Application of GSTF2 gene of Glechoma longituba in improving herbicide resistance of plants and method for improving herbicide resistance of plants

Abstract

The present invention discloses the application of the GSTF2 gene of Glechoma longituba in improving the herbicide resistance of plants and a method for improving the herbicide resistance of plants, and belongs to the technical field of molecular biology. The nucleic acid sequence of the GSTF2 gene of Glechoma longituba described in the present invention is shown in SEQ ID NO:1, and the amino acid sequence encoded by it is shown in SEQ ID NO:2. The CDS sequence of the gene is transformed into rice, and it is found that the rice with the GSTF2 gene of Glechoma longituba has different degrees of resistance to fenoxaprop-butyl, clodinafop-butyl, clethodim, and pinoxaden. Therefore, the rice with the GSTF2 gene of Glechoma longituba has the characteristics of herbicide resistance, which lays the foundation for cultivating new varieties of wheat and rice with herbicide resistance.

Description

Technical Field

[0001] The invention belongs to the technical field of molecular biology, and specifically relates to the application of a GSTF2 gene of Glechoma longituba in improving the herbicide resistance of plants and a method for improving the herbicide resistance of plants. Background Art

[0002] Since the beginning of farming, the struggle between humans and weeds has never stopped. Herbicides have liberated human hands and have high weed control efficiency, occupying an important position in the current agricultural development. The control of grass weeds in wheat fields mainly relies on acetyl-CoA carboxylase (ACCse) inhibitors, which eventually lead to the death of weeds by inhibiting the synthesis of fatty acids. Fenoxac-butyl is a commonly used stem and leaf treatment herbicide, mainly used to control grass weeds. Fenoxac-butyl can be used to control weeds in wheat and rice fields, but during use, if the application technique is improper, it may cause pesticide accidents. Studies have shown that there are differences in the safety of fenoxaprop-butyl to different varieties of rice, some of which have poor tolerance to fenoxaprop-butyl, and the pesticide damage to rice under high temperature conditions may be more serious. In addition, in recent years, the large-scale use of herbicides has led to the growth of resistant weeds, further increasing the dosage of herbicides used, and aggravating the pesticide damage to rice and wheat. When rice and wheat are slightly damaged by pesticides, their growth is inhibited, and when they are severe, they can lead to reduced yields or even death. Therefore, breeding new varieties of wheat and rice that are resistant to herbicides is one of the important means to prevent herbicide damage in wheat and rice fields. Summary of the invention

[0003] In view of the problems existing in the prior art, the object of the present invention is to provide an application of the GSTF2 gene of Glechoma longituba in improving the herbicide resistance of plants and a method for improving the herbicide resistance of plants.

[0004] In order to achieve the above object, the present invention adopts the following technical solution:

[0005] The invention discloses an application of the GSTF2 gene of Glechoma longituba in improving the herbicide resistance of plants. The amino acid sequence encoded by the GSTF2 gene of Glechoma longituba is shown in SEQ ID NO: 2.

[0006] Based on the above scheme, the nucleic acid sequence of the Glechoma longituba GSTF2 gene is shown in SEQ ID NO:1.

[0007] On the basis of the above scheme, the nucleic acid sequence of the GSTF2 gene of the scutellaria baicalensis is constructed into an expression vector, and the plant is transformed to be expressed in the plant, so that the plant has the ability to resist herbicides.

[0008] Based on the above scheme, the herbicide is an acetyl-CoA carboxylase inhibitor herbicide.

[0009] On the basis of the above scheme, the herbicides are fenoxaprop-butyl, clodinafop-butyl, clethodim, and pinoxaden.

[0010] A method for improving the herbicide resistance of plants, comprising constructing a nucleic acid sequence of a GSTF2 gene of Glechoma longituba into an expression vector, transforming the plant, and expressing the nucleic acid sequence in the plant to make the plant have the herbicide resistance; the nucleic acid sequence of the GSTF2 gene of Glechoma longituba is shown in SEQ ID NO: 1.

[0011] Based on the above scheme, the herbicide is an acetyl-CoA carboxylase inhibitor herbicide.

[0012] On the basis of the above scheme, the herbicides are fenoxaprop-butyl, clodinafop-butyl, clethodim, and pinoxaden.

[0013] Based on the above scheme, the plant is rice or wheat.

