Application of glutaredoxin StGRX5 in plant disease resistance

Abstract

The invention belongs to the technical field of gene engineering, and relates to application of glutaredoxin StGRX5 in plant disease resistance. The invention provides an application of glutaredoxin StGRX5 in the disease resistance of plants. The glutaredoxin StGRX5 is silenced in potato plants, and the resistance of the potato plants to phytophthora infestans can be enhanced.

Description

TECHNICAL FIELD

[0001] The application belongs to the technical field of genetic engineering and relates to application of glutaredoxin StGRX5 in plant disease resistance. BACKGROUND

[0002] Potato is an important food crop next to wheat, rice and corn, but potato is susceptible to various biological and abiotic stress during its production process, and its stable production is directly related to food security.

[0003] However, the late blight caused by the oomycete pathogen Phytophthora infestans poses a serious threat to potato cultivation and has become a major obstacle to the sustainable development of the industry. Although breeding disease-resistant varieties is an economical and efficient means of disease control, the strong genetic variation and virulence evolution of P. infestans often lead to resistance breakdown of disease-resistant varieties, resulting in the current late blight control still relying on chemical fungicides.

[0004] Therefore, cultivating new disease-resistant varieties through identification of disease-resistant genes and analysis of their mechanisms is considered the most sustainable solution to control late blight of crops. SUMMARY

[0005] In view of the key technical bottlenecks such as long breeding cycle and limited genetic improvement efficiency of traditional hybrid breeding, the present application is based on the functional analysis of glutaredoxin StGRX5 (abbreviated as StGRX5) and utilizes the molecular mechanism of glutaredoxin StGRX5 in regulating plant immune response to improve the sustained resistance of potato to P. infestans and promote the precise breeding process of high-quality disease-resistant varieties. The interaction target StGRX5 (glutaredoxin StGRX5, abbreviated as StGRX5) of the effector protein Pi05910 of P. infestans is obtained by co-immunoprecipitation (Co-IP) technology, and bioinformatics analysis confirms that the protein belongs to the CC-type glutaredoxin family and has high interspecies conservation.

[0006] To achieve this technical purpose, the present application adopts the following technical solutions:

[0007] On the one hand, the present application provides application of glutaredoxin StGRX5 in plant disease resistance, wherein the CDS sequence of the glutaredoxin StGRX5 is shown as SEQ ID NO: 1.

[0008] Preferably, the plant disease resistance comprises:

[0009] Silencing the glutaredoxin StGRX5 enhances the resistance of the plant to late blight.

[0010] Preferably, the pathogen of the late blight is P. infestans.

[0011] Preferably, the plant is potato.

[0012] Preferably, the amino acid sequence of the protein encoded by the sulfiredoxin StGRX5 is shown as SEQ ID NO: 2.

[0013] In another aspect, the present application provides an expression vector,

[0014] The expression vector contains sulfiredoxin StGRX5;

[0015] The CDS sequence of the sulfiredoxin StGRX5 is shown as SEQ ID NO: 1.

[0016] Silencing the sulfiredoxin StGRX5 enhances the resistance of potato plants to late blight.

[0017] In another aspect, the present application provides a potato transformant strain,

[0018] The potato transformant strain is obtained by silencing sulfiredoxin StGRX5.

[0019] The CDS sequence of the sulfiredoxin StGRX5 is shown as SEQ ID NO: 1.

[0020] Silencing the sulfiredoxin StGRX5 enhances the resistance of potato plants to late blight.

[0021] In another aspect, the present application provides a method for breeding a potato plant resistant to late blight, which comprises introducing the expression vector of the present application into a potato plant and silencing the sulfiredoxin StGRX5.

[0022] In another aspect, the present application provides a method for breeding a potato plant resistant to pathogenic Phytophthora infestans,

[0023] The method comprises the step of silencing sulfiredoxin StGRX5.

[0024] The CDS sequence of the sulfiredoxin StGRX5 is shown as SEQ ID NO: 1.

[0025] In another aspect, the present application provides the use of the expression vector of the present application in the breeding of a material resistant to late blight.

[0026] The gene sequence of StGRX5 is obtained based on the NCBI database (GenBank accession number: XM_006359365.2), and the coding region sequence (CDS) and the corresponding amino acid sequence are shown as SEQ ID NO:1 and SEQ ID NO:2 respectively. Through the Agrobacterium tumefaciens GV3101-mediated transient expression system, it is found that StGRX5 negatively regulates the plant immune effect in Nicotiana benthamiana leaves. The research finds that StGRX5 overexpression significantly inhibits flg22-induced reactive oxygen species (ROS) burst, and the systemic bacterial infection result confirms that it negatively regulates the molecular function of plant basic immunity.

