Application of Cucumber Salt Tolerance Gene CsGPDHc2

Abstract

The present invention relates to the field of genetic engineering technology, and in particular to the application of cucumber salt-tolerant gene CsGPDHc2. The cucumber salt-tolerant gene CsGPDHc2 of the present invention is a cucumber glycerol-3-phosphate dehydrogenase gene, and the nucleotide sequence of the gene is shown in SEQ ID NO.1. The cucumber salt-tolerant gene CsGPDHc2 of the present invention has the highest expression level in cucumber fruit, and the expression level of the gene is the highest after 6 hours of salt stress. By transfecting Arabidopsis with the cucumber salt-tolerant gene CsGPDHc2 of the present invention, transgenic Arabidopsis with strong stress resistance can be obtained, providing a basis for screening crops with strong stress resistance.

Description

Technical Field

[0001] The invention relates to the technical field of genetic engineering, in particular to the application of cucumber salt-tolerant gene CsGPDHc2. Background Art

[0002] Cucumber (Cucumis sativus L.), also known as cucumber and thorny melon, originated in the southern Himalayas and belongs to the Cucurbitaceae family. It is one of the most widely grown vegetables in China. Cucumber has high nutritional value and economic benefits. The fruit is sweet and crispy, rich in vitamin E, and has the effect of clearing heat and detoxifying. However, during the planting process, cucumber is easily affected by abiotic stresses such as salt, drought and cold. Among them, salt stress can destroy the antioxidant defense system of cucumber plants, inhibit their normal growth and development, and even cause symptoms of whole plant yellowing, seriously affecting their yield. Therefore, studying the molecular mechanism of cucumber's stress resistance and enhancing the ability of cucumber to resist stress is of great significance for cultivating new cucumber varieties that are resistant to stress and ensuring the yield of cucumber under various stress conditions.

[0003] At present, research on salt tolerance of cucumber is still relatively weak. Not only has there been no significant breakthrough in the measures and means to solve the problem of salt tolerance of cucumber, but also no cucumber varieties that are particularly salt-tolerant have been found, which has brought great trouble to cucumber production. Therefore, it is particularly important to explore the key salt-tolerant genes of crops such as cucumbers and analyze their molecular mechanisms in salt stress for the cultivation of salt-tolerant crops. Summary of the invention

[0004] The purpose of the present invention is to provide application of cucumber salt-tolerant gene CsGPDHc2.

[0005] In order to achieve the above-mentioned object of the invention, the present invention provides the following technical solutions:

[0006] The present invention provides an application of a cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 in improving plant salt tolerance and stress resistance or cultivating salt-tolerant transgenic plants, comprising the following steps: constructing a recombinant expression vector containing the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1, transforming Agrobacterium with the obtained recombinant expression vector, culturing to obtain a recombinant bacterium carrying the recombinant expression vector, and infecting a plant with the recombinant bacterium carrying the recombinant expression vector;

[0007] The empty vector used in constructing the recombinant expression vector is the overexpression vector pHB;

[0008] The Agrobacterium is Agrobacterium GV3101; and the plant is Arabidopsis thaliana.

[0009] Preferably, the primer pair for amplifying the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 is shown in SEQ ID NO.3~4.

[0010] Preferably, the primer pair for detecting the expression level of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 is shown in SEQ ID NO.5-6.

[0011] The present invention also provides an application of a recombinant expression vector in improving plant salt tolerance, stress resistance or cultivating salt-tolerant transgenic plants, wherein the recombinant expression vector comprises a cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 and an empty vector;

[0012] The empty vector is the overexpression vector pHB.

[0013] Preferably, the method for using the recombinant expression vector in improving plant salt tolerance, stress resistance or cultivating salt-tolerant transgenic plants comprises the following steps: transforming the recombinant expression vector into Agrobacterium, culturing to obtain recombinant bacteria carrying the recombinant expression vector, and infecting plant plants with the recombinant bacteria carrying the recombinant expression vector;

[0014] The plant is Arabidopsis thaliana.

