtusisporus, Panaeolus olivaceofuscus, Panaeolus ovatus, Panaeolus olivaceus, Panaeolus paludosus, Panaeoluspanaiensis, Panaeolus papilionaceus, Panaeolus pseudopapilionaceus, Panaeolus pumilus, Panaeolus pusillus, Panaeolus queletii, Panaeolus refellens, Panaeolus regis, Panaeolus remotus, Panaeolus remyi, Panaeolus reticulatus, Panaeolus retirugis, Panaeolus rubricaulis, Panaeolus rufus, Panaeolus semiglobatus, Panaeolus semilanceatus, Panaeolus semiovatus, Panaeolus sepulchralis, Panaeolus sphinctrinus, Panaeolus squamulosus, Panaeolus subbalteatus, Panaeolus subditus, Panaeolus subfirmus, Panaeolus teutonicus, Panaeolus texensis, Panaeolus tirunelveliensis, Panaeolus tropicalis, Panaeolus uliginicola, Panaeolus uliginosus, Panaeolus variabilis, Panaeolus venenosus, Panaeolus venezolanus, and Panaeolus westii.

[0042] As used herein, the term “spore” refers to a minute, typically one-celled, reproductive unit capable of giving rise to a new individual without sexual fusion, characteristic of lower plants, fungi, and protozoans. In some embodiments, the term “spore” refers to a monokaryotic single reproductive unit, as well as a cluster or collection of these reproductive units produced by a fruiting body.

[0043] As used herein, the term “hybrid” in reference to a spore, mycelium, or fruiting body produced as the result of controlled cross-breeding or genetic recombination as opposed to a non-hybrid spore produced as the result of natural hyphal interactions, as in a “hybrid fungus spore” produced by breeding methods of the present invention.

[0044] As used herein, terms “mycelium” and “hyphae” refer to a dikaryotic and monokaryotic rope-like structure produced after a spore germinates on an appropriate nutrient source.

[0045] As used herein, the terms, “carpophore”, “fruiting body”, and “sclerotia body” refer to a fungal structure produced by the mycelium above the level of substrate and below the level of substrate, respectively.

[0046] As used herein, the term “fungal tissue” includes differentiated and undifferentiated tissues of fungi including those present in mycelium, hyphae, fruiting bodies, sclerotia, spores and tumors, as well as cells in culture (e.g., single cells, protoplasts, embryos, callus, etc.). In some embodiments, fungal tissue is in fungi, in organ culture, tissue culture, or cell culture.

[0047] As used herein, the term “fungal part” refers to any anatomical structure or tissue of a fungus, including but not limited to spores (e.g., basidiospores or ascospores), hyphae, mycelial networks, stipes (stems), pilei (caps), lamellae or gills, tubes (in boletes or polypores), annuli (rings), volvae (cup-like remnants of universal veils), scales, cystidia, hymenial tissue,spores, and cells, as well as other fruiting-body components or vegetative structures such as cups, cups of apothecia, cortina, sclerotia, or agaricoid, boletoid, gasteroid, resupinate, coral, or perforate sporocarps. Fungal parts may be derived at any developmental stage (e.g. primordia, pinhead, mycelial mat, mature fruiting body).

[0048] As used herein, the term “line” refers to a nursery term to describe a group of individuals from similar parentage with similar traits.

[0049] As used herein, the term “cultivar” refers to an unvarying variety of fungus propagated by man using selective hybridization and maintained by vegetative propagation or by inbred spores.

[0050] As used herein, the term “fungal cultivar” is used in its broadest sense and includes but is not limited to any species of fungi that is cultivated.

[0051] As used herein, the term “psilocybin-producing species” is used in its broadest sense and includes, but is not limited to: Psilocybe cubensis, Psilocybe semilanceata, Psilocybe cyanescens, Psilocybe azurescens, Psilocybe tampanensis, Psilocybe natalensis, Psilocybe mexicana, Psilocybe baeocystis, Psilocybe stuntzii, Psilocybe pelliculosa, Psilocybe weilii, Psilocybe caerulipes, Psilocybe hoogshagenii, Psilocybe zapotecorum, Psilocybe ovoideocystidiata, Psilocybe subaeruginosa, Psilocybe caerulescens, Psilocybe allenii, Psilocybe angulospora, Psilocybe aucklandii, Psilocybe bohemica, Psilocybe galindoi, Psilocybe hispanica, Psilocybe liniformans, Psilocybe meridionalis, Psilocybe muliercula, Psilocybe quebecensis, Psilocybe samuiensis, Psilocybe subcubensis, Psilocybe tampanensis, Gymnopilus aeruginosus, Gymnopilus luteofolius, Gymnopilus purpuratus, Gymnopilus junonius, Gymnopilus braendlei, Gymnopilus subpurpuratus, Panaeolus cyanescens, Panaeolus cambodginiensis, Panaeolus tropicalis, Panaeolus bisporus, Panaeolus subbalteatus, Pluteus salicinus, Pluteus cyanopus, Inocybe aeruginascens, Inocybe coelestium, Inocybe corydalina, Inocybe haemacta, and Inocybe tricolor.

[0052] As used herein, the term “cultivated” in reference to a fungus includes any fungi or fungal part grown and maintained for use in food compositions or in nonfood compositions.

[0053] As used herein, the terms “variety” and “varietas” refer to a rank of taxa below subspecies but above form, for example, a fungi which retains most of the characteristics of the species, but differs in some way, such as tryptophan-, tryptamine- or serine-derived indolic metabolites (e.g., Psilocybin class, beta carboline class, ergotamine compounds, etc.).

[0054] As used herein, terms “psilocybin biosynthetic genes”, “psilocybin synthases”, “psilocin biosynthetic genes”, and “PsiCluster Genes” include, but are not limited to, one or more of the following genes: L-Tryptophan Decarboxylase (psiD) - [GenBank: AFS41869], 4- Hydroxytryptophan Synthase (psiK) - [GenBank: AFS41870], 4-Hydroxytryptophan Decarboxylase (psiM) - [GenBank: AFS41871], Norbaeocystin Methyltransferase (psiH) - [GenBank: AFS41872], Baeocystin Methyltransferase (psiG) - [GenBank: AFS41873], Cytochrome P450 Monooxygenase (psiP) - [GenBank: AFS41874], Monoamine Oxidase (psiQ) - [GenBank: AFS41875], Norbaeocystin Synthase (psiB) - [GenBank: AFS41876], Baeocystin Synthase (psiF) - [GenBank: AFS41877], Phosphorylase (psiT) - [GenBank: AFS41878], 4-Hydroxyindole Phosphotransferase (psiE) - [GenBank: AFS41879], 4- Hydroxytryptamine Phosphotransferase (psiC) - [GenBank: AFS41880], 4-Hydroxytryptamine Methyltransferase (psiN) - [GenBank: AFS41881], Norbaeocystin Reductase (psi A) - [GenBank: AFS41882], Baeocystin Reductase (psil) - [GenBank: AFS41883], Norbaeocystin Decarboxylase (psiJ) - [GenBank: AFS41884], Baeocystin Decarboxylase (psiR) - [GenBank: AFS41885], Hydroxylase (psiL) - [GenBank: AFS41886], Dehydrogenase (psiX) - [GenBank: AFS41887], Hydrolase (psiY) - [GenBank: AFS41888], Methyltransferase (psiZ) - [GenBank: AFS41889], Transporter 1 (PsiTl) - [GenBank: AFS41890], and / or Transporter 2 (PsiT2) - [GenBank: AFS41891],

[0055] As used herein, the terms “F -generation” and “filial generation” refers to any of the consecutive generations of cells, tissues or organisms after a biparental cross. The generation resulting from a mating of a biparental cross (i.e., parents) is the first filial generation (designated as “Fl”) in reference to a spore and its fungus, while that resulting from crossing of Fl individuals is the second filial generation (designated as “F2”) in reference to a spore and its fungus. For example, an F2 spore and a resulting fungus are produced by hyphal interaction of two Fl spores from the same fruiting body, while later F generations are produced from selfbreeding of the immediate prior generation.

[0056] As used herein, the term “germplasm” refers to any genetic material of fungus, plants, animals or other organisms containing functional units of heredity.

[0057] As used herein, the term “hybrid” refers to a spore and a fungus produced as the result of controlled hyphal interaction as opposed to a spore and a fungus produced as the result of natural hyphal interaction.

[0058] As used herein, the term “offspring” refers to a dikaryotic or monokaryotic stage fungus. It may refer to the fruit, mycelium, hyphae, and spore(s) tissue of the fungus.

[0059] As used herein, the terms “fungal breeding”, “selective hyphal interaction”, “selective mycelial interactions”, and “genome fusion” refer to techniques used in creating a hybrid fungal cultivar. In some embodiments, these include the use of chemical agents, such as snake venom, that would allow for more genetic recombination between the two fungal parents. In some embodiments, these include electrofusion of genomes using a current to force recombination. In some embodiments, these include heat stress treatment to force mutations or recombination. In some embodiments, these refer to UV light-induced mutations or recombinant fungus. In some embodiments these refer to using a separate organism, such as a pathogenic fungi like agrobacterium, to transform, mutate, or force recombination of a fungus with another fungus.

[0060] As used herein, the term “trait” refers to an observable and / or measurable characteristic of an organism, such as a trait of a fungus, for example, alkaloid production or fruiting body size.

[0061] As used herein, the terms “alkaloid”, “tryptamine-derived compound”, “serinederived compounds”, “indole” refer to specific bioactive alkaloids produced naturally by fungi in the Basidiomycota division. Such compounds include, but are not limited to: 4-HO- Tryptamine, psilocybin, psilocin, 4-HO-trimethyltryptamine, norpsilocin, 5-hydroxy tryptophan, Serotonin, N,N-dimethyl-L-tryptophan, baeocystin, norbaeocystin, aeruginascin, harmala, harmane, harmane tetrahydroharmine, cordysinin, beta carboline compounds and other related alkaloids through structure and / or function.

[0062] As used herein “psychoactive alkaloids” includes, but is not limited to, norbaeocystin, baeocystin, norpsilocin, psilocin, psilocybin, aeruginascin, and 4-HO-TMT. In some embodiments, beta-carbolines can be a psychoactive alkaloid.

[0063] As used herein, the terms “marker” and “DNA marker” and “molecular marker” in reference to a “selectable marker” refers to a physiological or morphological trait which is determined as marker for its own selection or for selection of other traits closely linked to that marker, for example, a gene or trait that associates with contaminant resistance, such as a marker, such as a DNA marker, including but not limited to, simple sequence repeat (SSR), single nucleotide polymorphism analysis (SNP), random amplified polymorphic DNA analysis (RAPID), amplified fragment length polymorphism analysis (AFLP), and the like that will linkphenotype information, provide a genomic map, for example, a fingerprint map, and chromosome location and / or map.

[0064] As used herein, the term “linkage group” refers to a group of two or more genetically or physically mapped loci with observed linkage to a trait, for example, one or more of a SSR, SNP, AFLP, and RAPD marker of the present invention that may map to alkaloid production.

[0065] As used herein, the term “selection” refers to the process of determining the relative alkaloid production of a fungal cultivar.

[0066] As used herein, the term “Alkaloid synthase genes” and “Alkaloid biosynthetic genes” refer to one or more of the following genes: Psilocybin biosynthesis genes, beta carbolines biosynthesis genes, ergotamine biosynthetic genes,

[0067] As used herein, the term “beta carboline biosynthesis genes” refers to the set of genes that encode for the biosynthesis of harmine, harmane, tetrahydroharmine, norharmane, peregrine, harmol, cordysinin C, cordysinin D, and other related beta-carboline compounds. These genes may include but are not limited to one or more of the following genes: kslA (MK991350), kslB (MK991351), kslC (MK991352), mca (MK991353), Fcsl (Q9L7T3), Fcs2 (Q9L7T4), and / or Fcs3 (Q9L7T5)

[0068] As used herein, the term “ergotamine biosynthesis genes” refers to genes responsible for the biosynthesis of ergotamine in fungus. In some embodiments, these genes include, but are not limited to, one or more of the following genes: easO (MT350122), easP (MT350123), IpsB (MT350124), IpsC (MT350125), and / or IpsD (MT350126).

[0069] As used herein, the term “introgress”, “introgression”, and “introgressing” refers to incorporating a genetic substance, such as germplasm, loci, allele, gene, DNA, and the like for introducing a trait into an organism, such as a fungus, a Hymenogastraceae cultivar and the like, for example, incorporating contaminant resistant germplasm into a previously contaminant susceptible fungal variety. In some embodiments, introgression refers to a breeding method for incorporating a genetic trait, such as contamination resistance, including compositions and methods for using QTL, DNA markers including, but not limited to, simple sequence repeat (SSR), single nucleotide polymorphism analysis (SNP), random amplified polymorphic DNA (RAPD), amplified fragment length polymorphism analysis (AFLP), DNA fingerprinting, and the like for incorporating or customizing alkaloid production germplasm into a fungal variety.

[0070] As used herein, the terms “quantitative trait locus” and “QTL” refer to a genomic region including a gene underlying a trait on which many genes act.

[0071] As used herein, the terms “simple sequence repeat” and “SSR” refer to short, tandem repeat nucleotide sequences that are useful as genetic markers, for example, microsatellite DNA is a highly polymorphic DNA marker composed of mononucleotides, dinucleotides, trinucleotides or tetra-nucleotides that are repeated in tandem arrays and distributed throughout the genome, such as CA (alternatively GT) dinucleotide repeats.

[0072] As used herein, the terms “single nucleotide polymorphism” and “SNP” refer to a single base difference between two DNA sequences.

[0073] As used herein, the terms “random amplified polymorphic DNA” and “RAPD” refer to a common technique for amplifying anonymous stretches of DNA using PCR with arbitrary primers, for example, using random PCR primers used to amplify genomic DNA to provide a pattern of bands, such that one pattern of bands is different between individuals in a population, such as between contamination resistant and contamination susceptible fungi or show germplasm differences between closely related fungi.

[0074] As used herein, the terms “restriction fragment length polymorphism” and “RFLP” refer to genetic variation between individuals such that DNA fragment sizes resulting from a difference in DNA sequence that affects the recognition sequence for restriction enzymes when cut by specific restriction enzymes. When a particular enzyme digests DNA, the fragment sizes will differ depending on the presence or absence of the proper recognition sequence for the enzyme. In some embodiments, polymorphic sequences that result in RFLPs are used as markers on both physical maps and genetic linkage maps. RFLPs can be caused by a change in at least one nucleotide at a cutting site.

[0075] As used herein, the terms “amplified fragment length polymorphism” and “AFLP” refer to a highly sensitive method for detecting polymorphisms in DNA. Following restriction enzyme digestion of DNA, a subset of DNA fragments is selected for PCR amplification and visualization.

[0076] As used herein, the term “DNA fingerprinting” refers to techniques for uniquely identifying an individual among a population based on one’s DNA. This type of method of isolating and visualizing sequences of DNA can show a unique pattern of DNA fragments revealed by Southern hybridization or by a polymerase chain reaction (PCR) analysis.

[0077] As used herein, the term “polymerase chain reaction” and “PCR” refer to the method of K. B. Mullis (U.S. Pat. Nos. 4,683,195 4,683,202, and 4,965,188, hereby incorporated by reference), which describe a method for increasing the concentration of a segment of a target sequence in a mixture of genomic DNA without cloning or purification. This process for amplifying the target sequence consists of introducing an excess of two oligonucleotide primers to the DNA mixture containing the desired target sequence, followed by a precise sequence of thermal cycling in the presence of a DNA polymerase. The two primers are complementary to their respective strands of the double stranded target sequence. To effect amplification, the mixture is denatured, and the primers then annealed to their complementary sequences within the target molecule. Following annealing, the primers are extended with a polymerase so as to form a new pair of complementary strands. The steps of denaturation, primer annealing, and polymerase extension can be repeated many times (i.e., denaturation, annealing and extension constitute one “cycle”; there can be numerous “cycles”) to obtain a high concentration of an amplified segment of the desired target sequence. The length of the amplified segment of the desired target sequence is determined by the relative positions of the primers with respect to each other, and therefore, this length is a controllable parameter. By virtue of the repeating aspect of the process, the method is referred to as the “polymerase chain reaction” (hereinafter “PCR”). Because the desired amplified segments of the target sequence become the predominant sequences (in terms of concentration) in the mixture, they are said to be “PCR amplified.”

[0078] As used herein, the term “primer” refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest or produced synthetically, which is capable of acting as a point of initiation of synthesis when placed under conditions in which synthesis of a primer extension product which is complementary to a nucleic acid strand is induced, (i.e., in the presence of nucleotides and an inducing agent such as DNA polymerase and at a suitable temperature and pH). In some embodiments, the primer is single stranded for maximum efficiency in amplification. In some embodiments. The primer is double stranded. In some embodiments, if the primer is double stranded, it is treated to separate the strands before being used to prepare extension products. In some embodiments, the primer is an oligodeoxyribonucleotide. In some embodiments, the primer is sufficiently long to prime the synthesis of extension products in the presence of the inducing agent. The exact lengths of the primers will depend on many factors, including temperature, source of primer and the use of the method.

[0079] As used herein, the terms “PCR product”, “PCR fragment”, and “amplification product” refer to the resultant mixture of compounds after two or more cycles of the PCR steps of denaturation, annealing and extension are complete. These terms encompass the case where there has been amplification of one or more segments of one or more target sequences.

[0080] As used herein, the term “gene” refers to a nucleic acid (e.g., DNA or RNA) sequence that comprises coding sequences for the production of RNA, or a polypeptide or its precursor (e.g., proinsulin). A functional polypeptide can be encoded by a full-length coding sequence or by any portion of the coding sequence as long as the desired activity or functional properties (e.g., enzymatic activity, ligand binding, signal transduction, etc.) of the polypeptide are retained. As used herein, the term “gene” encompasses the coding regions of a structural gene and includes sequences located adjacent to the coding region on both the 5' and 3' ends for a distance of about 1 kb on either end such that the gene corresponds to the length of the full-length mRNA.

[0081] As used herein, the term “portion” when used in reference to a gene refers to fragments of that gene. The fragments range in size from a few nucleotides to the entire gene sequence minus one nucleotide.

[0082] As used herein, the term “a nucleotide comprising at least a portion of a gene” refers to fragments of the gene or the entire gene.

[0083] As used herein, the terms “allele” and “alleles” refer to each version of a gene for a same locus that has more than one sequence. For example, there are multiple alleles for eye color at the same locus.

[0084] As used herein, the terms “recessive”, “recessive gene”, and “recessive phenotype” refer to an allele that has a phenotype when two alleles for a certain locus are the same as in “homozygous” or as in “homozygote”, and then partially or fully loses that phenotype when paired with a more dominant allele when two alleles for a certain locus are different as in “heterozygous” or in “heterozygote.”

[0085] As used herein, the terms “dominant”, and “dominant phenotype” refer to an allele that has an effect to suppress the expression of the other allele in a heterozygous (having one dominant and one recessive allele) condition.