[0027] Therefore, the double enzyme digestion directional cloning technology is adopted to construct the RNA interference expression vector, the 35S-StGRX5-pART27-RNAi expression vector is successfully constructed, and the agrobacterium-mediated potato genetic transformation method is used to introduce the target gene sequence into the tetraploid potato cultivar 'Atlantic', so that the transformed strain line with stable heredity is obtained; and then the relative expression amount of the transcript of the transformed strain line and the resistance of the transformed strain line to the pathogenic phytophthora are detected to verify whether the resistant variety is successfully cultivated.

[0028] Based on the above technical idea, the application first provides the application of glutaredoxin StGRX5 in cultivating disease-resistant potato varieties. Specifically, silencing the glutaredoxin StGRX5 in potato plants can enhance the resistance of potato plants to pathogenic phytophthora.

[0029] SEQ ID NO:1 is specifically as follows:

[0030] "ATGGATAAGATTAGAGATTTGTCATCAAAGAGGGCAGCAGTAATTTTCACAAAGAGTTCATGTTGTATGTGTCATAGTATCAAAGCACTATTTTATGAACTAGGAGCAAGCCCAGCAATACATGAACTTGATCAAGATTCAAGAGGCAATGAAATGGCATTGGCATTGAGAAGTCTAGGTTGTAATCCATGTGTTCCAGCTATTTTCATTGGTGGACACTTTGTTGGATCAACAAAAGATGTTATTTCCCTTCATGTTAATGGCTCTCTTAAACAAATGCTTATTAATGCCAAAGCTATATGGTTGTAG".

[0031] SEQ ID NO:2 is specifically as follows:

[0032] "MDKIRDLSSKRAAVIFTKSSCCMCHSIKALFYELGASPAIHELDQDSRG NEMALALRSLGCNPCVPAIFIGGHFVGSTKDVISLHVNGSLKQMLINAKAIW L".

[0033] The beneficial effects of the present application relative to the prior art are:

[0034] (1) The present application proves that silencing glutaredoxin StGRX5 can enhance the disease resistance of potato plants to P. infestans. In the P. infestans disease resistance experiment, the resistance of the transgenic potato lines is further improved compared with the wild type 'Atlantic', which proves the immune function of glutaredoxin StGRX5.

[0035] (2) Based on plant molecular mechanism analysis and genetic engineering technology, the present application develops a set of technical system for breeding potato resistant varieties. The experimental data verify the effectiveness of the technical route, which opens up an innovative way for potato disease resistance breeding research. The present application shows significant application potential in improving the breeding level of potato disease resistance.

[0036] (3) The present application carries out subcellular localization analysis through Agrobacterium-mediated transient transformation technology. The experimental results show that glutaredoxin StGRX5 presents significant localization signals in the nucleus and cytoplasm. The fusion expression vector containing nuclear localization signal (Nuclear Localization Signal, NLS) or nuclear export signal (Nuclear Export Signal, NES) is designed and constructed to change its subcellular localization. The results show that the immune function of StGRX5 is strictly dependent on its nuclear localization: the immune inhibition ability of the nuclear localization defective mutant (NES fusion) is lost, while the forced nuclear localization type (NLS fusion) significantly enhances its negative regulation on plant disease resistance. BRIEF DESCRIPTION OF DRAWINGS

[0037] In order to more clearly illustrate the technical solutions of the present application, the drawings involved in the embodiments will be briefly introduced below. Obviously, the drawings in the description are only some embodiments of the present application, and other drawings can be obtained by those skilled in the art without creative labor on the basis of these drawings.

[0038] Figure 1 The CDS sequence, amino acid sequence and sequence alignment of glutaredoxin StGRX5 are shown in the schematic diagram. A is the CDS sequence schematic diagram; B is the amino acid sequence; C is the CCMC active center and GSH binding site contained therein; D is the sequence alignment of Solanaceae species.

[0039] Figure 2 Bar graph of the relative expression of transcripts after inoculation of detached leaves of potato transformation line 2, RNAi-StGRX5-2, transformation line 11, RNAi-StGRX5-11 and wild type 'Atlantic' with P. infestans. "Atlantic" means potato variety Atlantic; "RNAi-StGRX5-2, RNAi-StGRX5-11" means potato transformation line 2 and 11, respectively, silencing glutaredoxin StGRX5; "**" means statistically significant difference at the threshold level of P<0.01.