[0014] Advantages of the technical solution of the present invention

[0015] The present invention cloned the GSTF2 gene of the weed grass, transformed the CDS sequence of the gene into rice, and measured the resistance levels of the transgenic rice to different herbicides. The results showed that the rice with the GSTF2 gene of the weed grass had different degrees of resistance to fenoxaprop-butyl, clodinafop-butyl, clethodim, and pinoxaden, but did not show obvious resistance to sethoxydim and high-efficiency fluazifop-butyl. Therefore, the rice with the GSTF2 gene of the weed grass has the characteristics of herbicide resistance, laying the foundation for breeding new varieties of wheat and rice resistant to herbicides. BRIEF DESCRIPTION OF THE DRAWINGS

[0016] Figure 1 The constructed vector map of pEGOEPubi-H-GST;

[0017] Figure 2 Electrophoresis of pEGOEPubi-H-GST after digestion with EcoRI / HindIII;

[0018] Figure 3 Identification of transgenic rice with GSTF2 gene (from left to right, lane 1 is the marker, lane 2 is the positive control, and lanes 3-13 are test samples);

[0019] Figure 4 The results of transgenic rice with GSTF2 gene resistance to fenoxaprop-butyl;

[0020] Figure 5 The results of transgenic rice with GSTF2 gene showing resistance to high-efficiency haloxyfop-butyl;

[0021] Figure 6 The results of transgenic rice with GSTF2 gene to clodinafop-butyl;

[0022] Figure 7 The results of transgenic rice with GSTF2 gene on resistance to sethoxydim;

[0023] Figure 8 The results of transgenic rice with GSTF2 gene for resistance to clethodim;

[0024] Fig. 9 The results of transgenic GSTF2 rice resistance to pinoxaden. DETAILED DESCRIPTION

[0025] The terms used in the present invention, unless otherwise specified, generally have the meanings commonly understood by those of ordinary skill in the art. The present invention will be further described in detail below in conjunction with specific examples and with reference to data. The following examples are intended to illustrate the present invention and are not intended to limit the scope of the present invention in any way.

[0026] The experimental methods in the following examples, unless otherwise specified, are all conventional methods, and are performed according to the techniques or conditions described in the literature in the field or according to the product instructions. The experimental materials, reagents, drugs, etc. used in the following examples, unless otherwise specified, can all be purchased through general channels.

[0027] In the following embodiments,

[0028] The weeds were collected from wheat fields in Yutai, Shandong, and obtained by breeding and keeping seeds in the laboratory;

[0029] The expression vector pEGOEPubi-H is a commercial vector provided by Aidijing Biotechnology Co., Ltd., which was modified from the PC1300 series vector by Liu Yaoguang's technical team at South China Agricultural University;

[0030] Escherichia coli competent cells DH5a were purchased from Shanghai Weidi;

[0031] Rice Zhonghua 11 variety was provided by Aidijing Biotechnology Co., Ltd.;

[0032] Example 1

[0033] Cloning of GSTF2 gene from Glechoma longituba

[0034] Total RNA extracted from Psoralea corylifolia was used One-Step gDNA Removal and cDNA Synthesis SuperMix was used to reverse transcribe RNA to obtain cDNA. Using this as a template, GSTF2 gene-specific primers were used for PCR amplification. The reaction system and reaction procedure were as follows:

[0035] According to the full gold The instructions of the FastPfu DNA Polymerase kit require the preparation of a PCR reaction system; PCR reaction program: 95°C for 2 min; 95°C for 20 s, 55°C for 20 s, 72°C for 20 s, 35 cycles; 72°C for 5 min.

[0036] The target gene PCR product was purified, recovered, cloned and sequenced to obtain the nucleic acid sequence of the GSTF2 gene of Glechoma longituba as shown in SEQ ID NO: 1, and the amino acid sequence encoded by the GSTF2 gene was shown in SEQ ID NO: 2.

[0037] SEQ ID NO:1(5'→3')