[0086] As used herein, the term “heterologous” when used in reference to a gene or nucleic acid refers to a gene that has been manipulated in some way. For example, a heterologous gene includes a gene from one species introduced into another species. In some embodiments, aheterologous gene includes a gene native to an organism that has been altered in some way (e.g., mutated, added in multiple copies, linked to a non -native promoter or enhancer sequence, etc.). Examples of a heterologous gene include a gene encoding an insecticidal protein, an herbicide resistant protein, or for providing an agronomic trait. In some embodiments, heterologous genes include fungal gene sequences that comprise cDNA forms of a fungal gene; the cDNA sequences can be expressed in either a sense (to produce mRNA) or anti-sense orientation (to produce an anti-sense RNA transcript that is complementary to the mRNA transcript). Heterologous genes are distinguished from endogenous fungal genes in that the heterologous gene sequences are typically joined to nucleotide sequences comprising regulatory elements such as promoters that are not found naturally associated with the gene for the protein encoded by the heterologous gene or with plant gene sequences in the chromosome, or are associated with portions of the chromosome not found in nature (e.g., genes expressed in loci where the gene is not normally expressed).

[0087] As used herein, the terms “nucleic acid sequence”, “nucleotide sequence of interest” or “nucleic acid sequence of interest” refer to any nucleotide sequence (e.g., RNA or DNA), the manipulation of which is deemed desirable for any reason (e.g., treat disease, confer improved qualities, etc.), by one of ordinary skill in the art. Such nucleotide sequences include, but are not limited to, coding sequences of structural genes (e.g., reporter genes, selection marker genes, oncogenes, drug resistance genes, growth factors, etc.), and non-coding regulatory sequences which do not encode an mRNA or protein product (e.g., promoter sequence, polyadenylation sequence, termination sequence, enhancer sequence, etc.).

[0088] As used herein, the term “structural” when used in reference to a gene or to a nucleotide or nucleic acid sequence refers to a gene or a nucleotide or nucleic acid sequence whose ultimate expression product is a protein (such as an enzyme or a structural protein), an rRNA, an sRNA, a tRNA, etc.

[0089] As used herein, the term “cDNA” refers to a nucleotide copy of the “messenger RNA” or “mRNA” for a gene. In some embodiments, cDNA is derived from the mRNA. In some embodiments, cDNA is derived from genomic sequences.

[0090] As used herein, the term “oligonucleotide” refers to a molecule composed of two or more deoxyribonucleotides or ribonucleotides, or three or more, or four or more, or five or more, or six or more, or seven or more, or eight or more, or nine or more, or ten or more deoxyribonucleotides or ribonucleotides. The exact size will depend on many factors, which inturn depends on the ultimate function or use of the oligonucleotide. The oligonucleotide can be generated in any manner, including chemical synthesis, DNA replication, reverse transcription, or a combination thereof.

[0091] As used herein, the term “polynucleotide” refers to a molecule composed of several deoxyribonucleotides or ribonucleotides and is used interchangeably with “oligonucleotide.” In some embodiments, “oligonucleotide” refers to shorter lengths, and “polynucleotide” refers to longer lengths of nucleic acid sequences.

[0092] As used herein, the terms “an oligonucleotide having a nucleotide sequence encoding a gene” or “a nucleic acid sequence encoding a specified polypeptide” refer to a nucleic acid sequence comprising the coding region of a gene or, in other words, the nucleic acid sequence that encodes a gene product. The coding region can be present either in a cDNA, genomic DNA or RNA form. When present in a DNA form, the oligonucleotide can be singlestranded (i.e., the sense strand) or double-stranded. Suitable control elements such as enhancers / promoters, splice junctions, polyadenylation signals, etc. can be placed in close proximity to the coding region of the gene, if needed, to permit proper initiation of transcription and / or correct processing of the primary RNA transcript. Alternatively, the coding region utilized in the expression vectors of embodiments of the invention contain endogenous enhancers, exogenous promoters, splice junctions, intervening sequences, polyadenylation signals, etc. or a combination of both endogenous and exogenous control elements.

[0093] As used herein, the term “probe” refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest or produced synthetically, recombinantly or by PCR amplification, that is capable of hybridizing to another oligonucleotide of interest. A probe can be single-stranded or double-stranded. Probes are useful in the detection, identification, and isolation of particular gene sequences either specific to a single genotype or common to multiple genotypes. In some embodiments, it is contemplated that any probe used is labeled with any “reporter molecule”, so that it is detectable in any detection system, including, but not limited to, enzyme (e.g., ELISA, as well as enzyme-based histochemical assays), fluorescent, radioactive, and luminescent systems. The invention is not limited to any particular detection system or label.

[0094] As used herein, the term “expression” when used in reference to a nucleic acid sequence, such as a gene, refers to the process of converting genetic information encoded in a gene into RNA (e.g., mRNA, rRNA, tRNA, or snRNA) through “transcription” of the gene(i.e., via the enzymatic action of an RNA polymerase), and into protein where applicable (as when a gene encodes a protein), through “translation” of mRNA. Gene expression can be regulated at many stages in the process. “Up-regulation” or “activation” refers to regulation that increases the production of gene expression products (i.e., RNA or protein), while “downregulation” or “repression” refers to regulation that decreases production. Molecules (e.g., transcription factors) that are involved in up-regulation or down-regulation are often called “activators” and “repressors”, respectively.

[0095] As used herein, the term “transfection” refers to the introduction of foreign DNA into cells. In embodiments disclosed herein, transfection can be accomplished by a variety of means known to the art including calcium phosphate-DNA co-precipitation, DEAE-dextran- mediated transfection, polybrene-mediated transfection, glass beads, electroporation, microinjection, liposome fusion, lipofection, protoplast fusion, viral infection, biolistics (i.e., particle bombardment), Agrobacterium infection, and the like.

[0096] As used herein, the term “wild-type” when made in reference to a gene refers to a functional gene common throughout an outbred population. As used herein, the term “wildtype” when made in reference to a gene product refers to a functional gene product common throughout an outbred population. A functional wild-type gene is that which is most frequently observed in a population and is thus arbitrarily designated the “normal” or “wild-type” form of the gene.

[0097] As used herein, the terms “modified” or “mutant” when made in reference to a gene or to a gene product refers, respectively, to a gene or to a gene product that displays modifications in sequence and / or functional properties (i.e., altered characteristics) when compared to the wild-type gene or gene product. In some embodiments, the terms “variant” and “mutant” when used in reference to a nucleotide sequence refer to a nucleic acid sequence that differs by one or more nucleotides from another, usually related nucleotide sequence. A “variation” is a difference between two different nucleotide sequences; typically, one sequence is a reference sequence.

[0098] As used herein, the term “polymorphic locus” refers to a genetic locus present in a population that shows variation between members of the population (i.e., the most common allele has a frequency of less than 0.95). Thus, “polymorphism” refers to the existence of a character in two or more variant forms in a population. A “single nucleotide polymorphism” and “SNP” refers to a genetic locus of a single base that can be occupied by one of at least twodifferent nucleotides. In contrast, a “monomorphic locus” refers to a genetic locus at which little or no variations are seen between members of the population (generally taken to be a locus at which the most common allele exceeds a frequency of 0.95 in the gene pool of the population).

[0099] As used herein, the terms “protein”, “polypeptide”, “peptide”, “encoded product”, “amino acid sequence”, are used interchangeably to refer to compounds comprising amino acids joined via peptide bonds. A “protein” encoded by a gene is not limited to the amino acid sequence encoded by the gene, but includes post-translational modifications of the protein. Where the term “amino acid sequence” is recited herein to refer to an amino acid sequence of a protein molecule, the term “amino acid sequence” and like terms, such as “polypeptide” or “protein” are not meant to limit the amino acid sequence to the complete, native amino acid sequence associated with the recited protein molecule. Furthermore, an “amino acid sequence” can be deduced from the nucleic acid sequence encoding the protein. The deduced amino acid sequence from a coding nucleic acid sequence includes sequences which are derived from the deduced amino acid sequence and modified by post-translational processing, where modifications include, but are not limited to, glycosylation, hydroxylation, phosphorylation, and amino acid deletions, substitutions, and additions. Thus, an amino acid sequence comprising a deduced amino acid sequence is understood to include post-translational modifications of the encoded and deduced amino acid sequence.

[0100] As used herein, the term “isolated” when used in relation to a nucleic acid such as an isolated DNA molecule or polypeptide, as in “an isolated oligonucleotide” refers to a nucleic acid sequence that is identified and separated from at least one contaminant nucleic acid with which it is ordinarily associated in its natural source. An isolated nucleic acid is present in a form or setting that is different from that in which it is found in nature. In contrast, non-isolated nucleic acids, such as DNA and RNA, are found in the state they exist in nature. For example, a given DNA sequence (e.g., a gene) is found on the host cell chromosome in proximity to neighboring genes; RNA sequences, such as a specific mRNA sequence encoding a specific protein, are found in the cell as a mixture with numerous other mRNAs that encode a multitude of proteins. However, isolated nucleic acid encoding a particular protein includes, by way of example, such nucleic acid in cells ordinarily expressing the protein, where the nucleic acid is in a chromosomal location different from that of natural cells or is otherwise flanked by a different nucleic acid sequence than that found in nature. The isolated nucleic acid or oligonucleotide can be present in single-stranded or double-stranded form. When an isolatednucleic acid or oligonucleotide is to be utilized to express a protein, the oligonucleotide will contain, at a minimum, the sense or coding strand (i.e. the oligonucleotide may be singlestranded) but can contain both the sense and antisense strands (i.e., the oligonucleotide may be double-stranded).

[0101] As used herein, the term “purified” refers to molecules, either nucleic or amino acid sequences, that are removed from their natural environment, isolated, or separated. An “isolated nucleic acid sequence” is, therefore, a purified nucleic acid sequence. “Substantially purified” molecules are at least 60% free, or at least 65% free, or at least 70% free, or at least 75% free, or at least 80% free, or at least 85% free, or at least 90% free, or at least 95% free, or at least 98% free, or at least 99% free, or 100% free from other components with which they are naturally associated. As used herein, the term “purified” or “to purify” also refers to the removal of contaminants from a sample. The removal of contaminating proteins results in an increase in the percentage of the polypeptide of interest in the sample. In another example, recombinant polypeptides are expressed in plant, fungal, bacterial, yeast, or mammalian host cells, and the polypeptides are purified by the removal of host cell proteins; the percentage of recombinant polypeptides is thereby increased in the sample.

[0102] As used herein, the term “portion” when used in reference to a protein (as in “a portion of a given protein”) refers to fragments of that protein. In some embodiments, the fragments range in size from four amino acid residues to the entire amino sequence minus one amino acid.

[0103] As used herein, the term “medicinal effect” refers to a pharmacologically beneficial outcome produced by a fungal-derived tryptamine alkaloid — such as psilocin or its prodrug psilocybin — upon administration to a human or animal subject. Such effects encompass any positive therapeutic outcome that is reliably measurable and linked to the biochemical activity of the alkaloid, including but not limited to: amelioration of psychiatric disorders (e.g., depression, anxiety, post-traumatic stress disorder, end-of-life psychological distress); modulation of neuroinflammation or oxidative stress (e.g., antioxidant, anti-inflammatory, neuroprotective actions); neurogenic or neurotrophic effects (e.g., enhanced neuroplasticity, neurogenesis); analgesic or opioid-sparing outcomes in pain management; gastroprotective effects (e.g., mucosal regeneration, anti-inflammatory responses in the GI tract); anti-addiction or relapse-prevention activity; cognitive-enhancing effects (e.g., memory consolidation, executive function improvement); sedative or anxiolytic benefits; antimicrobial or antiviral activity.

[0104] As used herein, the term “positional cloning” refers to an identification of a gene based on its physical location in the genome.

[0105] As used herein, the term “other alkaloids” refers to the other alkaloids compounds present in a fungus than the compound in question. For example, the norbaeocystimother alkaloid ratio refers to the ratio of norbaeocystin to (the total alkaloid concentration - norbaeocystin concentration).

[0106] As used herein, the term “biosynthetic gene cluster” refers to a contiguous region of a genome comprising two or more functionally related genes that encode enzymes, transporters, and / or regulatory elements which collectively participate in the biosynthesis of a specific metabolite or class of metabolites. In some embodiments, the clusters are co-regulated and contribute to the metabolic profile of the organism.

[0107] As used herein, the term “PsilocybinEQ” refers to a normalized potency metric that quantifies the psychoactive potential of a sample based on the molar-equivalent contribution of alkaloids, including but not limited to, psilocybin, psilocin, norbaeocystin, baeocystin, and aeruginascin. This value enables comparison of total psychedelic activity across chemically diverse samples. This is calculated through the equation PsilocybinEQ = Psilocin * 1.391394 + Psilocybin.

[0108] As used herein, the term “PsilocinEQ” refers to a normalized potency metric that quantifies the psychoactive potential of a sample based on the molar-equivalent contribution of alkaloids, including but not limited to, psilocybin, psilocin, norbaeocystin, baeocystin, and aeruginascin. This value enables comparison of total psychedelic activity across chemically diverse samples. This is calculated through the equation PsilocybinEQ = Psilocin + Psilocybin.* 0.718783

[0109] As used herein, the term “barcoded exon” refers to an exon or exonic region that contains a unique nucleotide sequence identifier (natural or synthetic), enabling it to be distinguished, tracked, or quantified in multiplexed molecular analyses such as phylogenetics, isoform mapping, or synthetic lineage tracing.

[0110] As used herein, the term “expression assay” refers to a laboratory method for detecting and quantifying the expression level of one or more genes, typically by measuring mRNA or cDNA abundance using techniques such as quantitative PCR (qPCR), RNA sequencing (RNA-seq), or reverse transcription-PCR (RT-PCR).

[0111] As used herein, the term “chemovar” refers to a chemically distinct variety of an organism, such as a fungal strain, that is defined by its unique profile of secondary metabolites. A chemovar is typically identified through both genotypic markers and quantifiable chemical output, particularly in relation to bioactive compounds.

[0112] As used herein, the term “Al” or “Artificial Intelligence” refers to the simulation of human intelligence in machines that are programmed to think like humans and mimic their actions. This includes technologies and methodologies such as machine learning (supervised, unsupervised, and reinforcement learning), deep learning, neural networks, language modeling, quantum computing, and other forms of computational intelligence. Al is capable of performing tasks that require human-like capabilities such as reasoning, learning from past experiences, understanding natural language, and solving problems. In the context of genomic analysis, Al applies these capabilities to analyze, interpret, predict, and visualize genetic data, facilitating advancements in genomic research and applications.

[0113] As used herein, the term “AI-Driven” refers to any system, process, or method that incorporates or is facilitated by artificial intelligence (Al) technologies, including but not limited to machine learning, deep learning, neural networks, language models, expert systems, quantum computing, and rule-based systems. These technologies are utilized to automate, enhance, optimize, or otherwise influence tasks traditionally performed by humans, specifically in the analysis, interpretation, or management of genomic information. AI-Driven solutions are characterized by their ability to learn from data, adapt to new inputs, and make decisions or predictions based on complex datasets.

[0114] As used herein, the described machine learning (ML) models are trained using experimentally derived high-resolution melting (HRM) data and ground-truth genomic sequencing data, including but not limited to Illumina and Oxford Nanopore reads. These datasets are labeled with corresponding nucleotide sequences and HRM profiles. The model performs a technical transformation of raw melt curve data into a predicted DNA sequence, which is subsequently translated in silico into an amino acid sequence.

[0115] The output enables real-time inference of synonymous or nonsynonymous amino acid changes based solely on HRM output, providing a novel and practical application of ML to nucleic acid analysis. This transformation of raw physical data into protein-level insight provides a specific, concrete result that has immediate laboratory utility.

[0116] In some embodiments, the model is further trained using curated datasets linking specific fungal genotypes to clinical outcomes in human subjects. In some embodiments, the model integrates individual human pharmacogenomic and microbiome data — including genotypes related to neurotransmitter metabolism or microbial taxa abundance — to stratify patient responses and therapeutic efficacy predictions. The more complete the biological context provided (i.e., fungal genotype, host genotype, and microbiome data), the more refined and personalized the model’s predictive capability becomes.

[0117] In some embodiments, the above-described ML system facilitates a real -world, technical transformation of physical biological inputs (e.g., melt curves) into molecular, phenotypic, and clinical insights, and is not limited to abstract mathematical algorithms or mental processes.

[0118] As more fully detailed in the examples herein, embodiments of the invention disclosed herein include specific PCR primers and probes for amplifying unique regions within psilocybin synthase paralogs (PsiM gene) that are directly responsible for the production of norbaeocystin, baeocystin, and psilocybin and necessary for the production of psilocin, norpsilocin, and aeruginascin in fungi of the Hymenogastraceae family, specifically within the Psilocybe and Panaeolus genera. Additionally, methods are disclosed for targeting and identifying haplotypes of SNPs in the amplified regions of these methyltransferase paralogs that indicate greater or lesser production and the ratio of certain alkaloids that the methyltransferase is directly responsible for producing.

[0119] Embodiments of the invention additionally provide methods for selectively breeding a fungal cultivar through identifying and genotyping exons of a methyltransferase gene or other psilocybin biosynthetic gene(s) in two or more fungal cultivars; and crossbreeding two individual fungal cultivars identified to have desired effects on alkaloid production in the mycelium and fruiting body. In some embodiments, the methyltransferase gene can be paralogs of the PsiM gene (KY984100.1), or other psilocybin biosynthetic genes disclosed herein. In some embodiments, a genotyping system for PsiK, PsiM, PsiL, PsiD, PsiH, PsiTl, PsiT2, and other genes in and related to the psilocybin biosynthetic pathway are disclosed to predict the total production and range of psilocybin and other related alkaloid profiles.

[0120] In some embodiments, the identifying step comprises PCR amplification of a composition comprising genomic DNA, or cDNA from the two or more fungal cultivars. Insome embodiments, the identifying step comprises PCR amplification using at least one primer selected from Table 1. In some embodiments, the identifying step comprises PCR amplification using a set of two or more, or three or more, or four or more, or five or more, or six or more, or seven or more, or eight or more, or nine or more, or ten or more? primers selected from Table 1.Table 1:

[0121] Table 2 shows a representative sample of bioactive compounds produced by these fungal organisms that are secondary metabolites and produced through a biosynthetic enzymatic pathway. In some embodiments, the methods disclosed herein can predict the product profiles of these compounds and other similar related classes of compounds.Table 2: Naturally Occurring Biochemicals of Fungus

[0122] In some embodiments, crossbreeding two parental organisms allows one to use this technology to select for an offspring fungal cultivar having a greater or lower norbaeocystin content than the two identified individual fungal cultivars. In some embodiments, crossbreeding selects for a fungal cultivar having a greater or lower baeocystin content than the two identified individual fungal cultivars. In some embodiments, crossbreeding selects for a fungal cultivar having a greater or lower psilocybin content than the two identified individual fungal cultivars.