[0015] The present invention also provides an application of a recombinant bacterium in improving plant salt tolerance, stress resistance or cultivating salt-tolerant transgenic plants, wherein the recombinant bacterium comprises the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 or the recombinant expression vector and a host bacterium;

[0016] The host bacteria is Agrobacterium GV3101.

[0017] Preferably, the method for using the recombinant bacteria in improving plant salt tolerance, stress resistance or cultivating salt-tolerant transgenic plants comprises the following steps: infecting plant plants with the recombinant bacteria;

[0018] The plant is Arabidopsis thaliana.

[0019] The present invention also provides a method for improving plant salt tolerance and stress resistance, comprising the following steps:

[0020] Overexpressing the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 in plants;

[0021] The plant is Arabidopsis thaliana.

[0022] The present invention also provides a method for cultivating salt-tolerant transgenic plants, comprising the following steps:

[0023] Constructing a recombinant expression vector containing the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1, transforming the obtained recombinant expression vector into Agrobacterium, culturing to obtain recombinant bacteria carrying the recombinant expression vector, and infecting plants with the recombinant bacteria carrying the recombinant expression vector to cultivate transgenic plants;

[0024] The empty vector used in constructing the recombinant expression vector is the overexpression vector pHB;

[0025] The Agrobacterium is Agrobacterium GV3101;

[0026] The plant is Arabidopsis thaliana.

[0027] The present invention provides an application of a cucumber salt-tolerant gene CsGPDHc2. The cucumber salt-tolerant gene of the present invention is a cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2, and the nucleotide sequence of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 is shown in SEQ ID NO.1. The gene of the present invention has a length of 1389 bp, encodes 462 amino acids, and has a high homology with Arabidopsis thaliana AtGPDHc2, so it is named CsGPDHc2. The cucumber salt-tolerant gene CsGPDHc2 of the present invention has the highest expression level in cucumber fruit, and the expression level of the gene is the highest after 6 hours of salt stress. By transfecting Arabidopsis thaliana with the cucumber salt-tolerant gene CsGPDHc2 of the present invention, a transgenic Arabidopsis thaliana with strong stress resistance can be obtained, which provides a basis for screening plant varieties with strong stress resistance. BRIEF DESCRIPTION OF THE DRAWINGS

[0028] Figure 1 The expression of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 in different cucumber tissues;

[0029] Figure 2 The expression of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 after salt stress (the horizontal axis represents the time of salt stress, and the vertical axis represents the expression level);

[0030] Figure 3 The expression of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 after abscisic acid treatment (the horizontal axis represents the abscisic acid treatment time, and the vertical axis represents the expression level);

[0031] Figure 4 The expression of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 in overexpressed Arabidopsis thaliana (the horizontal axis represents different Arabidopsis thaliana plants, and the vertical axis represents the expression level);

[0032] Figure 5Seed germination of Arabidopsis thaliana strains OE5 and OE10 overexpressing under salt stress conditions (A represents the appearance of different seed germination, the left side is the control, and the right side is the 125mM NaCl treatment group; B represents the germination rate of different seeds under different conditions, the left side is the control, and the right side is the 125mM NaCl treatment group);

[0033] Figure 6 Effects of salt stress and abscisic acid induction on root length of Arabidopsis overexpressing OE5 and OE10 and wild-type Arabidopsis (A is the apparent diagram of Arabidopsis root length under different treatments, from left to right are control group, 125mM NaCl treatment group, 10μM abscisic acid treatment group; B is the expression level of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 in Arabidopsis under different treatments);

[0034] Figure 7 The growth of Arabidopsis thaliana overexpressing OE5 and OE10 and wild-type Arabidopsis thaliana under salt stress (A represents the growth phenotype of Arabidopsis thaliana under different treatments, the upper figure is the control group, and the lower figure is the 200mMNaCl treatment group; B represents the total content of chlorophyll a and chlorophyll b in different Arabidopsis thaliana; C represents the content of carotenoids in different Arabidopsis thaliana);

[0035] Figure 8 The reactive oxygen staining of different Arabidopsis plants under salt stress (A represents DAB staining, B represents NBT staining);

[0036] Fig. 9 Analysis of antioxidant enzyme activities of different Arabidopsis plants under salt stress conditions (A represents the activity of superoxide dismutase SOD; B represents the activity of peroxidase POD);