[0038] ATGGCGCCAGCGGCGGTGAAGGTGTACGGGTGGGCGGTGTCGCCGTTCGTGGCGCGCGCTGCTGTGCCTGGAGGAGGCCGGCGTCGAGTACGAGCTCGCCCCCATGAGCCGCGAGGCCGGCGACCACCTCCGCCCCGACTTCCTCGCCAGGAACCCCTTCGCCCAGG TGCCCGTCCTCGAGGACGGCGACCTCACCCTCTTCGAGTCGCGCGCGATTGCCAGGCACGTGCTGCGCAAGCACAAGCCGGAGCTGCTGGCGGGCGACGGCTCGCCGGAGGCGGCGGCGATGGTGGACGTGTGGCTGGAGGTGGAGGCGCAGCAGCACCACGGCCCCATG GGCGCCATCACGGTGCAGTGCATCCTCACCCACTCCTCGGCGGCGTGCCGACCAGGCAGTTGTGGACGAGAACGTCGCCAAGCTGAAGAAGGTGTTGGAGGTGTACGAGGCGCGGCTGTCGACCTCAAGGTACCTCGCTGGGGAGTCCGTCAGCCTCGCCGACCTCA GCCACTTCCCGGTGATGCGCTACTTCATGGAGACCGAGTACAAGACGCTGGTGGAGGAGCGACCCCACGTGAAGGCGTGGTGGGAGGAGCTCAAGGCCAGGCCGGCGGCGAGGAAAGTCACGGAGTTCATGCCGCCGGACTTTGGGTTCGGGAAGAAGGCAGACCAGTGA

[0039] SEQ ID NO:2

[0040] MAPAAVKVYGWAVSPFVARALLCLEEAGVEYELAPMSREAGDHLRPDFLARNPFAQVPVLEDGDLTLFESRAIARHVLRKHKPELLAGDGSPEAAAMVDVWLEVEAQQHHGP MGAITVQCILTPLLGGVRDQAVVDENVAKLKKVLEVYEARLSTSRYLAGESVSLADLSHFPVMRYFMETEYKTLVEERPHVKAWWEELKARPAARKVTEFMPPDFGFGKKADQ

[0041] GSTF2 gene-specific primers:

[0042] F: 5'-ATGGCGCCAGCGGCG-3' (SEQ ID NO: 3);

[0043] R: 5'-TCACTGGTCTGGCCTTCTT-3' (SEQ ID NO: 4).

[0044] Example 2

[0045] Construction of GSTF2 gene overexpression vector

[0046] The cDNA extracted from the total RNA of the extracted radix scutellariae was reverse transcribed as a template, and the primers containing restriction sites were used for PCR amplification. After the product was electrophoresed, the agarose gel DNA recovery kit (DP209-03) of Tiangen Biochemical Technology Co., Ltd. was used to recover the target fragment to obtain the gene fragment containing the restriction site. The fragment was connected to the expression vector pEGOEPubi-H and transformed into the competent Escherichia coli DH5a cells. The UBI-F / NOS-R primer pair was used for colony PCR screening of positive clones, and the plasmid of the positive clone was extracted for Sanger sequencing. The sequencing primers NOS-R / UBI-F were used for sequencing. The sequencing result sequence was consistent with the sequence of the target fragment, which was the successfully constructed GSTF2 gene overexpression vector (pEGOEPubi-H-GST).

[0047] The primer sequences containing restriction enzyme cutting sites are as follows:

[0048] F: 5'-ActagggtctcGCACCATGGCGCCAGCGGCGGTGAAGGTG-3' (SEQ ID NO: 5);

[0049] R:5'-ActagggtctcTACCGTCACTGGTCTGCCTTCTTCCCGAACCCAAAGTCCGG-3'

[0050] (SEQ ID NO:6);

[0051] The nucleotide sequence of the UBI-F / NOS-R primer pair is as follows:

[0052] UBI-F: 5'-TTAGCCCTGCCTTCATACGC-3' (SEQ ID NO: 7);

[0053] NOS-R: 5'-ATCATCGCAAGACCGGCAAC-3' (SEQ ID NO: 8);

[0054] The constructed vector map of pEGOEPubi-H-GST is as follows: Figure 1 As shown, pEGOEPubi-H-GST was digested with EcoRI / HindIII, and the product was detected by agarose gel electrophoresis. The results are as follows Figure 2 As shown, three DNA fragments of 8906 bp, 1578 bp and 1524 bp were obtained after enzyme digestion.

[0055] Example 3

[0056] Obtaining Transgenic Rice with GSTF2 Gene

[0057] 1. Inducing callus using mature rice embryos

[0058] (1) Disinfection: Take mature rice seeds (Zhonghua 11 varieties), mechanically dehull them, select plump and high-quality seeds without sterile spots, and disinfect them;

[0059] (2) Induction: The sterilized seeds were inoculated onto MS medium supplemented with 2,4-D to induce callus tissue;

[0060] Induction conditions: light tissue culture box, light intensity ≤500lux, temperature 24℃, humidity 70%.