[0123] In some embodiments, the norbaeocystin:baeocystin:psilocybin ratio of the fungal cultivar resulting from the crossbreeding step results from i) greater enzymatic activity of a PsiM paralog identified in two or more fungal cultivars, and / or ii) greater copy number of a PsiM gene, and / or (iii) novel variant alleles that have greater enzymatic activity on one precursor, either norbaeocystin or baeocystin, which allows for various alkaloid profiles to be produced.

[0124] In some embodiments, the crossbreeding further includes crossing a first fungal cultivar wherein the first fungal cultivar provides desired alkaloid content, with a second fungal cultivar, producing hybrid offspring fruit, and harvesting the resultant hybrid fungal spores or cloning the hybrid fungal fruiting body. In some embodiments, the crossbreeding includes introgressing alkaloid production into hybrid fungal spores. In some embodiments, the crossbreeding includes one or more of a backcrossing, an outcrossing, and a self-crossing.

[0125] In some embodiments, specific and targeted exon-by-exon genetic modification occurs to produce novel PsiCluster and alkaloid biosynthetic genes that produce novel chemical secondary metabolite product profiles. In some embodiments, the methods include one or more of the following: CRISPR-Cas9, CRISPR-Casl2, CRISPR-Casl3, CRISPR-Cas3, CRISPR- Cpfl, CRISPR-CasX, CRISPR-CasY, CRISPR interference (CRISPRi), CRISPR activation (CRISPRa), base editing (BE), prime editing (PE), homology-directed repair (HDR), nonhom ologous end joining (NHEJ), Cre-Lox, Cre-ERT2, FLP-FRT, Sleeping Beauty transposon system, PiggyBac transposon system, zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), meganucleases, antisense oligonucleotides, RNA interference (RNAi), small interfering RNA (siRNA), microRNA (miRNA), short hairpin RNA (shRNA), double-stranded RNA (dsRNA), Agrobacterium-mediated transformation, biolistic particle delivery (gene gun), electroporation, polyethylene glycol (PEG)-mediated transformation, viral vectors (e.g., lentivirus, adenovirus, adeno-associated virus), site-directed mutagenesis, targeted gene knockout, targeted gene insertion, gene knockdown, gene overexpression,synthetic biology tools (e.g., gene synthesis, pathway engineering), ribozyme-based gene editing, and / or optogenetics. In some embodiments, the processes disclosed herein include selecting certain exons from one variety and then modifying a genetically distinct variety with one or more hybrid exon amplicons produced using the primer sequences disclosed herein.

[0126] In some embodiments, the fungal cultivars disclosed herein comprise one or more DNA molecular markers associated with alkaloid biosynthetic activity. In some embodiments, the identification of paralogs of a PsiM methyltransferase gene includes molecular marker analysis of DNA and / or RNA samples isolated from one or more of a progeny fungi, a second fungal cultivar, a high norbaeocystin producing fungal cultivar, a high baeocystin fungal cultivar, a high psilocybin fungal cultivar, a parental fungal cultivar, non-alkaloid producing fungal cultivar, and a low alkaloid producing fungal cultivar, wherein the analysis identifies DNA molecules associated with alkaloid content in the fungi. In some embodiments, one or more molecular markers include a single nucleotide polymorphism (SNP) or a combination of SNPs commonly referred to as a haplogroup. In some embodiments, one or more molecular markers encode at least one amino acid substitution identified in the PsiM methyltransferase and PsiK, kinase gene selected from the amino acid substitutions set forth in Table 3 and Table 4 of this disclosure.

[0127] Some embodiments of the invention provide multiple specific examples of fungal cultivars produced by the methods disclosed herein. In some embodiments, these fungal cultivars are obtained by crossbreeding two individuals selected from the group consisting of the cultivar produced by the methods disclosed herein and a progeny of such cultivar.

[0128] Kits and conditions useful in conducting the assays are also provided wherein a combination of markers from one or more genes are provided together for a combined analysis of the biosynthetic pathway. In some embodiments, kits provide subsets of primer sequences disclosed herein that allow users to achieve a single goal while breeding or selecting a fungus.

[0129] In some embodiments, specific or desired chemotypes can be selected according to the methods disclosed herein and using the primers disclosed herein. For example, in some embodiments, a desired chemotype can be produced through breeding for a selective genotype or the absence of the PsiM (SEQ ID: 065, 066, and 067), PsiD (SEQ ID: 070 and 071), PsiK (SEQ ID: 068 and 069), PsiTl (SEQ ID: 072 and 073), PsiT2 (SEQ ID: 074 and 075) and / or PsiH (SEQ ID: 076 and 077) gene(s) through a polymerase chain reaction amplification step and using one or more of the following genotyping end points: sequencing, restriction digest,size selection, high resolution melting (HRM) end-point assay, allele-specific PCR, PCR- RFLP (Restriction Fragment Length Polymorphism), qPCR with TaqMan probes, multiplex PCR, real-time PCR (qPCR), digital PCR, next-generation sequencing (NGS) technologies, loop-mediated isothermal amplification (LAMP), quantitative LAMP (qLAMP), CRISPR- based diagnostics (e.g., SHERLOCK and DETECTR), single-molecule real-time (SMRT) sequencing, and droplet digital PCR (ddPCR). In some embodiments, internal positive control ITS primers can be used to verify the success of the reaction and allow for the detection of the lack of the specific amplicon and / or to serve as an endpoint assay.

[0130] For example, as detailed further in the Examples, in some embodiments, chemovars of psilocybin-producing species can be produced that are psylocibin-free, or baeocystin-free, or norbaeocystin-free, or psilocin-free, or norpsilocin-free, or aeruginascin-free, or 4-HO- Trimethyltryptamine-free, or 4-HO-tryptamine-free.

[0131] In some embodiments, one or more of the following genotyping end points: sequencing, restriction digest, size selection, high resolution melting (HRM) end-point assay, allele-specific PCR, PCR-RFLP (Restriction Fragment Length Polymorphism), qPCR with TaqMan probes, multiplex PCR, real-time PCR (qPCR), digital PCR, next-generation sequencing (NGS) technologies, loop-mediated isothermal amplification (LAMP), quantitative LAMP (qLAMP), CRISPR-based diagnostics (e.g, SHERLOCK and DETECTR), singlemolecule real-time (SMRT) sequencing, and droplet digital PCR (ddPCR) can be used with the markers disclosed herein to select for desired PsiM genotypes. For example, the markers disclosed herein can be used to select for PsiM genotypes that result in an offspring with high 4-OH-tryptamine and low levels of other terminal alkaloids, or high norbaeocystin and low levels of other terminal alkaloids, or high baeocystin and low levels of other terminal alkaloids, or high psilocybin and low levels of other terminal alkaloids, or high 4-OH-tryptamine and high baeocystin, but low levels of other terminal alkaloids, or high 4-OH-tryptamine and high norbaeocystin, but low levels of other terminal alkaloids, or high 4-OH-tryptamine and high psilocybin, but low levels of other terminal alkaloids, or high norbaeocystin and high psilocybin, but low levels of other terminal alkaloids, or high baeocystin and high psilocybin, but low levels of other terminal alkaloids, or high 4-OH-tryptamine, high norbaeocystin, and high baeocystin, but low levels of psilocybin, or high 4-OH-tryptamine, high norbaeocystin, and high psilocybin, but low levels of baeocystin, or high 4-OH-tryptamine, high baeocystin, and high psilocybin, but low levels of norbaeocystin, or high norbaeocystin, high baeocystin, and high psilocybin, but low levels of 4-OH-tryptamine, or high aeruginascin and high 4-HO-trimethyltryptamine but low levels of other tryptamines, or high carboline content with low other terminal alkaloids.

[0132] In some embodiments, the qPCR primers disclosed herein can be used to discriminate fungus with copy number variation of the PsiM gene and / or other psilocybin biosynthetic genes to increase the total production of these alkaloids through the selection of individuals with greater copy number of one or more of the psilocybin biosynthetic genes. For example, in some embodiments the qPCR primers disclosed herein can be used to discriminate fungus with presence-absence variation of the PsiM gene and / or other psilocybin biosynthetic genes to identify fungi that are capable or incapable of producing these psilocybin-related alkaloids, which could be used to identify fungi containing illicit or controlled substances versus those containing no illicit or controlled substance.

[0133] In some embodiments, one or more of the primers disclosed herein [SEQ ID: 001- 081] can be used to discriminate fungus with presence-absence variation of the PsiK gene and / or other psilocybin biosynthetic genes to identify fungi that are capable or incapable of producing these psilocybin-related alkaloids, which could be used to identify fungi containing illicit or controlled substances versus those containing no illicit or controlled substance.

[0134] In some embodiments, the primers can be used with a LAMP primer set that is amplified at room temperature producing a color change in the presence of the biosynthetic genes so that law enforcement or other users could identify the presence of psilocybin in the field.

[0135] In some embodiments, one or more of the disclosed primer sequences [SEQ ID: 001-081] can be used to detect mutant and non-naturally occurring alleles. Mutations can be induced into a single cultivar through certain wavelengths of light, such as UV light, chemical agents like mutagens, or electroshock to increase genetic diversity. This process creates nonnatural alleles of these biosynthetic genes, which can then detected and selected for using the disclosed primer sequences.

[0136] In some embodiments, one or more of the disclosed primer sequences [SEQ ID: 001-081] can be used to detect whether increased genetic recombination between two fungal cultivars has occurred, and whether it is able to produce recombinant or non-functional alleles after putting the fungus through a chemical agent, heat shock, or electroshock treatment.

[0137] In some embodiments, one or more of the disclosed primer sequences [SEQ ID: 001-081] can be used on two parental type mycelium to allow for mycelial recombination orone or more of the disclosed primer sequences [SEQ ID: 001-081] on two hyphal monokaryotic parental types to cause hyphal recombination to produce a recombinant offspring.EXAMPLES Example 1Psylocibin-free chemovar

[0138] A psilocybin-free chemovar of a psilocybin-producing fungal species was produced through selection for the absence, truncation (e.g., internal stop codon), or nonfunctional alleles in one or more of the biosynthetic pathway genes PsiD, PsiH, PsiK, PsiM, PsiTl, or PsiT2. Specifically, selection for a nonfunctional or truncated PsiM allele using the technologies disclosed herein eliminated the methyltransferase activity required for conversion of norbaeocystin to baeocystin and further downstream alkaloids, resulting in a norbaeocystin- dominant chemovar. Such cultivars exhibit genotype profiles consistent with either (i) complete lack of psilocybin and related compounds (selective disruption of PsiD / K / M / Tl / T2 / H), or (ii) selective production of early pathway intermediates — such as 4- HO-tryptamine, norbaeocystin, and norpsilocin — when PsiM is functional enough to add a single methyl group, but incapable of further downstream biosynthesis. In the latter case, nonfunctional PsiM prevents accumulation of baeocystin, norpsilocin, aeruginascin, 4HOTMT, and psilocin, thereby redirecting the chemotype toward norbaeocystin. DNA from fungal tissue was tested using internal positive control ITS primers multiplexed alongside or ran independently from PCR assays targeting PsiD / M / K / H / Tl / T2, where the presence of an ITS amplicon confirmed DNA quality and successful reaction.

[0139] The absence or truncation of the targeted genes was verified by high-resolution melting PCR assays, allele-specific PCR, PCRRFLP, qPCR with TaqMan probes, Sanger or NGS sequencing, and optionally ddPCR, LAMP / qLAMP, or CRISPR-based diagnostics (e.g., SHERLOCK, DETECTR). Such genotypic confirmation was followed by phenotypic analysis via HPLCDAD and LCMSQQQ to demonstrate that the resulting cultivar was chemically free of psilocybin, baeocystin, aeruginascin, norpsilocin, and psilocin, and — where applicable — accumulated norbaeocystin as the dominant alkaloid.Norbaeocystin-free chemovar

[0140] A norbaeocystin-free chemovar of a psilocybin-producing fungal species was developed by selecting for the absence, truncation (e.g., internal stop codon), or non-functional alleles in key pathway genes — PsiD, PsiK, PsiTl, PsiT2, and / or PsiH — while PsiM remainsunaltered and functional. Because PsiM functions downstream of norbaeocystin biosynthesis — catalyzing its methylation to baeocystin and subsequent steps — its presence or absence does not influence norbaeocystin accumulation. As such, the selected genotype resulted in a chemovar dominated by tryptamine and / or 4-hydroxytryptamine, but devoid of norbaeocystin and all downstream alkaloids.

[0141] DNA from fungal tissue was analyzed using multiplex PCR assays that included internal ITS primers to confirm DNA quality, alongside targeted amplification of PsiD / K / Tl / T2 / H loci. The absence or disruption of these genes was confirmed by high- resolution melting (HRM) PCR, allele-specific PCR, PCR-RFLP, qPCR with TaqMan probes, Sanger or NGS sequencing, with optional ddPCR, LAMP / qLAMP, or CRISPR-based diagnostics (e.g., SHERLOCK, DETECTR). Following genotypic verification, the chemovar underwent HPLC-DAD and LC-MS-QQQ analysis, demonstrating no detectable norbaeocystin or further downstream alkaloids, while tryptamine and / or 4-hydroxytryptamine were present as the primary metabolites.Norpsilocin-Dominant chemovar

[0142] A norpsilocin-dominant chemovar of a psilocybin-producing fungal species was produced by selectively breeding for a functional but limited PsiM genotype — capable of monomethylation (yielding baeocystin) but incapable of dimethylation to psilocybin — combined with selection for a hyperactive or overexpressed PsiK, which efficiently dephosphorylates baeocystin to norpsilocin, while upstream genes (PsiD, PsiH, PsiTl, PsiT2') remain functional. This genotype resulted in a fungal strain that produced tryptamine, 4- hydroxy-tryptamine, norbaeocystin, baeocystin, and norpsilocin, but no psilocybin, psilocin, aeruginascin, or 4HOTMT. The breeding strategy involved DNA extraction from fungal tissue followed by multiplex PCR assays using internal ITS primers as quality controls. Target genes (PsiM, PsiK, Psil) H T1 T2) were assessed via high-resolution melting PCR, allele-specific PCR, PCR-RFLP, qPCR with TaqMan probes, Sanger / NGS sequencing — optionally supplemented with ddPCR, LAMP / qLAMP, or CRISPR diagnostics (e.g., SHERLOCK, DETECTR). Functional assays identified PsiM alleles with demonstrated mono-, not di-, methyltransferase activity, consistent with the catalytic mechanism described in structural studies (monomethylation to baeocystin precedes slower dimethylation). Simultaneously, selection for PsiK genotypes with enhanced kinase and dephosphorylation activity favored the conversion of baeocystin to norpsilocin. Following genotypic selection, chemovar samples were analyzed viaHPLCDAD and LCMSQQQ, confirming the absence of psilocybin, psilocin,aeruginascin, and 4HOTMT, and dominance of norpsilocin, along with detectable baeocystin, norbaeocystin, 4hydroxytryptamine, and tryptamine.Aeruginascin-free chemovar

[0143] An aeruginascin-free chemovar of a psilocybin-producing fungal species was produced by selecting for a PsiM genotype that enables monomethylation (norbaeocystin —> baeocystin) and dimethylation (baeocystin —> psilocybin) of the precursor, but lacks the capacity for a third methyl transfer to form aeruginascin. This breeding strategy preserved functional upstream biosynthesis — PsiD, PsiH. PsiK. PsiTP and PsiT2 — allowing production of tryptamine, 4hydroxytryptamine, norbaeocystin, baeocystin, and psilocybin, while excluding aeruginascin and its active dephosphorylated form, 4HOTMT. DNA extracted from fungal samples was tested using multiplex PCR assays with internal ITS primers to verify reaction integrity, alongside targeted amplification of PsiM, PsiD / K / H / Tl / T2. Genotypic selection involved high-resolution melting (HRM) PCR, allele-specific PCR, PCRRFLP, qPCR with TaqMan probes, sequencing (Sanger orNGS), optionally ddPCR, LAMP / qLAMP, or CRISPR-based diagnostics (e.g., SHERLOCK, DETECTR). Candidate PsiM alleles were confirmed to support only two methyl transfers — consistent with structural and enzymatic data showing PsiM can execute the first two methylation steps but is incapable of trimethylation to aeruginascin. Following genotypic confirmation, HPLC-DAD and LC-MS-QQQ analyses substantiated the chemotype: no detectable aeruginascin or 4HOTMT, yet maintained levels of norbaeocystin, baeocystin, psilocybin, and upstream tryptamines.4-HO-tryptamine-ffee chemovar

[0144] A 4-HO-tryptamine-free chemovar of a psilocybin-producing fungal species was produced by selectively breeding for truncated or nonfunctional alleles (e.g., via internal stop codons, exon deletions) in the PsiD and / or PsiH genes — while the genotypes, presence, or absence of downstream enzymes (PsiK, PsiM, PsiTl, PsiT2) do not influence the chemotype. Since PsiD encodes the L-tryptophan decarboxylase (gateway enzyme to convert L-tryptophan to tryptamine) and PsiH encodes the cytochrome P450 monooxygenase responsible for 4- hydroxylation of tryptamine, inactivation of either enzyme blocks formation of 4-hydroxy- tryptamine (4-HO-tryptamine). Thus, the resulting cultivar was chemically devoid of 4-HO- tryptamine and all downstream 4-substituted tryptamines, regardless of the status of other pathway genes. DNA extracted from fungal tissue was analyzed using multiplex PCR assays including internal ITS primers to ensure DNA quality, along with targeted amplification ofPsiD n PsiH. Disruption of these genes was confirmed using high-resolution melting (HRM) analysis, allele-specific PCR, PCRRFLP, TaqMan qPCR, Sanger or NGS sequencing, optionally supplemented with ddPCR, LAMP / qLAMP, or CRISPR-based assays (e.g., SHERLOCK, DETECTR). After genotypic confirmation, cultivars were chemically profiled via HPLCDAD and LCMSQQQ, which demonstrated the absence of 4-HO-tryptamine and all downstream 4hydroxytryptamine derivatives, even when PsiK, PsiM, PsiTl, and PsiT2 were present or functional.4-OH-Tryptamine-Dominant chemovar

[0145] A 4-HO-tryptaminedominant chemovar of a psilocybin-producing fungal species was created by selectively breeding for overactive genotypes of PsiD (the L-tryptophan decarboxylase) and PsiH (the 4-hydroxylase), while concurrently selecting for a non-functional or truncated PsiK enzyme to block the phosphorylation of 4-HO-tryptamine required to produce norbaeocystin. Upregulation or gain-of-function mutations in PsiD and PsiH enhanced conversion of L-tryptophan to tryptamine and then to 4-HO-tryptamine, resulting in a chemovar that predominantly accumulated 4-HO-tryptamine and remained devoid of norbaeocystin and downstream 4-substituted tryptamines. The functionality of upstream genes (PsiM, PsiTl, PsiT2) was irrelevant in this context due to the PsiK block. Fungal DNA was extracted using standard protocols and analyzed via multiplex PCR using ITS primers as internal positive controls. Alleles of PsiD and PSIH WQVQ screened for overactive variants using high-resolution melting (HRM) PCR, allele-specific PCR, PCR-RFLP, TaqMan qPCR, Sanger or NGS sequencing, with optional support from ddPCR, LAMP / qLAMP, or CRISPR-based diagnostics (e.g., SHERLOCK, DETECTR). Meanwhile, PsiK disruption was confirmed by HRM and sequencing to verify truncations or stop codons indicating non-functionality. Following genotyping, chemovars were quantitatively analyzed via HPLCDAD and LCMSQQQ, confirming a high concentration of 4HOtryptamine, with no detectable norbaeocystin, baeocystin, norpsilocin, psilocybin, psilocin, aeruginascin, or 4-HO-TMT. This confirmed successful redirection of metabolic flux toward 4-HO-tryptamine accumulation.Norbaeocystin-Dominant chemovar

[0146] A norbaeocystin-dominant chemovar of a psilocybin-producing fungal species was developed by breeding for a non-functional or absent PsiM allele — preventing the methylation of norbaeocystin — and concurrently selecting for functional upstream enzymes (PsiD, PsiH, PsiK, PsiTl, PsiT2 . Because PsiM is responsible for the mono-methylation / di-methylationsteps converting norbaeocystin to baeocystin and psilocybin, loss or truncation of PsiM blocked these downstream reactions and led to the accumulation of norbaeocystin, alongside tryptamine and 4-HO-tryptamine, while eliminating psilocybin, baeocystin, norpsilocin, psilocin, aeruginascin, and 4-HO-TMT.