[0040] Figure 3 Picture of the in planta control of detached leaves of potato transformation line 2, RNAi-StGRX5-2, transformation line 11, RNAi-StGRX5-11 and wild type 'Atlantic' after inoculation with P. infestans and irradiation with UV light. "Atlantic" means potato variety Atlantic; "RNAi-StGRX5-2, RNAi-StGRX5-11" means potato transformation line 2 and 11, respectively, silencing glutaredoxin StGRX5.

[0041] Figure 4 Comparison of the lesion diameter after inoculation of detached leaves of potato transformation line 2, RNAi-StGRX5-2, transformation line 11, RNAi-StGRX5-11 and wild type 'Atlantic' with P. infestans. "Atlantic" means potato variety Atlantic; "RNAi-StGRX5-2, RNAi-StGRX5-11" means potato transformation line 2 and 11, respectively, silencing glutaredoxin StGRX5; "**" means statistically significant difference at the threshold level of P<0.01.

[0042] Figure 5 Bar graph of the relative colonization of P. infestans after inoculation of detached leaves of potato transformation line 2, RNAi-StGRX5-2, transformation line 11, RNAi-StGRX5-11 and wild type 'Atlantic' with P. infestans. "Atlantic" means potato variety Atlantic; "RNAi-StGRX5-2, RNAi-StGRX5-11" means potato transformation line 2 and 11, respectively, silencing glutaredoxin StGRX5; "**" means statistically significant difference at the threshold level of P<0.01.

[0043] Figure 6Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence.

[0044] Figure 7 Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence. NLS Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence. NLS Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence. NLS Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence.

[0045] Figure 8 Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence. NLS Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence.

[0046] Figure 9 Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence. NES Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence. NES Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence. NES .

[0047] Figure 10 Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence. NES Subcellular localization of transiently overexpressed GFP-StGRX5 in N. benthamiana leaves. "DAPI" indicates that the nucleus is specifically dyed with DAPI dye; "Merged" indicates that the pictures of the three channels are superimposed; "GFP-StGRX5" indicates GFP-StGRX5 with green fluorescence. DETAILED DESCRIPTION

[0048] Hereinafter, the technical solutions of the present application will be described in conjunction with examples, but the present application is not limited to the following examples. The experimental methods and detection methods described in each example are all conventional methods unless otherwise specified; the reagents and materials described are all commercially available unless otherwise specified.

[0049] In the embodiments of the present application, glutaredoxin StGRX5 (italic) represents a gene, and glutaredoxin StGRX5 (roman) represents a protein.

[0050] Example 1 The present example provides the identification and bioinformatics analysis information of glutaredoxin StGRX5

[0051] Identification of target protein of RXLR effector protein Pi05910 of P. infestans in planta: The target protein interacting with effector protein Pi05910 was obtained by immunoprecipitation experiment. The target protein was identified as glutaredoxin StGRX5, which is a protein conserved among plant species.

[0052] The sequence information of glutaredoxin StGRX5 (GenBank Accession No. XM_006359365.2) was obtained from NCBI website, the coding region sequence (CDS) and the corresponding amino acid sequence are shown as SEQ ID NO: 1 and SEQ ID NO: 2, respectively. The amino acid sequence of glutaredoxin StGRX5 is shown as SEQ ID NO: 2 in Figure 1 SEQ ID NO: 2, the CDS sequence of glutaredoxin StGRX5 is 309 bp in length, and the active sites of glutaredoxin StGRX5 are located at the 21-24 amino acids CCMC Figure 1 in SEQ ID NO: 2, and the CDS sequence is shown in Figure 1 SEQ ID NO: 1.

[0053] The glutaredoxin sequences of other Solanaceae species used for bioinformatics analysis were obtained from Solanaceae Genome website, and the sequence alignment among Solanaceae species was performed by DNAMAN. The corresponding Chinese names of each species are as follows: potato (Solanum tuberosum), tomato (Solanum Lycopersicum), pepper (Capsicum annuum), and eggplant (Eggplant). As shown in Figure 1 SEQ ID NO: 1, the glutaredoxin StGRX5 has a high conservation in protein sequence with the homologous proteins in other Solanaceae species, and the identity is between 75-80%.

[0054] The primer pair GFP-StGRX5-F and GFP-StGRX5-R for amplifying glutaredoxin StGRX5 was designed according to the nucleotide sequence shown in SEQ ID NO: 1. The cDNA of potato 'Atlantic' variety plant was used as a template to amplify and sequence glutaredoxin StGRX5. After sequencing, the PCR product has the nucleotide shown in SEQ ID NO: 1, the gene with the name of glutaredoxin StGRX5, and the amino acid sequence of the protein encoded by the gene is shown in SEQ ID NO: 2, and the protein is named as glutaredoxin StGRX5.