[0061] MS medium supplemented with 2,4-D: 1 mg / mL of 2,4-D was added to the MS medium to make a final concentration of 2 μg / mL. The MS medium was purchased from Qingdao Haibo Biotechnology Co., Ltd. and the composition is shown in Table 1.

[0062] Table 1 MS medium components

[0063]

[0064] 2. Cultivation of Agrobacterium containing GSTF2 gene overexpression vector

[0065] The pEGOEPubi-H-GST vector obtained in Example 2 was transformed into Agrobacterium competent EHA105 (Weidi Biotech); a single colony was picked and placed in a culture medium for shaking culture. The culture medium was LB medium containing kanamycin (50 μg / mL), and the culture conditions were 30°C and 200 rpm shaking for 24-48 hours.

[0066] The cultured Agrobacterium liquid was placed in a centrifuge tube, centrifuged and the supernatant was discarded, the precipitate was retained, and the resuspension liquid was added to prepare the Agrobacterium suspension, in which the bacterial concentration was about 1×10 8 cfu / mL. The resuspension formula is shown in Table 2 below:

[0067] Table 2 Resuspension formula composition

[0068] Element Concentration (mg / L) <![CDATA[Potassium dihydrogen phosphate KH2PO4]]> 170 <![CDATA[Magnesium sulfate MgSO4·7H2O]]> 370 Potassium chloride KCl 2940 <![CDATA[Calcium chloride Cacl2·2H2O]]> 440 <![CDATA[Manganese sulfate MnSO4.4H2O]]> 10 <![CDATA[Sodium molybdate Na2MoO4.2H2O]]> 0.25 <![CDATA[Boric acid H3BO3]]> 3 <![CDATA[Zinc sulfate ZnSO4.7H2O]]> 2 Potassium iodide KI 0.75 <![CDATA[Copper sulfate CuSO4.5H2O]]> 0.0387 <![CDATA[Cobalt chloride CoCl2.6H2O]]> 0.025 <![CDATA[Ferrous sulfate FeSO4.7H2O]]> 27.8 <![CDATA[Sodium ethylenediaminetetraacetate Na2EDTA]]> 37.8 Glycine 7.5 Arginine 174 Glutam 876 Myo-inositol 100 Niacin 0.5 Thiamine Hydrochloride (VB1) 0.5 Pyridoxine Hydrochloride (VB6) 0.5 Hydrolyzed casein Casamino acids 500 Acetosyringone AS 19.62

[0069] 3. Agrobacterium and callus co-culture

[0070] The callus induced in step 1 was placed in the Agrobacterium suspension prepared in step 2 and infected for 30 minutes. After infection, the callus was placed on a co-culture medium and cultured in the dark at 27° C. for 3 days. The composition of the co-culture medium is shown in Table 3.

[0071] Table 3 Composition of co-culture medium

[0072]

[0073]

[0074] 4. Screening of resistant callus

[0075] The callus tissue after the co-cultivation in step 3 is taken out, dried, and then transferred to a screening medium for the first screening; then the initial callus with resistant callus is transferred to a new screening medium for the second screening.

[0076] The screening medium is MS medium (containing agar and sucrose, purchased from Qingdao Haibo Biotechnology Co., Ltd.) + hygromycin (final concentration is 0.3 mg / mL), and the screening culture condition is dark culture at 30° C. for 15 days.

[0077] 5. Induction, differentiation and rooting of resistant callus

[0078] The resistant callus obtained in step 4 was picked and transferred into a culture dish containing differentiation medium (the components are shown in Table 4), sealed with a sealing film, and placed in a constant temperature culture room to wait for differentiation into seedlings. The culture conditions were 28°C light culture for 14 hours and 25°C dark culture for 10 hours. When the seedlings grew to about 1 cm, they were transferred to a rooting medium for seedling growth. The rooting medium was 1 / 2MS medium (purchased from Qingdao Haibo Biotechnology Co., Ltd.), and the culture conditions were 25°C light culture for 14 hours and dark culture for 10 hours.

[0079] Table 4 Differentiation medium composition

[0080]

[0081]

[0082] 6. Identification of transgenic rice with GSTF2 gene

[0083] The genomic DNA of the transgenic rice was extracted, and the hygromycin gene-specific primers were used to amplify the rice seedlings to detect whether they contained the hygromycin gene. The product was detected by agarose gel electrophoresis, and the amplification result of the pEGOEPubi-H-GST vector obtained in Example 2 was used as a positive control. The results are as follows: Figure 3 As shown, a total of 11 strains were sampled, and all 11 strains were PCR positive, with a positive rate of 100%.