[0147] Structural studies confirmed that PsiM catalyzed di-methylation but was disabled when non-functional, and its absence or truncation ensured no conversion past norbaeocystin. Fungal DNA was extracted and subjected to multiplex PCR with ITS primers as internal positive controls. Target genes — including PsiM — were genotyped using high-resolution melting (HRM) PCR, allele-specific PCR, PCRRFLP, qPCR with TaqMan probes, sequencing (Sanger / NGS), and optionally ddPCR, LAMP / qLAMP, or CRISPR diagnostics (e.g., SHERLOCK, DETECTR), to confirm PsiM disruption. Following genotypic selection, chemovar extracts underwent HPLCDAD and LCMSQQQ analysis, confirming strong accumulation of norbaeocystin, with detectable tryptamine and 4HOtryptamine, and no detectable levels of downstream 4substituted tryptamines or psychoactive alkaloids.High baeocystin chemovar

[0148] A high-baeocystin chemovar of a psilocybin-producing fungal species was generated by selecting for a partially functional PsiM allele that supported efficient monomethylation of norbaeocystin to baeocystin but lacked sufficient activity for a second methylation to psilocybin or trimethylation to aeruginascin. Concurrently, a PsiK variant was selected that remained active on 4-HO-tryptamine yet is incapable of dephosphorylating norbaeocystin, thereby preventing the formation of norpsilocin.

[0149] This dual selection strategy yielded a chemovar enriched in baeocystin, accompanied by norbaeocystin, 4-HO-tryptamine, and tryptamine, while being devoid of psilocybin, psilocin, norpsilocin, aeruginascin, and 4-HO-TMT.

[0150] Genotyping was performed on DNA extracted from fungal tissue using multiplex PCR assays that included internal ITS primers as positive controls. Alleles of PsiM and PsiK were screened via high-resolution melting (HRM) PCR, allele-specific PCR, PCRRFLP, qPCR with TaqMan probes, and Sanger or NGS sequencing — optionally supplemented by ddPCR, LAMP / qLAMP, or CRISPR diagnostics (e g., SHERLOCK, DETECTR). Candidate PsiM variants exhibited kinetic and structural characteristics consistent with monomethylation activity but limited catalytic efficiency past that point, corroborated by structural studies indicating PsiM’s first methylation is faster than the second, and variants at position Asn247 (e.g., N247M / N247A) abolish di-methylation. The selected PsiK genotype showed activityagainst 4-HO-tryptamine without accepting baeocystin as a substrate, verified through enzyme assays and chemical profiling. Chemovar samples underwent HPLCDAD and LCMSQQQ analysis, confirming a high concentration of baeocystin, with retained norbaeocystin, 4-HO- tryptamine, and tryptamine, and no detectable levels of downstream alkaloids including psilocybin, psilocin, norpsilocin, aeruginascin, and 4-HO-TMT.High psilocybin chemovar

[0151] A psilocybin-dominant chemovar of a psilocybin-producing fungal species was developed by selecting for overactive or overexpressed genotypes of PsiD (L-tryptophan decarboxylase), PsiH (4-hydroxylase), and PsiK (4-hydroxytryptamine kinase), together with a PsiM genotype capable of efficient monomethylation and dimethylation — but inherently incapable of trimethylation — thereby maximizing conversion up to psilocybin only. Known structural studies of PsiM show that its enzymatic architecture supports dimethylation of norbaeocystin to psilocybin while being intrinsically unable to catalyze a third methyl transfer to form aeruginascin. A further layer of control was introduced through selection of PsiK genotypes to modulate the psilocin-to-psilocybin ratio: alleles with enhanced dephosphorylation activity led to elevated psilocin production (higher bioavailability), whereas alleles with enhanced phosphorylation activity favored psilocybin retention (improving shelf stability and reducing psilocin-mediated bruising or dimerization). Fungal DNA from candidate strains was extracted and subjected to multiplex PCR assays including ITS internal controls to ensure DNA quality and assay reliability. Genotyping employed a suite of methods: high-resolution melting (HRM), allele-specific PCR, PCRRFLP, qPCR with TaqMan probes, Sanger or NGS sequencing, optionally supplemented with ddPCR, LAMP / qLAMP, and CRISPR-based diagnostics (e g., SHERLOCK, DETECTR). PsiD, PsiH, PsiK, and PsiM alleles were each screened for overactivity or enhanced catalytic efficiency, while trimethylation-deficient Ctrl-PsiM variants were confirmed. Chemovar extracts were quantitatively analyzed via HPLCDAD and LCMSQQQ, confirming high total alkaloid content dominated by psilocybin, with controlled psilocin levels based on the chosen PsiK allele. Trace or no detection of aeruginascin and 4-HO-TMT was observed, demonstrating both effective flux redirection to psilocybin and metabolic pathway specificity.High norbaeocystin / high baeocystin / high psilocybin chemovar

[0152] A high-norbaeocystin / high-baeocystin / high-psilocybin chemovar of a psilocybin- producing fungal species was developed by selecting a specific PsiM genotype capable ofsequential mono- and di-methylation — producing norbaeocystin, baeocystin, and psilocybin — while inherently incapable of trimethylation, thus excluding aeruginascin and 4-HO-TMT. This genotype leverages PsiM’s enzymatic mechanism: its active site supports the first two methyl transfers with declining catalytic efficiency and cannot accommodate a third, as confirmed by high-resolution crystal structures and kinetic analyses demonstrating inability for trimethylation. Upstream enzymes (1’sil). PsiH. PsiK. Psill. PsiT2) remained functional to ensure precursor supply and pathway flow. DNA from candidate cultivars was extracted and analyzed using multiplex PCR with internal ITS primers as positive controls. Genotyping employed high-resolution melting (HRM), allele-specific PCR, PCR-RFLP, qPCR with TaqMan probes, Sanger and NGS sequencing, ddPCR, LAMP / qLAMP, and CRISPR-based diagnostics (e.g., SHERLOCK, DETECTR). PsiM genotypes were screened for dual methylation capacity but lacking trimethylation, while PsiK and other pathway enzymes were confirmed active. Chemovar samples underwent HPLC-DAD and LC-MS-QQQ analysis, showing high concentrations of norbaeocystin, baeocystin, and psilocybin, with low levels of 4HOtryptamine and no detectable aeruginascin, 4-HO-TMT, or other downstream alkaloids.Beta-Carboline-Dominant chemovar

[0153] A P-carboline-dominant chemovar, confirmed through breeding and chemical analysis, was developed by crossing a 4-HO-tryptaminefree cultivar with a P-carboline- producing strain, then selecting offspring that retained the 4-HO-tryptamine-free genotype (PsiD / PsiH disruption) and exhibited elevated P-carboline biosynthesis. By disrupting PsiD to block the 4-hydroxylation pathway, metabolic flux was redirected — leaving abundant tryptophan and tryptamine available for P-carboline formation. In breeding selections, multiplex PCR assays with internal ITS primers were used alongside high-resolution melting (HRM), allele-specific PCR, PCRRFLP, qPCR, NGS sequencing, LAMP / qLAMP, ddPCR, and CRISPR-based diagnostics (e.g., SHERLOCK / DETECTR) to confirm retention of the 4HOtryptaminefree genotype and to track inherited P-carboline production markers. Selected progeny were chemically screened via HPLCDAD and LCMSQQQ (using methods capable of simultaneous tryptamine and Pcarboline profiling), confirming low to undetectable levels of terminal tryptamines (psilocybin, etc.) and elevated levels of P-carboline alkaloids, such as harmane and harmine — secondary metabolites previously observed at low concentrations in Psilocybe mushrooms. This validates that P-carbolines can accumulate when primary pathway flux is blocked and precursor pools are diverted. This embodiment provides a novel fungalcultivar enriched in P-carbolines (MAO-inhibitory compounds) for potential use in pharmacology, functional food development, or other biotechnological applications.Detection of illicit or controlled substances

[0154] A field-capable assay for detecting psilocybin-producing fungi has been reduced to practice, demonstrating real-world use via specific qPCR and LAMP primers targeting presence-absence polymorphisms in PsiK and other key psilocybin pathway genes. DNA extracted from fungal tissue — via crude Tris / TRITON-X or Qiagen Plant Kits with Proteinase K — was analyzed using multiplex qPCR assays targeting PsiK (and optionally PsiD, PsiM, etc.) alongside ITS internal control primers to verify DNA quality and detect true negatives. Genotypes were discriminated using qPCR with TaqMan probes, confirmed via Sanger sequencing or NGS, and optionally corroborated with ddPCR. To enable rapid, equipment-free field testing, a LAMP -based assay was developed using primers specific to PsiK and / or PsiD. The LAMP reaction runs at room temperature or 60-65 °C, using colorimetric detection via pH-sensitive dyes (e.g., phenol red) or metal-ion indicators (e.g., hydroxynaphthol blue), yielding a visible color shift when amplification occurs. This colorimetric LAMP test was validated on-site, successfully identifying mushrooms containing biosynthetic genes associated with psilocybin production — demonstrating real-time, presumptive detection of controlled substances.Detection of mutant and non-naturally occurring alleles

[0155] A screening platform for detecting mutant and non-naturally occurring alleles within psilocybin-biosynthetic genes was developed, enabling precise identification of unique or induced variations through genotypic comparison to a reference barcode database. Fungal DNA — sourced from pre-treatment and post-treatment samples — was barcoded using multiplex PCR targeting exons of key genes (PsiD, PsiM, PsiK, PsiH, etc.) alongside ITS internal control primers. Sequencing (Sanger or NGS) generated high-fidelity exon-level genotype barcodes, which were compared to a curated database of known wild-type genotypes. This comparative approach enabled detection of novel, one-of-a-kind alleles introduced by mutagenesis techniques such as UV, chemical mutagens, or electroshock treatments. In particular, the workflow effectively differentiated pre-treatment barcodes (wild-type) from post-treatment barcodes, identifying any induced mutations in the target exons. Additional assays such as allele-specific PCR, high-resolution melting (HRM), and Surveyor nuclease (TILLING) were utilized to quickly screen for changes in melting profiles or heteroduplexmismatches in unknown barcodes, flagging samples for further sequencing validation. For rapid in-field variant detection, an allele-specific LAMP assay was designed to preferentially amplify known or novel mutant alleles at ~60 °C with colorimetric detection (e.g., hydroxynaphthol blue), confirming presence of induced mutations without sequencing.Detection of increased genetic recombination

[0156] A screening platform for detecting increased genetic recombination in fungal cultivars was developed, enabling the identification of recombinant or non-functional alleles following mutagenesis (e.g., chemical, heat shock, electroshock) or crossbreeding between parental lines. Parental and offspring fungal DNA were extracted and subjected to multiplex PCR using primers (SEQ ID 001-081) targeting multiple biosynthetic genes (PsiD. PsiM, PsiK. PsiH. etc.), along with ITS internal control primers to confirm DNA integrity. Offspring genotypes were compared to parental profiles through multilocus sequence typing (MLST) — sequencing key exons across multiple loci — to determine whether recombination events occurred, and whether novel allele combinations (including non-functional variants) were present. To detect subtle sequence exchanges or indels indicative of recombination, intersample PCR products were subjected to Surveyor nuclease (mismatch cleavage) analysis. Heteroduplexes formed between parental and offspring alleles were cleaved at mismatch sites, producing fragment patterns consistent with recombination or gene conversion events. Hits were further resolved by sequencing to map precise recombination breakpoints. This workflow confirmed recombination in practice: offspring lines showed genotypes differing from both parents, including chimeric alleles and disrupted gene configurations, illustrating non-natural segregation patterns. The assay reliably distinguishes recombinants from parental genotypes.Example 2Using Amplicons for Genetic Transformation

[0157] Briefly, a variant allele of PsiM is identified using the primers disclosed herein, and then subsequently cloned into a plasmid that allows for the transformation and / or transfection of another fungal cultivar or other organism using an exon-by-exon gene modification system using these novel primers. That plasmid is screened using the disclosed technology for confirmation of the correct sequence insertion. Upon successful transformation, chemical extracts are screened via HPLC-DAD chemical quantification.

[0158] A subset of these markers is used to predict and select for various norbaeocystin:baeocystin:psilocybin ratios in breeding cultivars and / or offspring cultivars.

[0159] These markers are used to quantify the expression of a given gene family in a given fungal part to selectively increase or decrease a given alkaloid in certain fungal parts by selecting for parental lines with the desired expression profile.

[0160] Gene knockouts or knockdowns of the alkaloid biosynthesis genes are introduced through using one or more of the disclosed primer sequences using various genetic modification and expression modification methods, including but not limited to using plasmid transformation, and fungal transfection using a genetic engineering tool including but not limited to CRISPR-Cas9, CRISPR-Casl2, CRISPR-Casl3, CRISPR-Cas3, CRISPR-Cpfl, CRISPR-CasX, CRISPR-CasY, CRISPR interference (CRISPRi), CRISPR activation (CRISPRa), base editing (BE), prime editing (PE), homology-directed repair (HDR), nonhom ologous end joining (NHEJ), Cre-Lox, Cre-ERT2, FLP-FRT, Sleeping Beauty transposon system, PiggyBac transposon system, zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), meganucleases, antisense oligonucleotides, RNA interference (RNAi), small interfering RNA (siRNA), microRNA (miRNA), short hairpin RNA (shRNA), double-stranded RNA (dsRNA), Agrobacterium-mediated transformation, biolistic particle delivery (gene gun), electroporation, polyethylene glycol (PEG)-mediated transformation, viral vectors (e.g., lentivirus, adenovirus, adeno-associated virus), site-directed mutagenesis, targeted gene knockout, targeted gene insertion, gene knockdown, gene overexpression, synthetic biology tools (e.g., gene synthesis, pathway engineering), ribozyme-based gene editing, and / or optogenetics.

[0161] In some embodiments, these markers are used to select for the presence of, or the profile of psilocybin and minor alkaloids in a given fungus, while introgressing compounds from other fungal species. For example, selecting for the psilocybin biosynthesis pathway when breeding Hericium erinaceus (Lion’s Mane) metabolites into Psilocybe cubensis, or breeding the psilocybin pathway into Lion’s Mane.

[0162] In some embodiments, these markers are used to select for the presence of, or the profile of psilocybin and minor alkaloids in a given fungus, while introgressing compounds from Ganoderma lucidum (Reishi) into Psilocybe cubensis, or breeding the psilocybin pathway into Reishi.

[0163] In some embodiments, stability and genomic and / or transcriptomic variation data across manufacturing lots (identical genomic profiles and expression levels over multiple generations) are furnished, underscoring homologous quality attributes and supporting regulatory claims of product equivalence across batches.

[0164] In some embodiments, these markers are used to select for the presence of, or the profile of psilocybin and minor alkaloids in a given fungus, while introgressing compounds from Trametes versicolor (Turkey Tail) into Psilocybe cubensis, or breeding the psilocybin pathway into Turkey Tail.

[0165] In some embodiments, these markers are used to select for the presence of, or the profile of psilocybin and minor alkaloids in a given fungus, while introgressing compounds from Inonotus obliquus (Chaga) into Psilocybe cubensis, or breeding the psilocybin pathway into Chaga.

[0166] In some embodiments, these markers are used to select for the presence of, or the profile of psilocybin and minor alkaloids in a given fungus, while introgressing compounds from Cordyceps militaris (Cordyceps) into Psilocybe cubensis, or breeding the psilocybin pathway into Cordyceps.

[0167] In some embodiments, these markers are used to select for the presence of, or the profile of psilocybin and minor alkaloids in a given fungus, while introgressing compounds from Grifola frondosa (Maitake) into Psilocybe cubensis, or breeding the psilocybin pathway into Maitake.

[0168] In some embodiments, these markers are used to select for the presence of, or the profile of psilocybin and minor alkaloids in a given fungus, while introgressing compounds from Lentinula edodes (Shiitake) into Psilocybe cubensis, or breeding the psilocybin pathway into Shiitake.

[0169] In some embodiments, these markers are used to select for the presence of, or the profile of psilocybin and minor alkaloids in a given fungus, while introgressing compounds from Agaricus blazei (Agaricus) into Psilocybe cubensis, or breeding the psilocybin pathway into Agaricus.

[0170] In some embodiments, these markers are used to select for the presence of, or the profile of psilocybin and minor alkaloids in a given fungus, while introgressing compounds from Pleurotus ostreatus (Oyster Mushroom) into Psilocybe cubensis, or breeding the psilocybin pathway into Oyster Mushroom.

[0171] In some embodiments, these primer sequences can be used to amplify at least 1 exon or region of exon from PsiM in a given fungus, which can then be used to transform another fungus’s PsiM gene to contain 1 or more transgenic exons of a different PsiM paralog. This process would be accomplished using plasmid transformation, and fungal transfection using a genetic engineering tool including but not limited to CRISPR-Cas9, CRISPR-Casl2, CRISPR-Casl3, CRISPR-Cas3, CRISPR-Cpfl, CRISPR-CasX, CRISPR-CasY, CRISPRinterference (CRISPRi), CRISPR activation (CRISPRa), base editing (BE), prime editing (PE), homology-directed repair (HDR), non-homologous end joining (NHEJ), Cre-Lox, Cre-ERT2, FLP-FRT, Sleeping Beauty transposon system, PiggyBac transposon system, zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), meganucleases, antisense oligonucleotides, RNA interference (RNAi), small interfering RNA (siRNA), microRNA (miRNA), short hairpin RNA (shRNA), double-stranded RNA (dsRNA), Agrobacterium-mediated transformation, biolistic particle delivery (gene gun), electroporation, polyethylene glycol (PEG)-mediated transformation, viral vectors (e.g., lentivirus, adenovirus, adeno-associated virus), site-directed mutagenesis, targeted gene knockout, targeted gene insertion, gene knockdown, gene overexpression, synthetic biology tools (e.g., gene synthesis, pathway engineering), ribozyme-based gene editing, and / or optogenetics.Example 3Performing Quality Assurance Using This Technology

[0172] Briefly, SEQ ID: 025-032 is used to test for genetic stability of this biosynthetic region that encodes the ratio of active drugs found in the psilocybin-producing mushroom for quality control standards in a regulatory environment such as the FDA. One or more of these primer pairs are used to observe the genotypic changes that occur in this specific biosynthetic region of the psilocybin-containing mushroom genome. This is accomplished through using one or more of the following genotyping end points: sequencing, restriction digest, size selection, high resolution melting (HRM) end-point assay, allele-specific PCR, PCR-RFLP (Restriction Fragment Length Polymorphism), qPCR with TaqMan probes, multiplex PCR, real-time PCR (qPCR), digital PCR, next-generation sequencing (NGS) technologies, loop- mediated isothermal amplification (LAMP), quantitative LAMP (qLAMP), CRISPR-based diagnostics (e.g., SHERLOCK and DETECTR), single-molecule real-time (SMRT) sequencing, and droplet digital PCR (ddPCR).

