Liquid laundry detergent formulation

Abstract

The present invention relates to a liquid laundry detergent formulation containing a plant-based biodegradable surfactant and a fermented surfactant.

Description

[0001] References to sequence listings

[0002] This application contains a Sequence Listing in computer readable form. This computer readable form is incorporated herein by reference. Technical Field

[0003] The present invention relates to liquid laundry detergent formulations containing a plant-based biodegradable surfactant and a fermented surfactant. Background Art

[0004] As is well known, detergent compositions include a large number of ingredients that provide specific functionality throughout the cleaning process. However, some detergent ingredients face scrutiny due to potential environmental issues, most importantly because they come from non-renewable sources and are difficult to biodegrade or even persist in the environment, and therefore are unsustainable. It is desirable to provide alternatives that have improved sustainability characteristics while maintaining compatibility with other detergent ingredients. In addition, consumer benefits and performance effects must be maintained. Summary of the invention

[0005] Petrochemically derived detergent ingredients are not sustainable as they come from non-renewable sources and are often poorly biodegradable or even persist in the environment. The present inventors were able to reduce the total amount of surfactant (compared to commercially available environmentally friendly detergents) while maintaining washing performance by partially replacing surfactants with enzymes.

[0006] The plant-based green formulations of the present invention are sustainable and cost-effective formulations compared to commercial plant-based benchmarks. The cost window provides an opportunity to incorporate more enzymes to improve wash performance - stain removal and whiteness.

[0007] In summary, the present invention provides a new detergent in which surfactants can be replaced by enzymes, which is more compact than existing environmentally friendly detergents, has less impact on the environment than traditional fossil-based detergents, and maintains washing performance. DETAILED DESCRIPTION

[0008] definition

[0009] In light of this detailed description, the following definitions apply. Note that the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise.

[0010] The pH of the formulation is the pH of 3.3 grams of the liquid laundry detergent composition dissolved in one litre of demineralised water at 25°C.

[0011] Unless defined otherwise or clearly indicated by the context, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.

[0012] Unless otherwise defined or clearly indicated by the context, all component levels provided herein are with reference to the active level of that component.

[0013] The percentages of products refer to the relevant protonated form of the product.

[0014] Unless otherwise indicated, all percentages and ratios of all components are calculated by weight. Unless otherwise indicated, all percentages are calculated based on the total composition.

[0015] Detergent composition

[0016] The term "detergent composition" refers to a composition for removing undesirable compounds from articles to be cleaned, such as textiles, dishes, and hard surfaces. Detergent compositions can be used, for example, to clean textiles, dishes, and hard surfaces, for both domestic and industrial cleaning, and / or for fabric care. These terms encompass any material / compound selected for the desired particular type of cleaning composition and form of the product (e.g., liquid, gel, powder, granule, paste, or spray composition), and include, but are not limited to, detergent compositions (e.g., liquid and / or solid laundry detergents and fine fabric detergents; hard surface cleaning formulations, such as for glass, wood, plastic, ceramic, and metal countertops and windows; carpet cleaners; oven cleaners; fabric fresheners; fabric softeners; and textile and clothing pre-stain removers, together with dishwashing detergents). In addition to the enzymes of the invention, the detergent formulations may also contain one or more additional enzymes (e.g., amylases, proteases, peroxidases, cellulases, β-glucanases, xyloglucanases, hemicellulases, xanthanases, xanthan lyases, lipases, acyltransferases, phospholipases, esterases, laccases, catalases, arylesterases, amylases, α-amylases, glucoamylases, cutinases, pectinases, pectinase lyases, keratinases, reductases, oxidases, phenoloxidases, lipoxygenases, ligninases, carrageenase, pullulanases, tannases, arabinosidases, hyaluronidases, chondroitinases, xyloglucanases, xylanases, pectin acetylesterases, polygalacturonidases, rhamnogalacturonidases, other endo-β-mannanases, The detergent composition may comprise one or more detergent components of any type, such as surfactants, hydrotropes, builders, co-builders, chelating agents or chelating agents, bleaching systems or bleaching components, polymers, fabric hueing agents, fabric conditioners, foam boosters, foam suppressors, dispersants, dye transfer inhibitors, fluorescent whitening agents, perfumes, tarnish inhibitors, optical brighteners, bactericides, fungicides, soil suspending agents, soil release polymers, anti-redeposition agents, enzyme inhibitors or stabilizers, enzyme activators, antioxidants, and solubilizing agents.