[0084] Example 4

[0085] 1. Study on resistance of transgenic rice with GSTF2 gene to fenoxaprop-butyl

[0086] The transgenic positive rice seedlings of Example 3 were cultivated until homozygous T2 transgenic rice seeds were harvested. The homozygous rice seeds were placed in a culture dish for germination, and after germination, they were transferred to pots for cultivation, with 5 plants per pot. They were then moved to a greenhouse for cultivation. During the test, the greenhouse temperature was 28°C / 20°C, with natural light and a relative humidity of 75%. When the plants grew to the 3-5 leaf stage, they were sprayed with fenoxaprop-butyl at a concentration of 0, 6.78, 20.3, 61, 183, 549 g ai / ha, a spray volume of 450 L / ha, and a spray pressure of 275 kPa, with wild-type rice as the control.

[0087] The results are as follows Figure 4 As shown, the inhibitory concentration (GR 50 ) was 18.62 ga.i. / ha, and the GSTF2 gene-transformed rice (GST) GR 50 It was 179.52 g ai / ha, which was 9.64 times that of wild-type rice. Transgenic GSTF2 rice (GST) showed obvious resistance to fenoxaprop-butyl.

[0088] 2. Study on the resistance of transgenic rice with GSTF2 gene to high-efficiency haloxyfop-butyl

[0089] The transgenic positive rice seedlings of Example 3 were cultivated until homozygous T2 transgenic rice seeds were harvested. The homozygous rice seeds were placed in a culture dish for germination, and after germination, they were transferred to pots for cultivation, with 5 plants per pot. They were then moved to a greenhouse for cultivation. During the test, the greenhouse temperature was 28°C / 20°C, with natural light and a relative humidity of 75%. When the plants grew to the 3-5 leaf stage, they were sprayed with high-efficiency flupyramide at a concentration of 0, 1.78, 5.33, 16, 48, 144 g ai / ha, a spray volume of 450 L / ha, and a spray pressure of 275 kPa.

[0090] The results are as follows Figure 5 As shown, the high-efficiency halpyrifos-methyl has an effect on GR of wild-type rice (WT). 50 13.48g ai / ha, transgenic GSTF2 rice (GST)GR 50 It was 21.91 g ai / ha, which was 1.63 times that of wild-type rice. Therefore, transgenic GSTF2 rice did not show obvious resistance to the high-efficiency fluazifop-p-ethyl.

[0091] 3. Study on resistance of transgenic rice with GSTF2 gene to clodinafop-butyl

[0092] The transgenic positive rice seedlings of Example 3 were cultivated until homozygous T2 transgenic rice seeds were harvested. The homozygous rice seeds were placed in a culture dish for germination, and after germination, they were transferred to pots for cultivation, with 5 plants per pot. They were then moved to a greenhouse for cultivation. During the test, the greenhouse temperature was 28°C / 20°C, with natural light and a relative humidity of 75%. When the plants grew to the 3-5 leaf stage, they were sprayed with clodinafop-butyl at a spraying concentration of 0, 2.52, 7.56, 22.67, 68, and 204 g ai / ha, a spraying volume of 450 L / ha, and a spraying pressure of 275 kPa.

[0093] The results are as follows Figure 6 As shown, the effect of clodinafop-butyl on GR of wild-type rice (WT) 50 17.19 g ai / ha, transgenic GSTF2 rice (GST)GR 50 It was 75.6 g ai / ha, which was 4.40 times that of wild-type rice. Therefore, transgenic GSTF2 rice showed a low level of resistance to clodinafop-butyl.

[0094] 4. Study on resistance of transgenic rice with GSTF2 gene to fenthiocarb

[0095] The transgenic positive rice seedlings of Example 3 were cultured until homozygous T2 transgenic rice seeds were harvested. The homozygous rice seeds were placed in a culture dish for germination, and after germination, they were transferred to pots for cultivation, with 5 plants per pot. They were then moved to a greenhouse for cultivation. During the test, the greenhouse temperature was 28°C / 20°C, with natural light and a relative humidity of 75%. When the plants grew to the 3-5 leaf stage, they were sprayed with thiamethoxam at a concentration of 0, 6.96, 20.89, 62.67, 188, 564 g ai / ha, a spray volume of 450 L / ha, and a spray pressure of 275 kPa.