[0173] In some embodiments, one or more of SEQ ID: 001-081 are used used to test for genetic stability of this biosynthetic region that encodes the ratio of active drugs found in the psilocybin-producing mushroom for quality control standards in a regulatory environment such as the FDA. In particular, a subset of these primers could be used to amplify and genotype the entire psilocybin biosynthetic pathway, to monitor and compare across subsequent clonal and filial generations to rapidly screen for and identify any possible mutant varieties prior to having to fruit or chemical test each of those varieties. These novel primer sets would serve as an essential aspect for botanical drug substance quality assurance pipelines when combined withproteomics, chemical analysis, and / or other growth and visual data that allows for a batch to be certified the same as a previous batch.Example 4Selection For or Against Known Mutants

[0174] Briefly, the technology disclosed herein allows a user to selectively breed and / or identify mutant genes that have known effects on the catalytic activity of the enzyme being target mutations include one or more of the following mutant amino acid sites (Table 3).

[0175] Table 3 shows amino acid mutations in the coding region of the methyltransferase enzyme being targeted by this technology to allow for selective breeding of various chemotype profiles, as well as allow for one to use this disclosed invention to create psilocybin-free mushrooms, aeruginascin-free mushrooms, norbaeocystin-free mushrooms, and baeocystin- free mushrooms, where the biosynthesis of these compounds is inhibited through these selected mutated sites. Additionally, this table describes mutations within this amino acid code that have caused the enzyme to have greater or less ability to convert baeocystin into psilocybin. These amino acid mutations are aspects of the focal points of the novel genetic assays developed herewith in.Table 3: PsiM Targeted Mutations

[0176] Table 4 shows the amino acid mutations in the coding region of the kinase enzyme, otherwise known as a phosphotransferase enzyme, being targeted by this technology to allow for selective breeding of various chemotype profiles, as well as allow for one to use this disclosed invention to create psilocybin-free mushrooms, norbaeocystin-free mushrooms,aeruginascin-free mushrooms, and baeocystin-free mushrooms, where the biosynthesis of these compounds is inhibited through these selected mutated sites.Example 5Targeted Chemovar Development via Marker- Assisted Selection

[0177] Briefly, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced antidepressant effects by identifying expression profiles of psilocybin- pathway genes correlated with neurochemical markers associated with depression relief.

[0178] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced anti-inflammatory effects by quantifying gene expression signatures linked to compounds known to modulate inflammation.

[0179] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced anxiolytic effects, thereby enabling the propagation of cultivars that reduce anxiety without causing overstimulation.

[0180] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced neuroprotective effects, by targeting elevated expression of biosynthetic genes associated with neurotrophic alkaloids.

[0181] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced gastroprotective effects, through markers indicating production of compounds that support gastrointestinal cellular integrity.

[0182] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced analgesic effects, by correlation of specific gene expression profiles to known pain-relieving alkaloids.

[0183] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced anti -addiction effects by selecting for expression profiles that align with reduction in addictive behaviors.

[0184] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced end-of-life distress relief via gene-expression markers associated with palliative cognitive and emotional effects.

[0185] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced antioxidant properties by targeting genes linked to redoxactive alkaloid production.

[0186] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced antibacterial and antiviral properties by selecting geneexpression indicators of biosynthetic pathways known to yield antimicrobial alkaloids.

[0187] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced cognitive- and memory-enhancing effects, supporting cultivars for improved learning or memory consolidation applications.

[0188] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting enhanced sedative properties through expression profiles indicative of calmative alkaloid production.

[0189] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting reduced psychedelic (visual, mental, and somatic) effects while maintaining therapeutic properties, creating high potency therapeutic cultivars with minimized hallucinogenic side effects.

[0190] In some embodiments, primers and methods disclosed herein are used to engineer fungal cultivars combining high potency and low anxiety / nausea profiles, by selecting for favorable gene combinations that decouple therapeutic neurochemical pathways from those causing anxiety or gastrointestinal discomfort.

[0191] In some embodiments, primers and methods disclosed herein enable combinatorial profiling to produce fungal cultivars exhibiting both antidepressant and gastroprotective traits, or neuroprotective and analgesic traits, leveraging multigene expression signatures.

[0192] In some embodiments, primers and methods disclosed herein facilitate selection of fungal cultivars possessing potency therapeutic effects, high sedative outcomes, and low visual or physical side effects by balancing expression levels across multiple biosynthetic genes.

[0193] In some embodiments, primers and methods disclosed herein are used for quality assurance by monitoring expression of critical biosynthetic genes in fungal cultures; this allows early detection of mutant or expression variants and can be used in conjunction with genomic DNA-based QA assays to support batch consistency and regulatory compliance.Example 6Predictive Gene Expression Profiling

[0194] Brielfy, primers and methods disclosed herein are used to select fungal cultivars exhibiting specific gene expression profiles that predict increased production of tryptamines, tryptamine-derived compounds, and / or beta carbolines, enabling chemovar characterization and targeted breeding of high-value alkaloid producers and novel alkaloid profiles.

[0195] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting overexpression of one or more psilocybin biosynthetic genes — such as PsiM, PsiD, PsiK, PsiTl, PsiT2, PsiL, or PsiH — to identify and propagate cultivars with increased total alkaloid content.

[0196] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting negligible or no expression of psilocybin biosynthetic genes, thereby identifying cultivars with decreased or nonexistent alkaloid production for applications requiring non-psychoactive fungal material.

[0197] In some embodiments, quantitative PCR (qPCR), reverse transcription qPCR (RTqPCR), or real-time PCR is performed on pools of extracted mRNA or reverse transcribed cDNA to quantify expression of one or more alkaloid biosynthetic genes and enable direct comparison between cultivars.

[0198] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars with no detectable PsiM expression, thereby producing cultivars lacking the enzymatic conversion of norbaeocystin to baeocystin and resulting in mushrooms free of baeocystin, psilocin, psilocybin, aeruginascin, and 4-HO-TMT.

[0199] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars with no detectable PsiK expression, resulting in cultivars that accumulate only 4hydroxytryptamine and are free of norbaeocystin, baeocystin, norpsilocin, psilocin, psilocybin, aeruginascin, and 4-HO-TMT.

[0200] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars overexpressing PsiD, leading to increased production of 4hydroxytryptamine and enhanced overall alkaloid levels; in some instances, PsiD overexpression is co-selected with elevated PsiH, PsiK, PsiL, PsiTl, PsiT2 and / or PsiM expression to refine alkaloid profile ratios.

[0201] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars exhibiting reduced PsiK expression to minimize dimerization and degradation of active alkaloids such as psilocin, norpsilocin, and 4-HO-TMT, improving stability during harvest and processing.

[0202] In some embodiments, primers and methods disclosed herein are used to select fungal cultivars with reduced or no expression of PsiK combined with reduced or no expression of PsiL, further preventing active alkaloid dimerization, enhancing resistance to bruising, and reducing chemical degradation during storage.

[0203] In some embodiments, primers and methods disclosed herein are used to modulate the expression of PsiTl and / or PsiT2 to selectively alter intermediate alkaloid or precursor levels, enabling production of cultivars with tailored therapeutic or psychoactive profiles.

[0204] In some embodiments, primers and methods disclosed herein are used as a gene expression monitoring-based quality assurance system to detect cultures exhibiting unexpected increases or decreases in expression of key biosynthetic genes. This system may be employed independently or integrated into a larger genomic DNA-based QA pipeline to identify mutant or genetically unstable cultures before scale-up or commercialization.

[0205] In some embodiments, gene expression monitoring using the primers and methods disclosed herein is incorporated into multi-tiered quality assurance workflows that include genomic sequencing, analytical chemistry, and phenotypic assessments to certify botanical drug substance consistency and regulatory compliance.

[0206] In some embodiments, primers and methods disclosed herein are used to perform temporal or specific expression profiling (e.g., mycelium versus fruiting body) to select for cultivars with increased alkaloid expression in target tissues, enabling optimization of harvest timing and biomass usage.

[0207] In some embodiments, primers and methods disclosed herein are used to screen spore-derived cultures to identify contaminants, verify cultivar identity, and ensure genetic fidelity following spore-based propagation or clonal culture maintenance.

[0208] In some embodiments, primers and methods disclosed herein are used to identify and select cultivars with enhanced environmental or pest resistance by monitoring expression of biosynthetic genes correlated with defense-related alkaloid production under stressinduced conditions.

[0209] In some embodiments, primers and methods disclosed herein are used to support breeding strategies — including selfing, sibling crosses, backcrossing, threeway crossing, fourway crossing, or double haploidy — where genetic markers of expression or absence of key biosynthetic genes guide parental selection, enhance homozygosity for desired chemotypes, or promote novel heterozygous alkaloid profiles in offspring.Example 7Comprehensive Genetic Analysis for Quality Assurance

[0210] Briefly, primers and methods disclosed herein include any type of PCR (including qPCR, RT-qPCR, Real-Time PCR), targeted sequencing, or whole-genome sequencing to perform quality assurance of a given cultivar intended for production. This approach identifies biosynthetic mutants arising from clonal mutational load prior to cultivation.

[0211] In some embodiments, this genetic analysis is performed on plated cultures, liquid cultures, and / or individual fruiting bodies to detect amino acid substitutions or other genetic changes in psilocybin biosynthetic genes that lead to changes in the chemical profile of that fungi.

[0212] In some embodiments, this system identifies other biosynthetically identical or similar cultivars from spore-based cultures, providing redundancy in cases where clonal cultures mutate or are lost due to unforeseen circumstances.

[0213] In some embodiments, the analysis specifically targets one or more psilocybin biosynthetic genes, including but not limited to PsiM, PsiK, PsiD, PsiTl, PsiT2, PsiH, and PsiL.

[0214] In some embodiments, primers comprising SEQ IDs: 025-036 are employed to amplify and sequence the entire genomic region encompassing the psilocybin biosynthetic gene cluster. This approach involves amplification of overlapping sections assembled into a complete biosynthetic gene cluster sequence.

[0215] In some embodiments, analysis includes coding DNA sequence evaluation to predict amino acid sequences of biosynthetic proteins and non-coding regions such as 3’-UTR and 5’-UTR, identifying differential regulation and expression mechanisms potentially influencing alkaloid production.

[0216] In some embodiments, the disclosed methodologies provide a quality assurance kit comprising primer pairs suitable for in-field assays, enabling rapid identification and validation of genetic consistency or variations across fungal generations.

[0217] In some embodiments, this genetic monitoring system is integrated with regulatory standards (such as FDA guidelines) to ensure consistent chemical profiles and alkaloid compositions of psilocybin-containing fungi.Example 8Kits and Automated Analytical Apparatus

[0218] Briefly, kits comprising one or more primers described herein (SEQ IDs: 001-081) are provided for applications including but not limited to quality assurance assays,norbaeocystin-enhancement selection, norpsilocin-enhancement selection, and psilocybin- detection assays.

[0219] In some embodiments, kits comprising primers described herein (SEQ IDs: 001- 081) are provided for law enforcement and in-field applications including Psilocybe genus identification assays with or without the inclusion of additional assays to verify the presence of psilocybin or related alkaloids indicative of the presence of illicit or controlled substances.

[0220] In some embodiments, kits comprising primers described herein (SEQ IDs: 001- 081) are provided for law enforcement and in-field applications including Panaeolus genus identification assays with or without the inclusion of additional assays to verify the presence of psilocybin or related alkaloids indicative of the presence of illicit or controlled substances.

[0221] In some embodiments, an automated analytical apparatus is provided that comprises mechanisms for automatically loading fungal samples, extracting nucleic acids, and performing PCR, qPCR, or other nucleic acid amplification-based reactions to automatically generate genotyping results.

[0222] In some embodiments, the automated analytical apparatus comprises immobilized primers affixed to a solid surface, such as a SNPChip, enabling rapid, high-throughput genotyping.

[0223] In some embodiments, artificial intelligence (Al) components are integrated within the automated analytical apparatus to facilitate real-time data interpretation and genotype identification. Al technologies utilized include, but are not limited to, large language models, image-recognition models, and machine learning algorithms that analyze PCR-generated data to determine presence, absence, or variations in genotypes.

[0224] In some embodiments, Al components are specifically trained on protein sequence datasets, thereby enabling differentiation between synonymous and non-synonymous amino acid substitutions, allowing precise identification of mutations relevant to fungal phenotypes.

[0225] In some embodiments, the automated analytical apparatus further comprises integrated systems for automated sample handling, precise temperature regulation, and optimized reaction conditions to enhance analytical throughput, reproducibility, and reliability.

[0226] In some embodiments, the analytical apparatus includes a user-friendly interface designed for real-time analysis visualization, parameter customization, and automated reporting, thus improving operational efficiency, data interpretation, and practical implementation of analysis results.Example 9Breeding Strategies Using Biosynthetic Gene Markers

[0227] Brielfly, methods disclosed herein utilize genetic markers and associated primers (SEQ IDs: 001-081) for breeding fungal cultivars, specifically targeting alkaloid biosynthetic gene regions. These genetic markers enable screening and selection of parental fungal types for selective breeding, including inbreeding and outcrossing strategies.

[0228] In some embodiments, selecting genetically similar parental cultivars using the disclosed methods promotes offspring with greater homozygosity, enhanced phenotypic stability, and consistent chemical profiles.

[0229] In some embodiments, selecting genetically distinct parental cultivars using these methods promotes offspring with increased heterozygosity and potential heterosis, resulting in enhanced or novel alkaloid profiles that differ from either parent.

[0230] In some embodiments, disclosed genetic markers facilitate advanced fungal breeding strategies, including but not limited to backcrossing, sibling crossing, three-way crossing, four-way crossing, selfing, and double haploid breeding. These breeding methods leverage the precise selection of parental lines based on genotypic data from biosynthetic gene analyses to reliably and predictably modulate alkaloid production profiles.

[0231] In some embodiments, breeding strategies utilizing genetic markers herein described may be combined with phenotypic, chemotypic, or environmental data to optimize selection processes and outcomes, ensuring improved fungal cultivar stability and chemical consistency for medicinal or therapeutic applications.

[0232] In some embodiments, the described breeding techniques using biosynthetic gene markers enable identification and selection of fungal cultivars with desired traits such as increased yield, resistance to pests or environmental stressors, and optimized medicinal compound production.

[0233] In some embodiments, the disclosed methods for breeding and genetic selection enable regulatory compliance, ensuring genetic and chemical consistency across fungal generations for therapeutic, medicinal, or commercial purposes.Example 10Automated Analyses and Reporting

[0234] Briefly, the methods, kits, and apparatus disclosed herein include automated analytical systems capable of performing integrated analyses and generating actionable reports. Such automated systems incorporate artificial intelligence (Al) and machine learningalgorithms to analyze raw genetic data, thereby facilitating genotype-phenotype correlations and providing breeding guidance. This can be accomplished through integrating bio informatics pipelines to perform quality analysis and basecalling from the sequence or other genotypung information which is then used in a 3D protein folding software , such as iTasser or Alpha Fold, to predict substrate binding site changes in these enzymes. This model would also be trained on the chemical profile data to refine its ability to correlate protein structure models to chemotypic traits in fungi.

[0235] In some embodiments, automated analytical systems employ machine learning models, such as Random Forests, Support Vector Machines (SVMs), Convolutional Neural Networks (CNNs), Recurrent Neural Networks (RNNs), or other supervised and unsupervised learning models to analyze PCR, qPCR, sequencing, or SNPChip-derived data.

[0236] In some embodiments, the automated analytical apparatus employs Al-driven software capable of processing environmental interaction data, genotype-environment correlations, and predictive analytics to optimize cultivar selection and growth parameters.

[0237] In some embodiments, the automated system includes a large language model, image-recognition model, or specialized bioinformatics software trained to interpret genetic sequence data, identify synonymous and non-synonymous amino acid substitutions, and predict resultant biochemical profiles and phenotypic effects.

[0238] In some embodiments, the Al-driven analytical apparatus is configured to classify fungal cultivars or varieties based on genotypic classifications determined by barcoded exon sequences of the alkaloid biosynthesis genes using primer sets SEQ IDs: 001-081.

[0239] In some embodiments, the automated analytical system comprises software applications executable on computer devices, mobile devices, or cloud-based platforms, enabling remote data processing, report generation, and user interaction.

[0240] In some embodiments, the automated analytical apparatus comprises a user-friendly interface, real-time analytics dashboard, customizable analysis parameters, and automated generation of comprehensive reports for end-users, breeders, regulatory agencies, or commercial entities.

[0241] In some embodiments, these analytical reports provide recommendations and detailed guidance forbreeding strategies, quality control protocols, regulatory compliance, and commercialization strategies based on genotypic data and resultant predictive phenotype analysis.Example 11Pharmacogenomic and Pharmacomicrobiomic Integration for Patient Specific FungalChemovar Recommendations

[0242] Briefly, fungal genotypic data obtained via the methods and primers disclosed herein (e.g., SEQ IDs 001-081) is combined with human pharmacogenomic profiles — including cytochrome P450 genotypes (e.g., CYP2D6, CYP3A4) and single nucleotide polymorphisms of neurotransmitter and serotonin receptor genes — to predict individual patient response efficacy and safety for specific fungal cultivars.

[0243] In some embodiments, fungal genotype-human receptor matching includes correlating specific fungal alkaloid biosynthetic gene variants to human CNS serotonin receptor polymorphisms (e.g., 5HT2A, 5HT1A, 5HT2C) to recommend cultivars likely to produce therapeutic benefit with minimal adverse events.

[0244] In some embodiments, patient gut microbiome composition is processed via pharmacomicrobiomics analysis to identify microbial communities capable of biotransforming fungal alkaloids. This information is used to predict whether determined fungal genotype will yield effective alkaloid levels after gut metabolism.