[0055] The sequence information of the primer pair GFP-StGRX5-F and GFP-StGRX5-R is as follows:

[0056] GFP-StGRX5-F:

[0057] GAGCTGTACAAGGAATTCATGGATAAGATTAGAGATTTGTCATC;

[0058] GFP-StGRX5-R:

[0059] TTAAAGCAGGACTCTAGACTACAACCATATAGCTTTGGCATT.

[0060] Example 2 The present example provides resistance verification of silencing glutaredoxin StGRX5

[0061] 1. Preparation of potato transformant lines

[0062] In potato 'Atlantic' variety plants (Atlantic, preserved by Professor Yuxi Wei's research group of State Key Laboratory of Arid Crop Stress and High Efficiency Production, Northwest A&F University), a stable genetic silencing transformant line was obtained by Agrobacterium (Agrobacterium tumefaciens GV3101, Shanghai Weidi Biotechnology Co., Ltd.) mediated potato stem segment transformation method. After resistance verification, two transformant lines with the lowest silencing efficiency were selected and recorded as RNAi-StGRX5-2 and RNAi-StGRX5-11, respectively. The relative expression amount of transcripts in the transformant lines was detected, as shown in Figure 2 The relative expression amount of transcripts in the silencing transformant line was lower than that in the wild type.

[0063] 2. Phytophthora infestans resistance experiment

[0064] Phytophthora infestans (88069, a gift from Professor Francine Govers of Wageningen University in the Netherlands) cultured for 10 days was stimulated to produce zoospores with pre-cooled sterile water (4°C). The healthy detached leaves of 'Atlantic' variety plants and two transformant lines RNAi-StGRX5-2 and RNAi-StGRX5-11 were inoculated with zoospores, respectively. After 3 days of culture at 16°C in the dark, the lesion size was observed and measured.

[0065] Figure 3 The actual photos of the leaves of each group after inoculation with Phytophthora infestans are shown in Figure 3It can be seen that under the irradiation of ultraviolet lamp, the lesion diameters of the silencing transformant strains RNAi-StGRX5-2 and RNAi-StGRX5-11 are smaller than that of the wild type 'Atlantic' strain.

[0066] Figure 4 The lesion diameter graph of each group after inoculation with P. infestans is shown in Figure 6. Figure 4 It can be seen that the lesion diameters of the silencing transformant strains RNAi-StGRX5-2 and RNAi-StGRX5-11 are smaller than that of the wild type 'Atlantic' strain.

[0067] From the detection of P. infestans colonization amount Figure 5 , it can be seen that the P. infestans colonization amount of the silencing transformant strains RNAi-StGRX5-2 and RNAi-StGRX5-11 is lower.

[0068] Example 3 This example provides the localization of glutaredoxin StGRX5 overexpression in cells

[0069] The agrobacterium expression vector GFP-StGRX5 carrying the green fluorescent protein (GFP) gene was constructed, and the fusion expression vector containing nuclear localization signal (Nuclear Localization Signal, NLS) or nuclear export signal (Nuclear Export Signal, NES) was designed and constructed. Through the agrobacterium-mediated N. benthamiana transient overexpression system, the subcellular localization of glutaredoxin StGRX5 transient overexpression was observed. The results are shown in Figure 3. Figure 6 、 Figure 7 、 Figure 9 As shown in Figure 3, "DAPI" means that the cell nucleus is specifically dyed with DAPI dye; "GFP-StGRX5" means glutaredoxin StGRX5 with green fluorescence; "GFP-StGRX5-NLS" means glutaredoxin StGRX5 fused with nuclear localization signal; "GFP-StGRX5-NES" means glutaredoxin StGRX5 fused with nuclear export signal; "Merged" means the picture superimposition of the three channels. NLS GFP-StGRX5, GFP-StGRX5 NES GFP-StGRX5 fused with nuclear localization signal and GFP-StGRX5 fused with nuclear export signal NLS GFP-StGRX5, GFP-StGRX5 NES GFP-StGRX5 fused with nuclear localization signal and GFP-StGRX5 fused with nuclear export signal NES ; "Merged" means the picture superimposition of the three channels.

[0070] Using the agrobacterium-mediated transient expression technology, Flag-GFP was used as a control, GFP-StGRX5, GFP-StGRX5 NLS GFP-StGRX5 fused with nuclear localization signal and GFP-StGRX5 fused with nuclear export signal NES were injected into the leaves of 4-week-old N. benthamiana, and P. infestans 88069 was inoculated after 1d. The lesion size was measured after 5-7d of inoculation.