[0037] Fig.10 The expression of salt stress response-related genes under salt stress conditions (A represents the expression of AtP5CS, B represents the expression of AtRD22, and C represents the expression of AtRD29A). DETAILED DESCRIPTION

[0038]

[0039] In the present invention, the amino acid sequence encoded by the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 is shown in SEQ ID NO. 2. SEQ ID NO. 2: MVDTIDRNSQTNGSIQNSNATMEEKLDDLRRLFGKSDGDPLRIVGVGAGAWGSVFIAMLQESYGHLREKVLIRIWRRHGRTVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRILYADEILKDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVVNGLPSTDTRQVFHEMRRYWKERLTMPVIISLSKGVEAELEPQPRIITPTQIINSATGVPLENILYLG GPNIASEIYNREYANARICGSEKWRKSLAKFLRQPHFIVWDNGDLVTHEVMGGLKNVYAIGAGMVAALTKESATSKAVYFAHCTSEMILITHLLAEEPEKLAGPLLADTYVTLLKGR NAWYGQKLAEGELSLEMGDSIKGKGMIQGVSAVKAFYELLSQSSLSVLHPEDNKPVAPVKLCPILKMLYNILITREFSSEAILQALRDETITDPRDRIKIAQTHVFYKPSLLGQQR.

[0040] In the present invention, the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 is overexpressed for improving plant salt tolerance and stress resistance or cultivating salt-tolerant transgenic plants.

[0041] In the present invention, a primer pair for amplifying the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 is shown in SEQ ID NO.3~4, SEQ ID NO.3 is an upstream primer CsGPDHc2-F, and the sequence is: CTCTCTCTCAAGCTTGGATCCATGGTTGATACAATCGACAGAAATAGC; SEQ ID NO.4 is a downstream primer CsGPDHc2-R, and the sequence is: GATACGAACGAAAGCTCTAGATTAACGCTGCTGTCCAAGAAGC.

[0042] In the present invention, a primer pair for detecting the expression amount of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 is shown in SEQ ID NO.5~6, SEQ ID NO.5 is an upstream primer, and the sequence is: GGTGTGGAGGCTGAATTGGA; SEQ ID NO.6 is a downstream primer, and the sequence is: AAGGAACTCCAGTTGCGCTG.

[0043] The technical solutions provided by the present invention are described in detail below in conjunction with the embodiments, but they should not be construed as limiting the protection scope of the present invention.

[0044] Example 1

[0045] Cloning of Cucumber Glycerol-3-phosphate Dehydrogenase Gene CsGPDHc2

[0046] The nucleotide sequence of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 is shown in SEQ ID NO.1, with a length of 1389 bp; the amino acids encoded by the nucleotide sequence are shown in SEQ ID NO.2, encoding 462 amino acids. The nucleotide sequence of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 has a high homology with Arabidopsis thaliana AtGPDHc2, so the gene is named CsGPDHc2 。

[0047] Example 2

[0048] RNA was extracted from the roots, stems, leaves, flowers and fruits of cucumber variety 9930, reverse transcribed into cDNA, and real-time fluorescence quantitative PCR was performed using the fluorescent quantitative primers of CsGPDHc2 to detect the expression level of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 in cucumber roots, stems, leaves, flowers and fruits. Figure 1 shown.

[0049] Different lowercase letters in the figure indicate significant differences (P<0.05).

[0050] Figure 1 The results showed that the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 had the highest expression level in the fruit, followed by the female flower, and the lowest expression level in the tendril.

[0051] Example 3

[0052] Cucumber variety 9930 was subjected to salt stress (200 mM NaCl). Specifically, 2-week-old cucumber seedlings were placed in a 200 mM NaCl solution for treatment. Cucumber leaves were taken at different time points to detect the expression changes of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2. The results are as follows: Figure 2 shown.

[0053] Different lowercase letters in the figure indicate significant differences (P<0.05).

[0054] Figure 2 The results showed that the expression level of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 was the highest at 6 h after salt stress, and then decreased at 12 h.