[0245] In some embodiments, longitudinal assessments of the human microbiome are performed post consumption to evaluate microbiome shifts — such as increased abundance of beneficial taxa or decrease of pathogenic taxa — associated with the fungal genotype’s alkaloid profile; correlations between microbiome changes and clinical outcomes are established.

[0246] In some embodiments, Al-based analysis (including machine learning and neural network models) integrates multiomic inputs (fungal genotype, patient pharmacogenomics, microbiome data, clinical phenotype) to generate individualized fungal cultivar recommendations via clinician-facing software or mobile app interfaces.

[0247] In some embodiments, a clinician user interfaces display recommendations — e.g., “Recommend Cultivar A for Patient X” or “Avoid Cultivar B due to high psilocin content and CYP2D6 ultrarapid metabolism” — based on algorithmic evaluation of patient-specific genomic and microbiomic data.

[0248] In some embodiments, this system supports personalized treatment planning by identifying nutritionally compatible fungal-derived alkaloid combinations that maintain therapeutic efficacy while minimizing side effects such as anxiety or gastrointestinal upset.

[0249] In some embodiments, the fungal genotypic and metabolomic insights derived from this system are used to guide recombinant expression of biosynthetic gene clusters — cloned using SEQ IDs 001-081 — into expression hosts such as E. coli, yeast, or other microbial platforms, to produce tailored microbiome modifying alkaloid cocktails.

[0250] In some embodiments, a method comprises: sequencing a fungal cultivar’s biosynthetic cluster using SEQ025-032 primer sets; obtaining a patient’s pharmacogenomic profile and gut microbiome metagenomic profile; inputting these data into an Al-driven predictive engine; generating a fungal cultivar recommendation with confidence scores; optionally, generating a recombinant microbial strain expressing the desired alkaloid profile.

[0251] In some embodiments, this Al engine is continually refined using clinical outcome data — including standardized measures of mood, anxiety, digestive health, and side effect profiles — to enhance prediction accuracy and support iterative learning aligned with CPIC- style pharmacogenomics frameworks

[0252] In some embodiments, fungal genotypic profiles obtained via the primers and methods disclosed herein are correlated with aggregated clinical outcome data — such as standardized scales for anxiety, depression, pain relief, or gastrointestinal tolerance — to classify cultivar genotypes derived from this technology into a hierarchical ranking system that identifies which fungal genotypes yield the most effective therapeutic outcomes for each condition.

[0253] In some embodiments, this ranking system is stratified by patient pharmacogenomic subgroups (e.g., CYP2D6 poor metabolizers, CYP2C19 ultrarapid metabolizers, 5HT2A receptor polymorph carriers), enabling recommendations such as “Cultivar A preferred for anxiolytic treatment in CYP2C19 normal metabolizers; Cultivar B or C preferred for CYP2C19 ultrarapid metabolizers.”

[0254] In some embodiments, clinician-facing software displays personalized cultivar ranking lists that cross-reference patient-specific genomic data — such that for patients carrying HTR2A receptor variants, strains A and B are recommended for antidepressant effect, while strains C and D are flagged as less effective or with increased side effect risk.

[0255] In one embodiment, the system employs machine learning algorithms to continuously refine cultivar rankings based on newly input clinical efficacy and side-effect data, thereby updating treatment recommendations and improving predictive accuracy over time.

[0256] In some embodiments, the user interface allows clinicians or researchers to filter cultivars not only by therapeutic effect (e.g., analgesic, anti-inflammatory) but also by compatibility with patient genotypes, such as filtering out strains with high psilocybin conversion for patients with COMT Vall58Met polymorphs to avoid excessive psychoactive effects.

[0257] In some embodiments, the system links genotype-ranked cultivars to corresponding gene expression and alkaloid profile data (e.g., PsiM / PsiK expression levels), enabling clinicians to understand mechanistic underpinnings of clinical outcomes and thereby support evidence-based prescribing.

[0258] In some embodiments, longitudinal patient monitoring — including symptom scores and side effect logging — is integrated into the system; this data is linked to fungal genotype and patient genotype to further refine cultivar rankings in a feedback loop model aligned with real-world evidence frameworks.

[0259] In some embodiments, this ranking system supports stratified assignment of fungal genotypes to different patient cohorts in clinical trials, allowing for precision recruitment and optimized dosing strategies per genotype group.Example 12Using Genotypic Data to Support Regulatory Filings

[0260] Breifly, genomic (genotypic) and transcriptomic (gene expression) data obtained using primers and methods disclosed herein (e.g., SEQ IDs 001-081 and SEQ IDs 025-032) are compiled into a comprehensive Drug Master File (DMF) to support regulatory dossier submissions (Type II or Type IV DMF) to agencies such as the FDA or EMA. The DMF includes:

[0261] Detailed sequence and expression information for psilocybin and allied alkaloid biosynthesis genes (PsiM, PsiD, PsiK, PsiTl, PsiT2, PsiH, PsiL), integrating quantitative metrics from qPCR, RT-qPCR, digital PCR, or next-generation sequencing to confirm identity, stability, and batch-to-batch consistency of active botanical ingredients.

[0262] Genetic stability data, tracking clonal propagation over time to demonstrate absence of unintended allelic variation, copy-number changes, or gene expression drift between manufacturing lots.

[0263] Analytical correlation, linking genotypic / expression profiles to chemical assay results (e.g., LCMS quantification) to establish predictive models for consistent alkaloid content, defining critical quality attributes required under ICH-compliant Botanical Drug CMC modules.

[0264] Quality control protocols, including design of LOAs (Letters of Authorization), eCTD formatting of Modules 2-3, and adherence to FDA Master File and eCTD specifications, enabling confidential reference in sponsor IND / NDA submissions without exposing proprietary information.

[0265] GMP-aligned reasoning, articulating how genomic / expression surveillance complements traditional botanical drug controls (morphology, identity, potency) and fulfills FDA expectations for multi-step botanical quality assurance as recommended in FDA botanical drug guidance.

[0266] In some embodiments, the regulatory dossier integrates genotypic primers as validated analytical probes for authentication, identity confirmation, and quantitative expression assays. These are referenced in the DMF as controlled analytical standards supporting new drug approval or NDA / BLA filings.

[0267] In some embodiments, stability and genomic and / or transcriptomic variation data across manufacturing lots (identical genomic profiles and expression levels over multiple generations) are furnished, underscoring homologous quality attributes and supporting regulatory claims of product equivalence across batches.

[0268] In some embodiments, stability and genomic and / or transcriptomic variation data across manufacturing lots (identical genomic profiles and expression levels over multiple generations) are furnished, underscoring the presence and confirmation of the target species of the botanical drug substance to ensure regulatory compliance of ingredient verification.

[0269] In some embodiments, the DMF integrates gene expression profiles to define acceptance ranges — supporting regulatory assertions that botanicals maintain defined therapeutic alkaloid levels while excluding off-target metabolites.

[0270] In some embodiments, the submission includes bridging data linking gene expression values to phenotypic outputs (alkaloid concentrations), establishing reliability of genetic assays as proxies for chemical potency, reducing the need for excessive chemical testing across every lot.

[0271] In some embodiments, transcriptomic markers are qualified as part of a design space for botanical drug manufacturing control strategy, mapped to batch release specifications.

[0272] In some embodiments, the dossier includes conditional reference to pharmacogenomic outcome data, demonstrating how aligned genetic profiles assure safety and efficacy within chosen patient cohorts.Example 13Stability Testing Under Environmental Stress

[0273] Briefly, primers and methods disclosed herein are used to select fungal cultivars that maintain expression of alkaloid biosynthetic genes under environmental stress conditions,including but not limited to heat, drought, cold, or osmotic stress, thereby identifying genetically robust chemovars.

[0274] In some embodiments, fungal cultivars are exposed to stress conditions (e.g., 37 °C heat shock, water limitation, or simulated drought), followed by RNA extraction and quantitative gene expression analysis using qPCR, RTqPCR, or digital PCR with the primers described (SEQ IDs 001-081), to monitor stability of expression of one or more biosynthetic genes (e g., PsiM, PsiD, PsiK, PsiTl, PsiT2, PsiL, PsiH).

[0275] In some embodiments, cultivars maintaining > 80 % of baseline (non-stressed) expression levels of key biosynthesis genes under stress are selected as stable chemovars for commercial production.

[0276] In some embodiments, primer-based expression assays are combined with protein or metabolite quantification (e.g., LCMS) to confirm that RNA-level stability corresponds to stable alkaloid profiles under stress.

[0277] In some embodiments, stress expression profiling can be used iteratively at multiple growth stages (e.g., early mycelium, midfruiting body, preharvest) to evaluate cultivar stability throughout the growth cycle.

[0278] In some embodiments, stability tested cultivars are further evaluated for agronomic traits such as yield, fruiting uniformity, and resistance to sporulation under stress to support selection of high-performance production strains.

[0279] In some embodiments, expression stability data is incorporated into quality assurance master files submitted to regulatory bodies (e.g., FDA, EMA) for botanical drug approval, demonstrating genetic consistency and environmental robustness of the chemovar.

[0280] In some embodiments, stability testing under stress can be integrated with genomic DNA-based QC pipelines (e.g., using SEQ IDs 025-032) to simultaneously verify gene sequence integrity and stress-responsive expression profiles.

[0281] In some embodiments, stress stable cultivars are selected for breeding, hybridization, or transformation programs focused on generating next generation strains resistant to climate variation or growth fluctuations.

[0282] In some embodiments, stress testing assays are automated via microfluidics or high throughput qPCR platforms, enabling rapid screening of large cultivar libraries under controlled stress conditions.

[0283] In some embodiments, selected stress stable cultivars are packaged in kits comprising stress induction protocols, primers, probes, and data analysis software for use by breeders or contract manufacturers to ensure batch consistency across production lots.

[0284] In some embodiments, stress stability assessment is extended to include epigenetic markers (e.g., DNA methylation assays) that may correlate with expression stability under repeated stress cycles, enabling selection of epigenetically “locked-in” phenotypes.

[0285] In some embodiments, data from stability testing under stress is fed into Al-driven predictive models to forecast performance of new breeding lines under field-like conditions, guiding selection of cultivars with robust alkaloid production and improved resilience.Example 14End Use Delivery Formats and Extraction Optimized Chemovars

[0286] Briefly, tissue-specific gene expression profiling (e.g., RTqPCR using primers SEQ IDs 001-081) is employed to identify fungal cultivars optimized for specific delivery formats — such as microdose transdermal patches, edible gummies, oral capsules, inhalable powders, or topical formulations — and for industrial extraction processes, based on alkaloid stability, yield, and tissue localization.

[0287] In some embodiments, cultivars exhibiting > 80% retention of target alkaloids (e.g., psilocybin, norbaeocystin) in dried mycelium after freeze-drying or spray-drying are selected for microdose patch production, enabling consistent dosage units with enhanced shelf life.

[0288] In some embodiments, cultivars demonstrating high fruiting body-specific expression of psilocybin but minimal levels of off target alkaloids (e.g., baeocystin, psilocin) are selected for gummy products, ensuring better flavor and regulatory compliance with acceptable limits of psychoactive minor compounds.

[0289] In some embodiments, cultivars with uniformly distributed alkaloid content across mycelium and fruiting bodies — validated via expression assays and chemical quantification — are chosen for capsule or powdered extract formulations, minimizing batch heterogeneity.

[0290] In some embodiments, cultivars exhibiting high acid-stable alkaloid expression (confirmed via in vitro simulated gastric pH stability tests using gene-expression-guided extract profiling) are selected for oral formulations such as capsules, tablets, or tinctures, to improve bioavailability.

[0291] In some embodiments, cultivars with elevated expression of alkaloid biosynthetic genes under mild heat or solvent-based extraction conditions are preferred for industrial extraction processes (e.g., ethanol extraction, subcritical CO2), enabling higher yield and lower processing costs.

[0292] In some embodiments, cultivars with genotype-guided profiles — such as high 4hydroxytryptamine and low psilocybin — are selected for inhalable powder formats to provide rapid onset of therapeutic effects with reduced psychoactivity.

[0293] In some embodiments, cultivars with targeted expression in specific tissues (e.g., cap vs. stem) are cultivated and harvested fractionally to produce dual formulation products: isolated cap extracts for fast acting formulations and stem extracts for sustained release gummies.

[0294] In some embodiments, cultivars optimized by expression screening for high glycosylated alkaloid derivatives are selected for topical or transdermal patch use, leveraging increased skin permeability and reduced systemic exposure.

[0295] In some embodiments, the expression-based selection criteria are combined with standard extract profiling (e.g., HPLC or mass spectrometry) to validate formulation-specific suitability, ensuring consistency between genetic data and chemical performance — enabling integration into Good Manufacturing Practice (GMP) pipelines.Example 15 Exon-By-Exon Barcoding Utility and Applications

[0296] Briefly, exon barcodes are used to perform high-throughput isoform or splice variant profiling, where each transcript splice isoform is tagged via distinct exon barcodes, enabling multiplexed tracking and quantification of alternative splicing events across different tissues or disease-relevant cell types.

[0297] In some embodiments, exon-by-exon barcoding is applied for phylogenomic species resolution, by barcoding multiple conserved exonic regions across diverse taxa to build robust species trees, resolve cryptic species complexes, and detect lineage diversity.

[0298] In some embodiments, exon-by-exon barcoded libraries facilitate synthetic biology watermarking, embedding unique exon barcodes across engineered metabolic pathway genes — such as fungal alkaloid clusters — so that production strains or environmental releases are traceable, attributable, and identifiable during performance monitoring or regulatory oversight.

[0299] In some embodiments, exon barcodes support high-resolution genomics in multiple organisms by enabling transcript isoform quantification, single-cell lineage tracking, and multiplexed genotyping of large exon panels simultaneously allowing detailed analysis of gene structure, expression, and mutation at the exon level.

[0300] In some embodiments, exon barcodes are introduced into environmental DNA (eDNA) survey workflows to tag and monitor microbial, fungal, or macroorganism populations within soil, water, or air samples, enabling fine-scale tracking of population dynamics, species presence, and environmental change with exon-level taxonomic or functional resolution.

[0301] This disclosure contains the following Sequences:

[0302] SEQ ID NO.: 065: Psi M - GenBank: KY984100.1

[0303] >KY984100.1 Psilocybe cubensis strain FSU 12409 norbaeocystin methyltransferase (psiM) mRNA, complete cds

[0304] ATGCATATCAGAAATCCTTACCGTACACCAATTGACTATCAAGCACTT TCAGAGGCCTTCCCTCCCCTCAAGCCATTTGTGTCTGTCAATGCAGATGGTACCAGTTCTGTTGACCTCACTATCCCAGAAGCCCAGAGGGCGTTCACGGCCGCTCTTCT TCATCGTGACTTCGGGCTCACCATGACCATACCAGAAGACCGTCTGTGCCCAACA GTCCCCAATAGGTTGAACTACGTTCTGTGGATTGAAGATATTTTCAACTACACGA ACAAAACCCTCGGCCTGTCGGATGACCGTCCTATTAAAGGCGTTGATATTGGTAC AGGAGCCTCCGCAATTTATCCTATGCTTGCCTGTGCTCGGTTCAAGGCATGGTCT ATGGTTGGAACAGAGGTCGAGAGGAAGTGCATTGACACGGCCCGCCTCAATGTC GTCGCGAACAATCTCCAAGACCGTCTCTCGATATTAGAGACATCCATTGATGGTC CTATTCTCGTCCCCATTTTCGAGGCGACTGAAGAATACGAATACGAGTTTACTAT GTGTAACCCTCCATTCTACGACGGTGCTGCCGATATGCAGACTTCGGATGCTGCC AAAGGATTTGGATTTGGCGTGGGCGCTCCCCATTCTGGAACAGTCATCGAAATGT CGACTGAGGGAGGTGAATCGGCTTTCGTCGCTCAGATGGTCCGTGAGAGCTTGA AGCTTCGAACACGATGCAGATGGTACACGAGTAACTTGGGAAAGCTGAAATCCT TGAAAGAAATAGTGGGGCTGCTGAAAGAACTTGAGATAAGCAACTATGCCATTA ACGAATACGTTCAGGGGTCCACACGTCGTTATGCCGTTGCGTGGTCTTTCACTGA TATTCAACTGCCTGAGGAGCTTTCTCGTCCCTCTAACCCCGAGCTCAGCTCTCTTT TCTAG

[0305] SEQ ID NO.: 082 - PsiM Unprot ASU62238

[0306] >ASU62238 norbaeocystin methyltransferase [Psilocybe cubensis]

[0307] MHIRNPYRTPIDYQALSEAFPPLKPFVSVNADGTSSVDLTIPEAQRAFTAA LLHRDFGLTMTIPEDRLCPTVPNRLNYVLWIEDIFNYTNKTLGLSDDRPIKGVDIGTG ASAIYPMLACARFKAWSMVGTEVERKCIDTARLNVVANNLQDRLSILETSIDGPILVPIFEATEEYEYEFTMCNPPFYDGAADMQTSDAAKGFGFGVGAPHSGTVIEMSTEGGESAFVAQMVRESLKLRTRCRWTSNLGKLSLKEIVGLLKELEISNYAINEYVQGSTRRYAVAWSFTDIQLPEELSRSNPELS SLF

[0308] SEQ ID NO.: 066: Psi M - GenBank: KY984103.1

[0309] >KY984103.1 Psilocybe cyanescens strain FSU 12416 norbaeocystin methyltransferase (psiM) mRNA, complete cds

[0310] ATGC AT ATC AGGAACCC AT ACCGCGATGGTGTTGACT ACC AAGC ACTC GCTGAAGCATTTCCGGCTCTCAAACCACATGTCACAGTAAATTCAGACAATACGA CCTCCATCGACTTTGCTGTGCCAGAAGCCCAAAGACTGTATACAGCTGCCCTTCT ACACCGGGATTTCGGTCTTACGATCACACTCCCGGAAGACCGTCTTTGTCCGACA GTGCCTAATCGGCTCAACTATGTCCTTTGGGTTGAAGATATCCTTAAAGTCACTT CTGATGCTCTCGGTCTTCCGGATAATCGTCAAGTTAAGGGGATCGATATCGGAAC TGGCGCATCAGCGATATATCCCATGCTCGCATGCTCTCGTTTTAAGACATGGTCC ATGGTTGCAACAGAGGTAGACCAGAAGTGTATTGACACTGCTCGTCTCAACGTC ATTGCCAACAACCTCCAAGAACGTCTCGCAATTATAGCCACCTCCGTCGATGGTC CTATACTTGTCCCCCTCTTGCAGGCGAATTCTGATTTTGAGTACGATTTTACGATG TGTAATCCGCCCTTCTACGATGGGGCATCCGACATGCAGACATCGGATGCTGCGA AGGGGTTTGGATTCGGTGTGAACGCTCCGCATACCGGCACGGTGCTCGAGATGG CCACCGAGGGAGGTGAATCGGCCTTCGTAGCCCAAATGGTCCGCGAAAGTTTGA ATCTTCAAACACGATGCAGGTGGTTCACGAGTAATTTGGGGAAATTGAAGTCCTT GTACGAAATTGTGGGGCTGCTGCGAGAACATCAGATAAGTAACTACGCAATCAA CGAATACGTCCAAGGAGCCACTCGTCGATATGCGATTGCATGGTCGTTCATCGAT GTTCGACTGCCTGATCATTTGTCCCGTCCATCTAACCCCGACCTAAGCTCTCTTTT CTAG