[0096] The results are as follows Figure 7 As shown in the results, it was found that oxadiazine had an inhibitory effect on GR of wild-type rice (WT). 50 157.36g ai / ha, transgenic GSTF2 rice (GST)GR 50 It was 191.68g ai / ha, which was 1.22 times that of wild-type rice, and did not show obvious resistance to sethoxydim.

[0097] 5. Study on resistance of transgenic rice with GSTF2 gene to clethodim

[0098] The transgenic positive rice seedlings of Example 3 were cultured until homozygous T2 transgenic rice seeds were harvested. The homozygous rice seeds were placed in a culture dish for germination, and after germination, they were transferred to pots for cultivation, with 5 plants per pot. They were then moved to a greenhouse for cultivation. During the test, the greenhouse temperature was 28°C / 20°C, with natural light and a relative humidity of 75%. When the plants grew to the 3-5 leaf stage, they were sprayed with clethodim at a spraying concentration of 0, 3.33, 10, 30, 90, 270 g ai / ha, a spraying volume of 450 L / ha, and a spraying pressure of 275 kPa.

[0099] The results are as follows Figure 8 As shown, clethodim has an effect on GR of wild-type rice (WT). 50 52.18 g ai / ha, transgenic GSTF2 rice (GST)GR 50 It was 168.64 g ai / ha, 3.23 times that of wild-type rice, showing a low level of resistance to sethoxydim.

[0100] 6. Study on the resistance of transgenic rice with GSTF2 gene to pinoxaden

[0101] The transgenic positive rice seedlings of Example 3 were cultivated until homozygous T2 transgenic rice seeds were harvested. The homozygous rice seeds were placed in a culture dish for germination, and after germination, they were transferred to pots for cultivation, with 5 plants per pot. They were then moved to a greenhouse for cultivation. During the test, the greenhouse temperature was 28°C / 20°C, with natural light and a relative humidity of 75%. When the plants grew to the 3-5 leaf stage, they were sprayed with pinoxaden at a spraying concentration of 0, 2.22, 6.67, 20, 60, 180 g ai / ha, a spraying volume of 450 L / ha, and a spraying pressure of 275 kPa.

[0102] The results are as follows Fig. 9 As shown, pinoxaden had an effect on GR in wild-type rice (WT). 50 9.18g ai / ha, transgenic GSTF2 rice (GST)GR 50 It was 49.32 g ai / ha, which was 5.37 times that of wild-type rice, and showed a mild to moderate level of resistance to pinoxaden.

[0103] The above is only a preferred embodiment of the present invention, and does not limit the present invention in other forms. Any technician familiar with the profession may use the above disclosed technical content to change or modify it into an equivalent embodiment with equivalent changes. However, any simple modification, equivalent change and modification made to the above embodiment according to the technical essence of the present invention without departing from the technical solution of the present invention still belongs to the protection scope of the technical solution of the present invention.

Claims

1. Application of the GSTF2 gene of Glechoma longituba in improving the herbicide resistance of plants, characterized in that: The amino acid sequence encoded by the GSTF2 gene of the Herba Lysimachiae is shown in SEQ ID NO: 2; The herbicide is an acetyl-CoA carboxylase inhibitor herbicide.

2. The use according to claim 1, characterized in that: The nucleic acid sequence of the Glechoma longituba GSTF2 gene is shown in SEQ ID NO:

1.

3. The use according to claim 2, characterized in that: The nucleic acid sequence of the GSTF2 gene of Glechoma longituba is constructed into an expression vector, and the vector is transformed into a plant to make the gene expressed in the plant, so that the plant has the ability to resist herbicides.

4. The use according to claim 1, characterized in that: The herbicides are fenoxaprop-butyl, clodinafop-butyl, clethodim and pinoxaden.

5. A method for improving the herbicide resistance of plants, characterized in that: The nucleic acid sequence of the GSTF2 gene of Glechoma longituba is constructed into an expression vector, and the vector is transformed into a plant to express the gene in the plant, so that the plant has the ability to resist herbicides; the nucleic acid sequence of the GSTF2 gene of Glechoma longituba is shown in SEQ ID NO: 1; The herbicide is an acetyl-CoA carboxylase inhibitor herbicide.

6. The method for improving plant resistance to herbicides according to claim 5, characterized in that: The herbicides are fenoxaprop-butyl, clodinafop-butyl, clethodim and pinoxaden.

7. The method for improving plant resistance to herbicides according to any one of claims 5 to 6, characterized in that: The plant is rice or wheat.

Images