[0055] Example 4

[0056] The cucumber variety 9930 was treated with abscisic acid (ABA). Specifically, 2-week-old cucumber seedlings were placed in 100 μM ABA solution for treatment. Cucumber leaves were taken at different time points to detect the expression level of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 under abscisic acid (ABA) treatment. Figure 3 shown.

[0057] Different lowercase letters in the figure indicate significant differences (P<0.05).

[0058] Figure 3 The results showed that the expression level of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 first decreased and then increased with the treatment time, reaching the highest value at 12h, indicating that cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 is related to the response of plants to ABA signals and adaptation to adversity.

[0059] Example 5

[0060] The full-length CDS sequence of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 was amplified by PCR to obtain the nucleotide sequence shown in SEQ ID NO.1, which was ligated with the overexpression vector pHB to obtain the recombinant expression vector pHB-CsGPDHc2 (35S: CsGPDHc2). The recombinant expression vector was transformed into Agrobacterium competent GV3101, and the Agrobacterium liquid containing the recombinant plasmid was obtained using LB liquid medium and Kan and Rif antibiotics. The wild-type Arabidopsis thaliana was infected with the Agrobacterium liquid containing the recombinant plasmid pHB-CsGPDHc2 (35S: CsGPDHc2) and T0 generation seeds were collected. The T1 generation resistant seedlings were screened using MS medium supplemented with 1 / 2 hygromycin. The homozygous plants of the T3 generation were further screened. After the homozygous plants of the T3 generation were planted in nutrient soil for 3 weeks, the leaf RNA was extracted and reversely transcribed into cDNA. The specific fluorescent quantitative primers of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 were used to detect the expression level of CsGPDHc2 gene in positive plants. Figure 4 shown.

[0061] The primers used for PCR amplification of the full-length CDS sequence of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 were: CsGPDHc2-F (SEQ ID NO.3): CTCTCTCTCAAGCTTGGATCCATGGTTGATACAATCGACAGAAATAGC; CsGPDHc2-R (SEQ ID NO.4): GATACGAACGAAAGCTCTAGATTAACGCTGCTGTCCAAGAAGC.

[0062] The PCR reaction program for PCR amplification of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 was: 95℃3min; 95℃15min, 60℃15min, 72℃60s, 35 cycles; 72℃5min.

[0063] The primers for specific fluorescence quantitative PCR were: F (SEQ ID NO.5): GGTGTGGAGGCTGAATTGGA;

[0064] R (SEQ ID NO. 6):AAGGAACTCCAGTTGCGCTG.

[0065] The reaction program of specific fluorescence quantitative PCR was as follows: 95°C for 30 s, 1 cycle; 95°C for 5 s, 60°C for 30 s, 40 cycles.

[0066] Different lowercase letters in the figure indicate significant differences (P<0.05).

[0067] Figure 4 The results showed that among the 12 positive plants screened, the expression level of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 was higher in plants 5 and 10, which were named OE5 and OE10, respectively. OE5 and OE10 were used as transgenic plants for subsequent experiments.

[0068] Example 6

[0069] The T3 transgenic plant seeds of homozygous OE5 and OE10 and wild-type seeds were sown in the same number on 1 / 2 MS medium with 125mM NaCl, and the control group used 1 / 2 MS medium (0mM NaCl). After 3 days of vernalization, the seeds were placed in a light culture room to observe the germination, and the germination status was recorded every day until all seeds germinated. The results are shown in Figure 5 shown.

[0070] Different lowercase letters in the figure indicate significant differences (P<0.05).

[0071] Figure 5The results showed that under normal growth conditions, there was no significant difference in germination between the wild-type WT and transgenic plants, and all of them had germinated by the third day. However, salt stress hindered the germination ability of seeds to a certain extent. All seeds did not germinate on the first day, but began to germinate on the second day. The germination rate of the wild type was only 6.79%, while the germination rate of the overexpression plants OE5 and OE10 was 18.52%. The most significant difference was on the third day. The wild type had only a germination rate of 38.98%, while the germination rates of the overexpression plants OE5 and OE10 were 64.81% and 62.96%, which were more than 1.5 times the germination rate of the wild type. The above results show that overexpression of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPHDc2 can improve the tolerance of seeds to salt stress.