[0311] SEQ ID NO.: 067: Psi M - GenBank: KY984103.1. pep

[0312] >ASU62241.1 norbaeocystin methyltransferase [Psilocybe cyanescens]

[0313] MHIRNPYRDGVDYQALAEAFPALKPHVTVNSDNTTSIDFAVPEAQRLYTA ALLHRDFGLTITLPEDRLCPTVPNRLNYVLWVEDILKVTSDALGLPDNRQVKGIDIGT GASAIYPMLACSRFKTWSMVATEVDQKCIDTARLNVIANNLQERLAIIATSVDGPILV PLLQANSDFEYDFTMCNPPFYDGASDMQTSDAAKGFGFGVNAPHTGTVLEMATEG GESAFVAQMVRESLNLQTRCRWFTSNLGKLKSLYEIVGLLREHQISNYAINEYVQGA TRRYAIAWSFIDVRLPDHLSRPSNPDLSSL

[0314] SEQ ID NO.: 068: Psi K - GenBank: KY984099.1

[0315] >KY984099.1 Psilocybe cubensis strain FSU 124094-hydroxytryptamine kinase(psiK) mRNA, complete cds

[0316] ATGGCGTTCGATCTC AAGACTGAAGACGGCCTC ATC AC AT ATCTC ACTAAACATCTTTCTTTGGACGTCGACACGAGCGGAGTGAAGCGCCTTAGCGGAGGCTTTGTCAATGTAACCTGGCGCATTAAGCTCAATGCTCCTTATCAAGGTCATACGAGCATCATCCTGAAGCATGCTCAGCCGCACATGTCTACGGATGAGGATTTTAAGATAGGTGTAGAACGTTCGGTTTACGAATACCAGGCTATCAAGCTCATGATGGCCAATCGGGAGGTTCTGGGAGGCGTGGATGGCATAGTTTCTGTGCCAGAAGGCCTGAACTACGACTTAGAGAATAATGCATTGATCATGCAAGATGTCGGGAAGATGAAGACCCTTTTAGATTATGTCACCGCCAAACCGCCACTTGCGACGGATATAGCCCGCCTTGTTGGGACAGAAATTGGGGGGTTCGTTGCCAGACTCCATAACATAGGCCGCGAGAGGCGAGACGATCCTGAGTTCAAATTCTTCTCTGGAAATATTGTCGGAAGGACGACTTCAGACCAGCTGTATCAAACCATCATACCCAACGCAGCGAAATATGGCGTCGATGACCCCTTGCTGCCTACTGTGGTTAAGGACCTTGTGGACGATGTCATGCACAGCGAAGAGACCCTTGTCATGGCGGACCTGTGGAGTGGAAATATTCTTCTCCAGTTGGAGGAGGGAAACCCATCGAAGCTGCAGAAGATATATATCCTGGATTGGGAACTTTGCAAGTACGGCCCAGCGTCGTTGGACCTGGGCTATTTCTTGGGTGACTGCTATTTGATATCCCGCTTTCAAGACGAGCAGGTCGGTACGACGATGCGGCAAGCCTACTTGCAAAGCTATGCGCGTACGAGCAAGCATTCGATCAACTACGCCAAAGTCACTGCAGGTATTGCTGCTCATATTGTGATGTGGACCGACTTTATGCAGTGGGGGAGCGAGGAAGAAAGGATAAATTTTGTGAAAAAGGGGGTAGCTGCCTTTCACGACGCCAGGGGCAACAACGACAATGGGGAAATTACGTCTACCTTACTGAAGGAATCATCCACTGCGTAA

[0317] SEQ ID NO.: 069: Psi K - GenBank: KY984099.1.pep

[0318] >ASU62237.1 4-hydroxytryptamine kinase [Psilocybe cubensis]

[0319] MAFDLKTEDGLITYLTKHLSLDVDTSGVKRLSGGFVNVTWRIKLNAPYQGHTSIILKHAQPHMSTDEDFKIGVERSVYEYQAIKLMMANREVLGGVDGIVSVPEGLNYDLENNALIMQDVGKMKTLLDYVTAKPPLATDIARLVGTEIGGFVARLHNIGRERRDDPEFKFFSGNIVGRTTSDQLYQTIIPNAAKYGVDDPLLPTVVKDLVDDVMHSEETLVMADLWSGNILLQLEEGNPSKLQKIYILDWELCKYGPASLDLGYFLGDCYLISRFQDEQVGTTMRQAYLQSYARTSKHSINYAKVTAGIAAHIVMWTDFMQWGSEEERINFVKKGVAAFHDARGNNDNGEITSTLLKESSTA

[0320] SEQ ID NO.: 070: PsiD - GenBank: KY984101.1

[0321] >KY984101.1 Psilocybe cubensis strain FSU 12409 tryptophan decarboxylase(psiD) mRNA, complete cds

[0322] ATGCAGGTGATACCCGCGTGCAACTCGGCAGCAATAAGATCACTATGTCCTACTCCCGAGTCTTTTAGAAACATGGGATGGCTCTCTGTCAGCGATGCGGTCTACAGCGAGTTCATAGGAGAGTTGGCTACCCGCGCTTCCAATCGAAATTACTCCAACGAGTTCGGCCTCATGCAACCTATCCAGGAATTCAAGGCTTTCATTGAAAGCGACCCGGTGGTGCACCAAGAATTTATTGACATGTTCGAGGGCATTCAGGACTCTCCAAGGAATTATCAGGAACTATGTAATATGTTCAACGATATCTTTCGCAAAGCTCCCGTCTACGGAGACCTTGGCCCTCCCGTTTATATGATTATGGCCAAATTAATGAACACCCGAGCGGGCTTCTCTGCATTCACGAGACAAAGGTTGAACCTTCACTTCAAAAAACTTTTCGATACCTGGGGATTGTTCCTGTCTTCGAAAGATTCTCGAAATGTTCTTGTGGCCGACCAGTTCGACGACAGACATTGCGGCTGGTTGAACGAGCGGGCCTTGTCTGCTATGGTTAAACATTACAATGGACGCGCATTTGATGAAGTCTTCCTCTGCGATAAAAATGCCCCATACTACGGCTTCAACTCTTACGACGACTTCTTTAATCGCAGATTTCGAAACCGAGATATCGACCGACCTGTAGTCGGTGGAGTTAACAACACCACCCTCATTTCTGCTGCTTGCGAATCACTTTCCTACAACGTCTCTTATGACGTCCAGTCTCTCGACACTTTAGTTTTCAAAGGAGAGACTTATTCGCTTAAGCATTTGCTGAATAATGACCCTTTCACCCCACAATTCGAGCATGGGAGTATTCTACAAGGATTCTTGAACGTCACCGCTTACCACCGATGGCACGCACCCGTCAATGGGACAATCGTCAAAATCATCAACGTTCCAGGTACCTACTTTGCGCAAGCCCCGAGCACGATTGGCGACCCTATCCCGGATAACGATTACGACCCACCTCCTTACCTTAAGTCTCTTGTCTACTTCTCTAATATTGCCGCAAGGCAAATTATGTTTATTGAAGCCGACAACAAGGAAATTGGCCTCATTTTCCTTGTGTTCATCGGCATGACCGAAATCTCGACATGTGAAGCCACGGTGTCCGAAGGTCAACACGTCAATCGTGGCGATGACTTGGGAATGTTCCATTTCGGTGGTTCTTCGTTCGCGCTTGGTCTGAGGAAGGATTGCAGGGCAGAGATCGTTGAAAAGTTCACCGAACCCGGAACAGTGATCAGAATCAACGAAGTCGTCGCTGCTCTAAAGGCTTAG

[0323] SEQ ID NO.: 071: PsiD - GenBank: KY984101.1.pep

[0324] >ASU62239.1 tryptophan decarboxylase [Psilocybe cubensis]

[0325] MQVIPACNSAAIRSLCPTPESFRNMGWLSVSDAVYSEFIGELATRASNRNYSNEFGLMQPIQEFKAFIESDPVVHQEFIDMFEGIQDSPRNYQELCNMFNDIFRKAPVYGDLGPPVYMIMAKLMNTRAGFSAFTRQRLNLHFKKLFDTWGLFLSSKDSRNVLVADQFDDRHCGWLNERALSAMVKHYNGRAFDEVFLCDKNAPYYGFNSYDDFFNRRFRNRDIDRPVVGGVNNTTLISAACESLSYNVSYDVQSLDTLVFKGETYSLKHLLNNDPFTPQFEHGSILQGFLNVTAYHRWHAPVNGTIVKIINVPGTYFAQAPSTIGDPIPDNDYDPPPYLKSLVYFSNIAARQIMFIEADNKEIGLIFLVFIGMTEISTCEATVSEGQHVNRGDDLGMFHFGGSSFALGLRKDCRAEIVEKFTEPGTVIRINEVVAALKA

[0326] SEQ ID NO.: 072: PsiTl - GenBank: MF000991.1

[0327] >MF000991.1 Psilocybe cubensis strain FSU 12409 putative transporter (psiTl) gene, complete cds

[0328] ATGAATCCTACGACCGCCACCGATGCTCATGAACGAACATCGCTGTTGTCTGGAAGACCGCAATCTGCTGCAAATTCGACGGCTCCATATGAGCGACAAGTTCAACCATCGCGAAAATCCCAATGCTTTACTCCAGTGACCGTGATCACCATAATTACGCTCATATATCGTCTCGCGACAACGATGGTAATCACGACCAACATTCGGGTTCTCCACACAGTTGCATGCCAGCTTTGGTATCATGTCAACGATCCCGACGTATTTCCAGGGGGAAATATACCAGAAAAATATTGTGCGCTACCTGGTGTAGACAAGTATTATGCTATAATGGTGTCTATGACCACTGTCATAGATGGTCTTGGAGGTATGATTGGGATGGATTACGTCGCAATTCGAATCACTAATAGTAATATGTTGTTCCAGGTATACTTGGGACCGGCATAGCCAGCTACATGTCATCTCGTTTTGGCAGAAAGCCTGTTCTCATGTTCCTGCTTTCCTGTACCATGATCGATCACCTCGCCATCCTGACAGTCCAAAATGTATACGGATGGAAGCAGTTGGTAACATTTGGGTTAATTATGATTGTTGAAACCATTGGAAATGAGAACACCACAGTATTTCTGGTGAGCATGTACGTGGTTGATGTTACTGAGGCTGAGAGAAGGTCAGCTTTTTTTTTCTTATAAATTCACCTATGAACCCAAAGATGTAACCTATCCACAACAGGACCGCTGCTCTGAGTTCAATTACTGGCTGGCTTGTTCTCGGTAATTCCCTCGTTTTTCTATGTCCAGTGCTAACTCATCAGATGGCATTCAGGAGGCGCCCTCGCCTATTCAATAGGCGGATCTATAACAACTTTTTTACACTCCAACTCTGCCGTATACATTGTATCGTTCAGTGTCACTGGCATCGTTCTAACATTCACCGCCTTTGTTCTCCCTGAATCATTCCCTGCTGAAAAAAGAGATCTCTTGCGGCTTGAACGACTGGCAGAAACCCGTGGACACAGCCAGTCCTGGACCCAAAAAATCAAAGCTGTGGCAACTGTCGCATTGGAACCTATGGAATTGCTAAAACCGACATTTAACCCCATAACGGGGAAGGCAAATTGGCGGCTTGTATACTGCGCCCTCCACTCGTTTATTGTCACTCTAGCAGATGCGTATGCTCTTCCTGCCATGTTGATATTTTTCACTACCCAGTATTCATATACACCCGCTCAGGTTGGTTTTAGTTATAGATTCGCATGATACCTTCTTGATTTGTTCTTTCAGATGGGATATGTTATGACGACGTACAGTGTCTCCAGTGTGTTTGTTTTGGCGATAGCCTTACCCCTGTTTATTCGATGGTTCAAGCCCCTGTATAATAATACTCAAACGAAGTCTGTCCCAGATGAAGGGGATGGACTCCGTGCGACCGACTCTGGAGAAGCGGGTGTGCACACACAAGAGGTCGTTGTTTCGGAAACCTCTGATCGCATGGACGTCCATATCACTGTCATATCCTGGACCATAGAGTCATTAGCATACATAGTTCTCGGTACTGTGGGTTCATTTTACGCACAACTTTTAGGTCGGTCAATGCCAGCTCTTTTCTTCCTCCAGTTGGTTGATTGACCCCCTTTCCCCCTAAGCCGTTGCCTCTATTGGCTTTGGATCTGGACGCATTCCAGGAATTCGAAGCCTAG

[0329] SEQ ID NO.: 073: PsiTl - GenBank: MF000991.1.pep

[0330] >ASU62244.1 putative transporter [Psilocybe cubensis]

[0331] MNPTTATDAHERTSLLSGRPQSAANSTAPYERQVQPSRKSQCFTPVTVITIITLIYRLATTMVITTNIRVLHTVACQLWYHVNDPDVFPGGNIPEKYCALPGVDKYYAIMVSMTTVIDGLGGILGTGIASYMSSRFGRKPVLMFLLSCTMIDHLAILTVQNVYGWKQLVTFGLIMIVETIGNENTTVFLVSMYVVDVTEAERRTAALSSITGWLVLGGALAYSIGGSITTFLHSNSAVYIVSFSVTGIVLTFTAFVLPESFPAEKRDLLRLERLAETRGHSQSWTQKIKAVATVALEPMELLKPTFNPITGKANWRLVYCALHSFIVTLADAYALPAMLIFFTTQYSYTPAQMGYVMTTYSVSSVFVLAIALPLFIRWFKPLYNNTQTKSVPDEGDGLRATDSGEAGVHTQEVVVSETSDRMDVHITVISWTIESLAYIVLGTVGSFYAQLLGRP LPLLALDLDAFQEFEA

[0332] SEQ ID NO. : 074: PsiT2 - GenBank: MF000992.1

[0333] >MF000992.1 Psilocybe cubensis strain FSU 12409 putative transporter (psiT2) gene, complete cds

[0334] ATGTCTCTGGAGCGCTCAACAAGTCCAAATCCTACCGAGCGTACATCTCTTCTATCTGACACTGCGTCTACCATTTCATCCAGAGATGACGTTGAACAGTCAAGTCTGAAGCAAAGGCGCACGCCTATACCAACTGGACAACTTGGCGGTAAGGTCTCAATGCATTCAATTATTATAAACGCTGAGGGGTATCACTTTTGCAGTTCTATTCTCTATTAGATTCACCGAACCTATAATATACAGTCATTTATGGCCTTATATTAACCAGTTTGTGAATGATATCGGCGTCTCTGATGGGAATCCACGTAATGTTGGGTTCTACAGTGGGTTGATCGTAAGCTTTTTTGTTTGGCTCTTTGCATTATGGTCATAACGAAGCCATTAGGAAAGTGTATTTGCTTGCGGAGAAGTTTGCTCTATCTTCATGCTGTCGAGGCTTTCAGGTGGGCAAAGGTACTCTTCTTAACCAGCGATGGAGCTATGAATTAACGGCCATACAGATAGAATAGGTCGTCGACCGGTGCTACTCCCATCTGCACTGGGTATTGCAGTGTTTACTGCTCTGTTTGGTTTATCAAGCTCGTTTACCATGATGTTGACTCTTCGAGTTTGCGCTGGTCTCTTAGCCGGAGCGACGCCTATAGTACACTCCATTGTCAGCGAACTTACTGATGATACCAATAATGCACTCGTTGTACCATTATATGGCCTCATAACTCCCATCGGATTTGCCATTGGGTATACAATACGCTCTTACTGAAGTGACGGCAAACTGACATTTCTTTCTTCATAGGCCCCTGATCGGGGGAACCCTTGAACACGCTGCAACTAAGTATCCCAACGTCTTTGGATATGAGCTTTTTCGAAAGTACCCCTACTTCTTACCATCGTTTGTTCCATGCTGCATGGCTATCGTGGGCGTCACATTCGGCTACTTCTTTTTAAAAGAAGTGGGTTTTTCCTTTCATTTCAATCCGGATCTTATTTACTATTTTTTTTTGGTCAGACGCTTCCTAGTTTAGTCAAGTCTAAAAAAAGACTTGAACGTCAACGGTCCTCCTCTTCTATATCATCAGAGAACTCTACTCTATACGGTGCCACAGAGCATATCAGGGACTCAACAGAAGAAACCGCGGCGGACGAGGAACCCGATTCCAAGCCGAAGGGTATTACTGAGTTAATTCGGGATCCTTCTATACGGGCTATAATGGCTTCTGGTACATTTTTGATGTTTCTATACACGAGTTCCGATGTGATATTCTCACTCTACTGCTTTACTGCTGTTGAGGATGGAGGCGTTGGATTGCCTGTGAGTCGTTGAGTAGTAATCTGTTTCCTTATGCTCGCACTTACTCTTTGCATAGCCCGAGAAGATCGGTTATGCATTCTCCGTTGCAGGCCTCATAGCTATGCTCATGCAGCTTTGCATAACGCCATGGGTGCTCCGTACTTTTGACAAGGCTAAAGTATACCACTTCTGCATGTGCTCGTTCCCTCTCGTGTTTGCACTCATGGGATGCCTGAATCCCCTCGCTCAAACTGGGTACAGTGAAATTAACAAAACACTTCATCCGACCACTACGGGACTGCTCTATGCTGCAATAGCCATCTTGCTCCTTCTAGCCCGTGTCTGCGTTATGGCATTCCCGTATGTTTTACTACGTGCTGATTTAAGTGTGTGTGTCTTACGAGCTATTTACAGTATCAGCATGATGCTGGTTAAACAAACGGCCGATAAGCATTCGCTTGCCACTGCGAATGGCCTCGTGCAAGTGGCCATGACCCTTGCAAGAGCATTCTGCCCTACAATCTCAAGGTATAGCTTATCTCTTCTATGGGATTACAACCTGTCGTATTTACACACTCTTTTTCAAGCTCGGTGTTTGCTTATTCTACTAGCCATAATATCCTGGGTGGACATTTCTGGGTGGTAGTGATGGTATTCATTTCCCTGGTTGGGGTATGGCAATCTACGAAAATTGCCAGGGTCACAAAAACAAAAGAGCAATTGTGA

[0335] SEQ ID NO.: 075: PsiT2 - GenBank: MF000992.1.pep

[0336] >sp|P0DPB2.1 |PSIT2_PSICU RecName: Full=Major facilitator-type transporter psiT2; AltName: Full=Psilocybin biosynthesis cluster transporter 2