[0071] From the detection of P. infestans colonization amount Figure 6Subcellular localization was observed using an Olympus FV3000 laser confocal microscope. Nucleus location was marked using DAPI staining. Results showed that GFP fluorescence signal accumulated in both the nucleus and cytoplasm, indicating that StGRX5 may be located in both the nucleus and cytoplasm.

[0072] Depend on Figure 7 It can be seen that fusing the nuclear input signal NLS to the N-terminus of GFP-StGRX5 constructs p35S:: NLS GFP-StGRX5 vector. Transient expression of p35S in Nicotiana benthamiana leaves: NLS Subcellular localization analysis of GFP-StGRX5 under laser confocal microscopy was performed. As expected, the GFP fluorescence signal was specifically enriched in the cell nucleus, and no significant fluorescence signal was detected in the cytoplasm. This result confirms that the NLS signal can completely target GFP-StGRX5 to the cell nucleus.

[0073] Depend on Figure 9 It can be seen that fusing the nuclear output signal NES to the C-terminus of GFP-StGRX5 constructs p35S::GFP-StGRX5. NES Vector. Transient expression of p35S::GFP-StGRX5 in tobacco leaves. NES Fluorescence signal detection showed that the GFP-labeled fusion protein selectively localized in the cytoplasm, while no obvious green fluorescence signal was detected in the nucleus, indicating that the NES signal can completely localize GFP-StGRX5 in the cytoplasm.

[0074] Figure 8 As a control, Flag-GFP was injected into leaves of 4-week-old Nicotiana benthamiana seedlings. NLS GFP-StGRX5, including a control image, a comparison image of lesion diameter, and a bar chart of the relative colonization of *Phytophthora infestans* 5-7 days after inoculation with UV light. Figure 8 It can be seen that overexpression NLS The leaf lesions of GFP-StGRX5 tobacco were larger and the colonization of Phytophthora infestans was significantly increased, indicating that it promoted the infection of Phytophthora infestans.

[0075] Figure 10 To use Flag-GFP as a control, GFP-StGRX5 was injected into leaves of 4-week-old Nicotiana benthamiana seedlings. NES The images show a comparison of specimens inoculated with Phytophthora infestans 5-7 days after UV irradiation, including a control image, a comparison of lesion diameters, and a bar chart showing the relative colonization of Phytophthora infestans. Figure 10 It can be seen that GFP-StGRX5 NESThere was no obvious difference between the infection of P. parasitica and the control Flag-GFP, indicating that the immune function of StGRX5 depends on its nuclear localization.

[0076] The above-described examples are part, but not all, of the examples of the present application. The detailed description of the examples of the present application does not intend to limit the scope of the claimed application, but to represent selected examples of the application. Relevant modifications and substitutions are intended within the scope of the application based on the concept of the application. All other examples obtained by the persons of ordinary skill in the art without creative work, based on the concept of the application, are within the scope of the present application.

Claims

1. The application of glutoreductin StGRX5 in plant disease resistance, characterized in that, The CDS sequence of the glutoreductase StGRX5 is shown in SEQ ID NO:

1.

2. The application according to claim 1, characterized in that, The plant disease resistance includes: Silencing the glutoreductase StGRX5 enhances plant resistance to late blight.

3. The application according to claim 2, characterized in that, The pathogen causing the late blight is Phytophthora infestans.

4. The application according to claim 2, characterized in that, The plant in question is a potato.

5. The application according to claim 1, characterized in that, The amino acid sequence of the protein encoded by the glutoreductase StGRX5 is shown in SEQ ID NO:

2.

6. An expression carrier, characterized in that, The expression vector contains glutoreductase StGRX5; The CDS sequence of the glutoreductase StGRX5 is shown in SEQ ID NO:1; Silencing the glutoreductase StGRX5 enhances the resistance of potato plants to late blight.

7. A potato transformant line, characterized in that, The potato transformant lines were obtained by silencing glutoreductase StGRX5; The CDS sequence of the glutoreductase StGRX5 is shown in SEQ ID NO:1; Silencing the glutoreductase StGRX5 enhances the resistance of potato plants to late blight.

8. A method for cultivating potato varieties resistant to late blight, characterized in that, The expression vector described in claim 6 was transferred into potato plants to silence the glutoreductase StGRX5.

9. A method for cultivating potato varieties resistant to Phytophthora infestans, characterized in that, This includes steps that silence the glutoreductase protein StGRX5; The CDS sequence of the glutoreductase StGRX5 is shown in SEQ ID NO:

1.

10. The application of the expression vector according to claim 6 in the cultivation of materials resistant to late blight.

Images