[0072] Example 7

[0073] Cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 overexpressing plants OE5 and OE10 and wild-type Arabidopsis were sown in 1 / 2 MS medium. Five days later, the seedlings were moved to 1 / 2 MS medium with 125mM NaCl and 10μM ABA and cultured vertically. Seven days later, the growth phenotypes of the overexpressing plants and wild-type plants were observed and their root length changes were measured. The results are shown in Figure 6 shown.

[0074] Different lowercase letters in the figure indicate significant differences (P<0.05).

[0075] Figure 6 It was shown that there was no significant difference in the growth and root length of the wild type WT and the overexpression plants OE5 and OE10 under normal growth conditions. After salt stress of 125mM NaCl, the cotyledons of the wild type WT had turned white, while the cotyledons of the transgenic plants were only wrinkled and slightly yellowed. It was concluded that salt stress had seriously affected the growth of the wild type. From the measurement of root length and the calculation of relative root length, it was found that the root length of the plants was inhibited after stress, but the relative root length of the wild type was significantly shorter than that of the two transgenic lines. After induction with 10μM ABA, the cotyledons of the wild type did not turn white, but the relative root length was also significantly shorter than that of the overexpression plants. In summary, overexpression of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 can improve the stress resistance of transgenic seedlings under salt stress.

[0076] Example 8

[0077] Wild-type Arabidopsis WT and overexpression plants Arabidopsis OE5 and OE10 were sown in 1 / 2 MS medium, cultured for 7 days and then planted in nutrient soil. After 3 weeks, 200mM NaCl was irrigated. After 9 days, the growth of the plants was observed and the phenotypic growth was photographed. Leaves at the same position of different groups were cut for determination of chlorophyll content. The results are shown in Figure 7shown.

[0078] Different lowercase letters in the figure indicate significant differences (P<0.05).

[0079] Figure 7 The phenotypic pictures of the control group showed that there was no difference in the growth of the transgenic plants and the wild type. Under the treatment of 200mM NaCl, the rosette leaves at the bottom of the wild type plants had obviously wilted and yellowed, while the growth of the overexpression plants (OE5 and OE10) was significantly better than that of the wild type. And from the determination of the total content of chlorophyll a and chlorophyll b and the content of carotenoids, it can be seen that the content of transgenic plants after stress is significantly higher than that of the wild type.

[0080] Example 9

[0081] 3,3-Diaminobenzidine (DAB) and nitroblue tetrazolium (NBT) staining were used to detect the color development of wild-type Arabidopsis and overexpressing plants OE5 and OE10 after 200 mM NaCl stress. Figure 8 shown.

[0082] The leaves of wild-type Arabidopsis and overexpression plants OE5 and OE10 that had been treated with different methods were taken to detect the activities of superoxide dismutase (SOD) and peroxidase (POD). The results are as follows: Fig. 9 Different lowercase letters in the figure indicate significant differences (P<0.05).

[0083] The genes of leaves of wild-type Arabidopsis and overexpression plants OE5 and OE10 under salt stress were extracted respectively to study the gene expression of salt stress response-related genes AtP5CS, AtRD22 and AtRD29A under salt stress. The results are as follows Fig.10 Different lowercase letters in the figure indicate significant differences (P<0.05).

[0084] Figure 8 The results showed that after 200 mM NaCl stress, the coloring of the leaves of the plants was darker than that of the leaves that were not stressed, indicating that the accumulation of reactive oxygen species would increase after the plants were subjected to abiotic stress. However, the degree of DAB and NBT coloring of the overexpression plants (OE5 and OE10) was significantly lighter than that of the wild type. This shows that overexpression of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 under salt stress can reduce the accumulation of ROS in the plants, thereby reducing the damage of the plants to salt stress.

[0085] Fig. 9The results showed that there was no significant difference in the POD and SOD activities of the plants before salt stress. After salt stress, the POD and SOD contents of the overexpressing plants (OE5 and OE10) were significantly higher than those of the wild type. The results showed that transgenic plants overexpressing the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 could more effectively eliminate reactive oxidative substances (ROS) in cells, thereby reducing the damage of salt stress to plants.