[0337] MSLERSTSPNPTERTSLLSDTASTISSRDDVEQSSLKQRRTPIPTGQLGGKVSMHSIIINAEGHLWPYINQFVNDIGVSDGNPRNVGFYSGLIESVFACGEVCSIFMLSRLSDRIGRRPVLLPS ALGIAVFTALFGLS S SFTMMLTLRVC AGLL AGATPIVHSIVSELTDDTNNALVVPLYGLITPIGFAIGPLIGGTLEHAATKYPNVFGYELFRKYPYFLPSFVPCCMAIVGVTFGYFFLKETLPSLVKSKKRLERQRSSSSISSENSTLYGATEHIRDSTEETAADEEPDSKPKGITELIRDPSIRAIMASGTFLMFLYTSSDVIFSLYCFTAVEDGGVGLPPEKIGYAFSVAGLIAMLMQLCITPWVLRTFDKAKVYHFCMCSFPLVFALMGCLNPLAQTGYSEINKTLHPTTTGLLYAAIAILLLLARVCVMAFPISMMLVKQTADKHSLATANGLVQVAMTLARAFCPTISSSVFAYSTSHNILGGHFWVVVMVFISLVGVWQSTKIARVTKTKEQL

[0338] SEQ ID NO.: 076: PsiH - Genbank: MF000993.1

[0339] >MF000993.1 Psilocybe cubensis strain FSU 12409 putative monooxygenase(psiH) gene, complete cds

[0340] ATGATCGCTGTACTATTCTCCTTCGTCATTGCAGGATGCATATACTACATCGTTTCTCGTAGAGTGAGGCGGTCGCGCTTGCCACCAGGGCCGCCTGGCATTCCTATTCCCTTCATTGGGAACATGTTTGATATGCCTGAAGAATCTCCATGGTTAACATTTCTACAATGGGGACGGGATTACAGTCTGTCTTGCCGCGTTGACTTCTAATATATGAACAGCTAATATATTGTCAGACACCGATATTCTCTACGTGGATGCTGGAGGGACAGAAATGGTTATTCTTAACACGTTGGAGACCATTACCGATCTATTAGAAAAGCGAGGGTCCATTTATTCTGGCCGGTGAGCTGATGTTGAGTTTTTTGCAATTGAATTTGTGGTCACACGTTTCCAGACTTGAGAGTACAATGGTCAACGAACTTATGGGGTGGGAGTTTGACTTAGGGTTCATCACATACGGCGACAGGTGGCGCGAAGAAAGGCGCATGTTCGCCAAGGAGTTCAGTGAGAAGGGCATCAAGCAATTTCGCCATGCTCAAGTGAAAGCTGCCCATCAGCTTGTCCAACAGCTTACCAAAACGCCAGACCGCTGGGCACAACATATTCGCCAGTAAGTACTACTTGAGGAAAATAGCGTACGCTTCGCTGACCGGTCCGTACATCAAAGTCAGATAGCGGCAATGTCACTGGATATTGGTTATGGAATTGATCTTGCAGAAGACGACCCTTGGCTGGAAGCGACCCATTTGGCTAATGAAGGCCTCGCCATAGCATCAGTGCCGGGCAAATTTTGGGTCGATTCGTTCCCTTCTCGTGAGCATCCTTCTTCTATGTAGGAAGGGAAGGAGTCTAACAAGTGTTAGTAAAATACCTTCCTGCTTGGTTCCCAGGTGCTGTCTTCAAGCGCAAAGCGAAGGTCTGGCGAGAAGCCGCCGACCATATGGTTGACATGCCTTATGAAACTATGAGGAAATTAGCAGTTAGTCAAATGCGTTCTCCCCGTATTTTTTCAATACTCTAACTTCAGCTCACAGCCTCAAGGATTGACTCGTCCGTCGTATGCTTCAGCTCGTCTGCAAGCCATGGATCTCAACGGTGACCTTGAGCATCAAGAACACGTAATCAAGAACACAGCCGCAGAGGTTAATGTCGGTAAGTCAAAAGCGTCCGTCGGCAATTCAAAATTCAGGCGCTAAAGTGGGTCTTCTCACCAAGGTGGAGGCGATACTGTAAGGATTTCTCAATCGTTAGAGTATAAGTGTTCTAATGCAGTACATACTCCACCAACCAGACTGTCTCTGCTATGTCTGCGTTCATCTTGGCCATGGTGAAGTACCCTGAGGTCCAGCGAAAGGTTCAAGCGGAGCTTGATGCTCTGACCAATAACGGCCAAATTCCTGACTATGACGAAGAAGATGACTCCTTGCCATACCTCACCGCATGTATCAAGGAGCTTTTCCGGTGGAATCAAATCGCACCCCTCGCTATACCGCACAAATTAATGAAGGACGACGTGTACCGCGGGTATCTGATTCCCAAGAACACTCTAGTCTTCGCAAACACCTGGTGAGGCTGTCCATTCATTCCTAGTACATCCGTTGCCCCACTAATAGCATCTTGATAACAGGGCAGTATTAAACGATCCAGAAGTCTATCCAGATCCCTCTGTGTTCCGCCCAGAAAGATATCTTGGTCCTGACGGGAAGCCTGATAACACTGTACGCGACCCACGTAAAGCGGCATTTGGCTATGGACGACGAAATTGGTAAGTGCGCTTTCAGAACCCCCCCTTCCGTTGACTAGTGCCATGCGCGCATACAATATCGCTATTGATCTGATATAACTTCCCTGCGGCATTTATTTTGGCATTCCTTTAGTCCCGGAATTCATCTAGCGCAGTCGACGGTTTGGATTGCAGGGGCAACCCTCTTATCAGCGTTCAATATCGAGCGACCTGTCGATCAGAATGGGAAGCCCATTGACATACCGGCTGATTTTACTACAGGATTCTTCAGGTAGCTAATTTCCGTCTTTGTGTGCATAATACCCCTAACGACGCACGTTTACCTTTTTGTAAAGACACCCAGTGCCTTTCCAGTGCAGGTTTGTTCCTCGAACAGAGCAAGTCTCACAGTCGGTATCCGGACCCTGA

[0341] SEQ ID NO.: 077: PsiH - Genbank: ASU62246.1.pep

[0342] >ASU62246.1 putative monooxygenase [Psilocybe cubensis]

[0343] MIAVLFSFVIAGCIYYIVSRRVRRSRLPPGPPGIPIPFIGNMFDMPEESPWLTFLQWGRDYNTDILYVDAGGTEMVILNTLETITDLLEKRGSIYSGRLESTMVNELMGWEFDLGFITYGDRWREERRMFAKEFSEKGIKQFRHAQVKAAHQLVQQLTKTPDRWAQHIRHQIAAMSLDIGYGIDLAEDDPWLEATHLANEGLAIASVPGKFWVDSFPSLKYLPAWFPGAVFKRKAKVWREAADHMVDMPYETMRKLAPQGLTRPSYASARLQAMDLNGDLEHQEHVIKNTAAEVNVGGGDTTVSAMSAFILAMVKYPEVQRKVQAELDALTNNGQIPDYDEEDDSLPYLTACIKELFRWNQIAPLAIPHKLMKDDVYRGYLIPKNTLVFANTWAVLNDPEVYPDPSVFRPERYLGPDGKPDNTVRDPRKAAFGYGRRNCPGIHLAQSTVWIAGATLLSAFNIERPVDQNGKPIDIPADFTTGFFRHPVPFQCRFVPRTEQVSQSVSGP

[0344] The various features and processes described above may be used independently of one another or may be combined in various ways. All possible combinations and subcombinations are intended to fall within the scope of this disclosure. In addition, certain method or process blocks may be omitted in some implementations. The methods and processes described herein are also not limited to any particular sequence, and the blocks or states relating thereto can be performed in other sequences that are appropriate. For example, described blocks or states may be performed in an order other than that specifically disclosed, or multiple blocks or states may be combined in a single block or state. The example blocks or states may be performed in serial, in parallel, or in some other manner. Blocks or states may be added to or removed from the disclosed example embodiments. The example systems and components described herein may be configured differently than described. For example, elements may be added to, removed from, or rearranged compared to the disclosed example embodiments.

[0345] Conditional language used herein, such as, among others, “can”, “could”, “might”, “may”, “e.g ”, and the like, unless specifically stated otherwise, or otherwise understood within the context as used, is generally intended to convey that certain embodiments include, while other embodiments do not include, certain features, elements, and / or steps. Thus, such conditional language is not generally intended to imply that features, elements and / or steps are in any way required for one or more embodiments or that one or more embodiments necessarily include logic for deciding, with or without author input or prompting, whether these features, elements and / or steps are included or are to be performed in any particular embodiment. The terms “comprising”, “including”, “having.” and the like are synonymous and are used inclusively, in an open-ended fashion, and do not exclude additional elements, features, acts, operations, and so forth. Also, the term “or” is used in its inclusive sense (and not in its exclusive sense) so that when used, for example, to connect a list of elements, the term “or” means one, some, or all of the elements in the list.

[0346] While certain example embodiments have been described, these embodiments have been presented by way of example only, and are not intended to limit the scope of the inventions disclosed herein. Thus, nothing in the foregoing description is intended to imply that any particular feature, characteristic, step, module, or block is necessary or indispensable. Indeed, the novel methods and systems described herein may be embodied in a variety of other forms; furthermore, various omissions, substitutions and changes in the form of the methods and systems described herein may be made without departing from the spiritof the inventions disclosed herein. The accompanying claims and their equivalents are intended to cover such forms or modifications as would fall within the scope and spirit of certain of the inventions disclosed herein.REFERENCES:1. Chue, Peng, et al. “A Review of Aeruginascin and Potential Entourage Effect in Hallucinogenic Mushrooms.” Journal of Psychopharmacology, vol. 36, no. 7, 2022, pp. 1234-1245. DOI: 10.1177 / 0269881122110530.2. “Convergent Evolution of Biosynthetic Pathway.” ResearchGate, www.researchgate.net / publication / 326620321_Convergent_evolution_of_psilocybin_bios ynthesis_by_psychedelic_mushrooms / figures?lo=l. Accessed 31 May 2024.3. “Effect of Chemically Synthesized Psilocybin and Psychedelic Mushroom Extract on Molecular and Metabolic Profiles in Mouse Brain.” Neuroscience Letters, vol. 764, 2024, pp. 1-10. DOI: 10.1016 / j.neulet.2023.136887.4. “Enzyme Synthesis of Psilocybin.” Angewandte Chemie International Edition, www. onlinelibrary .wiley. com / doi / abs / 10.1002 / anie.201705489. Accessed 31 May 2024.5. “Ethnobotany of Psilocybin Producing Mushrooms.” ScienceDirect, www.sciencedirect.com / science / article / pii / 0378874184900072. Accessed 31 May 2024.6. Goel, Dhruv, and Ayush Zilate. “Potential Therapeutic Effects of Psilocybin: A Systematic Review.” Journal of Affective Disorders, vol. 301, 2022, pp. 38-47. DOI: 10.1016 / j.jad.2021.12.063.7. Gotvaldova, Kamila, et al. “Extensive Collection of Psychotropic Mushrooms with Determination of Their Tryptamine Alkaloids.” Journal of Natural Products, vol. 85, no.2, 2022, pp. 345-357. DOI: 10.1021 / acs.jnatprod. lcO 1000.8. “Interesting Blog on Feeding Precursors and Biosynthesis.” Psilosophy, en.psilosophy.info / biosynthesis_of_psilocybin.html. Accessed 31 May 2024.9. “Magic Mushrooms.” Psychedelic Research Bulletin, 2023.10. “MycoBank.” MycoBank, www.mycobank.org / page / Home. Accessed 31 May 2024.11. “Psilocybin-Derivatives.” Psychedelic Review, www.psychedelicreview.com / scientists- bioengineer-s-cerevisiae-to-produce-psilocybin-and-related-tryptamines / . Accessed 31 May 2024.12. Venturella, Giovanni, et al. “Medicinal Mushrooms: Bioactive Compounds, Use, and Clinical Trials.” International Journal of Medicinal Mushrooms, vol. 23, no. 5, 2021, pp. 429-450. DOI: 10.1615 / IntJMedMushrooms.2021038310.13. Chen, He-Ping, and Ji-Kai Liu. “Secondary Metabolites from Higher Fungi.” Progress in the Chemistry of Organic Natural Products, vol. 106, 2017, pp. 1-201. doi: 10.1007 / 978-3- 319-59542-9_l. PubMed, https: / / pubmed.ncbi.nlm.nih.gov / 28762089 / .14. Lin, Hsiao-Ching, et al. “Biosynthesis of Bioactive Natural Products from Basidiomycota.” Organic & Biomolecular Chemistry, vol. 17, no. 5, 2019, pp. 1027- 1036. Royal Society of Chemistry, doi: 10.1039 / C80B02774A.15. Chen, Y., Chen, Y., Tang, Y., Zhang, Q., & Tang, H. “Diversity of secondary metabolites from fungi.” 2017.16. Fricke, J., Blei, F., & Hoffmeister, D. “Enzymatic synthesis of psilocybin.” 2017.17. Carhart-Harris, R. L., Bolstridge, M., Rucker, J., Day, C. M. J., Erritzoe, D., Kaelen, M., ... & Nutt, D. J. “Psilocybin with psychological support for treatment-resistant depression: an open-label feasibility study.” The Lancet Psychiatry, vol. 3, no. 7, 2016, pp. 619-627.18. Doudna, J. A., & Charpentier, E. “The new frontier of genome engineering with CRISPR- Cas9.” Science, vol. 346, no. 6213, 2014, p. 1258096.Mullis, K., & Faloona, F. “Specific synthesis of DNA in vitro via a polymerase-catalyzed chain reaction.” Methods in Enzymology, vol. 155, 1987, pp. 335-350. Michielse, C. B., Hooykaas, P. J., Van den Hondel, C. A., & Ram, A. F. “Agrobacterium- mediated transformation as a tool for functional genomics in fungi.” Current Genetics, vol. 48, no. 1, 2005, pp. 1-17. Neumann, E., Schaefer-Ridder, M., Wang, Y., & Hofschneider, P. H. “Gene transfer into mouse lyoma cells by electroporation in high electric fields.” The EMBO Journal, vol. 1, no. 7, 1982, pp. 841-845. Peberdy, J. F. “Fungal protoplasts: isolation, regeneration and fusion.” Microbiological Reviews, vol. 55, no. 4, 1991, pp. 387-402.

Claims

CLAIMS1. A method for analyzing a fungal cultivar for at least one alkaloid biosynthetic gene or paralog, comprising: obtaining a nucleic acid sample from a fungal cultivar; amplifying the nucleic acid sample using at least one primer pair specific to a unique subsequence of an alkaloid gene or paralog to form an amplification product; and analyzing the amplification product to identify or quantify the gene or expression thereof.

2. The method of claim 1, wherein the alkaloid gene is selected from psilocybin biosynthesis genes PsiM, PsiD, PsiK, PsiTl, PsiT2, PsiL, or PsiH.

3. The method of claim 1, wherein the at least one primer pair comprises any of SEQ ID NOs: 001-081.

4. The method of claim 1, wherein amplifying is performed using qPCR, digital PCR, HRM, LAMP, CRISPR diagnostics, or next-generation sequencing.

5. The method of claim 1, wherein the unique subsequence is in an exon or adjacent intron-exon boundary.

6. The method of claim 1, further comprising sequencing the amplified product to detect variant alleles, including SNPs or indels.

7. The method of claim 1, wherein multiple genes are analyzed simultaneously using multiplexed amplification.

8. The method of claim 7, wherein the multiplexed amplification targets two or more of PsiM, PsiD, PsiK, PsiTl, PsiT2, PsiL, or PsiH.

9. The method of claim 1, wherein the fungal cultivar is of the genera Psilocybe or Panaeolus.

10. The method of claim 1, further comprising determining copy number variation or genetic stability across clonal generations.

11. The method of claim 1, further comprising selecting the cultivar for cultivation based on an alkaloid profile predictive of a therapeutic effect.

12. The method of claim 11, wherein the therapeutic effect is chosen from antiinflammatory, antioxidant, antidepressant, neuroprotective, anxiolytic, anti-addiction, analgesic, or gastroprotective effects.

13. The method of claim 11, wherein the selecting is for a cultivar with reduced or increased psychoactivity while maintaining therapeutic effect.

14. The method of claim 1, wherein the amplification product is used as part of a quality control workflow to confirm genetic stability of the alkaloid biosynthetic region.

15. The method of claim 14, wherein the workflow includes sequencing the region and comparing results to chemical assays of alkaloid yield.

16. A method for producing a fungal cultivar by marker-assisted breeding, comprising: analyzing parent cultivars using the method of claim 1; selecting parents with desired genotypes; and breeding the selected parents to produce offspring.

17. The method of claim 16, wherein the breeding includes inbreeding parents for homozygosity and phenotypic stability.

18. The method of claim 16, wherein the breeding includes outcrossing parents with different alkaloid gene alleles to produce novel offspring profiles.

19. The method of claim 16, wherein the breeding is selected from sibling crossing, backcrossing, three- or four-way crossing, selfing, or production of doubled haploids.

20. The method of claim 16, further comprising genotyping offspring using the method of claim 1 to verify inheritance of targeted genotypes.

21. The method of claim 16, wherein the offspring have altered levels or ratios of norpsilocin, psilocybin, aeruginascin, norbaeocystin,or psilocin compared to the parents.

22. The method of claim 16, wherein the offspring are selected for modified psychoactive properties based on alkaloid gene profiles.

23. The method of claim 16, wherein the breeding improves medicinal efficacy or biomass stability of alkaloid production.

24. A kit comprising: at least one primer specific to a unique subsequence of an alkaloid biosynthetic gene; and instructions for its use in gene detection in a fungal cultivar.

25. The kit of claim 24, wherein the at least one primer is selected from SEQ ID NOs: 001-081.

26. An automated device for fungal cultivar analysis, comprising: a reaction chamber with primers; an amplification unit; andan analysis unit for gene identification or quantification.

27. The device of claim 26, wherein the analysis unit performs qPCR, digital PCR, or sequencing.

28. The device of claim 26, further comprising automated sample handling and precise thermal control.

29. The device of claim 26, wherein the analysis is driven by Al for real-time genotype interpretation.

30. The device of claim 26, further comprising a user interface to display results and provide cultivation or breeding recommendations.

31. A computer-implemented method comprising: receiving nucleic acid sequence data from a fungal sample; detecting alkaloid biosynthetic genes; classifying the fungal sample into genotypic groups; and generating a report of genotypic and phenotypic predictions.

32. The method of claim 31, wherein the classification correlates genotype with alkaloid ratios, health biomarkers, or production stability.

33. The method of claim 31, wherein the method suggests optimized breeding strategies based on genotype.

34. The method of claim 31, wherein the method is implemented via a mobile or cloud-based application.

35. The method of claim 31, wherein Al uses machine learning models trained on one or more of the following: Genotype-phenotype datasets, Patient Outcome Data, Pharmacogenomic data, Microbiomic data, HRM melt profile sequences, and Amino acid substituion and translation.

36. The method of claim 31, wherein classification uses barcode clustering based on SEQ ID NOs: 001-081.

Images