[0086] Fig.10 The results showed that the expression levels of AtP5CS, AtRD22 and AtRD29A were significantly higher than those of the wild type after salt stress, indicating that overexpression of cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 can improve plant tolerance to salt stress by enhancing proline synthesis and protecting cells from damage caused by dehydration.

[0087] As can be seen from the above embodiments, the present invention provides an application of the cucumber salt-tolerant gene CsGPDHc2. The cucumber salt-tolerant gene of the present invention is the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2, and the nucleotide sequence of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 is shown in SEQ ID NO.1. The gene of the present invention is 1389 bp in length, encodes 462 amino acids, and has a high homology with Arabidopsis AtGPDHc2, so it is named CsGPDHc2. The cucumber salt-tolerant gene CsGPDHc2 of the present invention has the highest expression level in cucumber fruit, and the expression level of the gene is the highest after 6 hours of salt stress. By transfecting Arabidopsis with the cucumber salt-tolerant gene CsGPDHc2 of the present invention, transgenic Arabidopsis with tolerance to salt can be obtained.

[0088] The above is only a preferred embodiment of the present invention. It should be pointed out that for ordinary technicians in this technical field, several improvements and modifications can be made without departing from the principle of the present invention. These improvements and modifications should also be regarded as the scope of protection of the present invention.

Claims

1. Application of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 in improving plant salt tolerance, stress resistance or cultivating salt-tolerant transgenic plants, characterized in that: The method comprises the following steps: constructing a recombinant expression vector containing the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1, transforming the obtained recombinant expression vector into Agrobacterium, culturing to obtain a recombinant bacterium carrying the recombinant expression vector, and infecting a plant with the recombinant bacterium carrying the recombinant expression vector; The empty vector used in constructing the recombinant expression vector is the overexpression vector pHB; The Agrobacterium is Agrobacterium GV3101; and the plant is Arabidopsis thaliana.

2. The use according to claim 1, characterized in that: The primer pair for amplifying the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 is shown in SEQ ID NO.3-4.

3. The use according to claim 1 or 2, characterized in that: The primer pair for detecting the expression level of the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 is shown in SEQ ID NO.5-6.

4. Use of a recombinant expression vector in improving plant salt tolerance, stress resistance or cultivating salt-tolerant transgenic plants, characterized in that: The recombinant expression vector comprises the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 and an empty vector; The empty vector is the overexpression vector pHB.

5. The use according to claim 4, characterized in that: The method for using the recombinant expression vector in improving plant salt tolerance, stress resistance or cultivating salt-tolerant transgenic plants comprises the following steps: transforming the recombinant expression vector into Agrobacterium, culturing to obtain recombinant bacteria carrying the recombinant expression vector, and infecting plant plants with the recombinant bacteria carrying the recombinant expression vector; The plant is Arabidopsis thaliana.

6. Use of a recombinant bacterium in improving plant salt tolerance, stress resistance or cultivating salt-tolerant transgenic plants, characterized in that: The recombinant bacteria include the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 and a host bacteria; The host bacteria is Agrobacterium GV3101.

7. The use according to claim 6, characterized in that: The method for using the recombinant bacteria in improving plant salt tolerance, stress resistance or cultivating salt-tolerant transgenic plants comprises the following steps: infecting plant plants with the recombinant bacteria; The plant is Arabidopsis thaliana.

8. A method for improving plant salt tolerance and stress resistance, characterized in that: The steps include: Overexpressing the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1 in plants; The plant is Arabidopsis thaliana.

9. A method for cultivating salt-tolerant transgenic plants, characterized in that: The steps include: Constructing a recombinant expression vector containing the cucumber glycerol-3-phosphate dehydrogenase gene CsGPDHc2 shown in SEQ ID NO.1, transforming the obtained recombinant expression vector into Agrobacterium, culturing to obtain recombinant bacteria carrying the recombinant expression vector, and infecting plants with the recombinant bacteria carrying the recombinant expression vector to cultivate transgenic plants; The empty vector used in constructing the recombinant expression vector is the overexpression vector pHB; The Agrobacterium is Agrobacterium GV3101; The plant is Arabidopsis thaliana.

Images