[0017] Improved washing performance

[0018] The term "improved wash performance" is defined herein as an enzyme that exhibits improved wash performance in a detergent composition relative to the wash performance of a reference enzyme when evaluated on a fresh sample and / or after storage of the sample under the same conditions, e.g., by increased color clarification and / or anti-pilling effect. The term "improved wash performance" includes wash performance in laundry washing and also in, for example, hard surface cleaning such as automated dishwashing (ADW).

[0019] Plant-based surfactants

[0020] Plant-based surfactants are surfactants based on those derived from palm kernel or coconut oil as well as plant ingredients such as glucose and vegetable oils.

[0021] textile

[0022] The term "textile" means any textile material, including yarn, yarn intermediates, fibers, nonwoven materials, natural materials, synthetic materials, and any other textile materials, fabrics made from these materials, and products made from fabrics (e.g., clothing and other products). Textiles or fabrics can be in the form of knitwear, woven fabrics, denim, nonwoven fabrics, felt, yarn, and terry cloth. The textile can be cellulose-based, such as natural cellulose products, including cotton, flax / linen, jute, ramie, sisal, or coconut fiber, or man-made cellulose products (e.g., derived from wood pulp), including viscose / rayon, cellulose acetate fibers (tricell), lyocell fibers, or their blends. Examples of blends are blends of cotton and / or rayon / viscose with one or more accompanying materials such as wool, synthetic fibers (e.g. polyamide fibers, acrylic fibers, polyester fibers, polyvinyl chloride fibers, polyurethane fibers, polyurea fibers, aramid fibers) and / or cellulose-containing fibers (e.g. rayon / viscose fibers, ramie, flax / linen, jute, cellulose acetate fibers, lyocell fibers). The fabric may be a conventional washable garment, such as stained household clothing. When the term fabric or garment is used, the broad term textile is also intended to be included.

[0023] Washing liquid

[0024] The term "wash liquor" refers to an aqueous solution containing a detergent composition in a diluted form, such as, but not limited to, a detergent solution containing a laundry detergent composition in a diluted form, such as the wash liquor in a laundry washing process.

[0025] Washing performance

[0026] Ability to remove or reduce stains on clothing

[0027] Whiteness

[0028] The term "whiteness" is defined herein as a broad term with different meanings in different areas and for different customers. Loss of whiteness can be due to graying, yellowing, or removal of optical brighteners / toners, for example. Graying and yellowing can be due to soil redeposition, body soil, coloring from, for example, iron and copper ions or dye transfer. Whiteness can include one or more problems from the following list: colorant or dye action; incomplete stain removal (e.g., body soil, sebum, etc.); redeposition (graying, yellowing or other discoloration of an object) (re-association of removed soil with other parts of the textile (soiled or unsoiled)); chemical changes in the textile during application; and clarification or brightening of the color.

[0029] Exemplary Liquid Laundry Detergent Formulations of the Present Invention

[0030] The present invention relates to a laundry detergent formulation comprising

[0031] 6%-10% anionic surfactants such as AES (alkyl ether sulfates), AS (alkyl sulfates), SLES preferably with 1-3 moles of ethoxylation, MES (methyl ester sulfonates), OS (olefin-sulfonates), Sophorolipids

[0032] 3%-10% nonionic surfactant, such as alkyl polyglucoside (APG), preferably APG, C 8 -C 14 Glucosides (alkyl polyglucosides), FAEO-fatty alcohol ethoxylates with 3-9 moles of ethoxylation, rhamnolipids, glucosamides

[0033] 3%-8% builder, such as citric acid or substoichiometric amounts of GLDA (N,N-dicarboxymethylglutamate tetrasodium salt), MGDA (methylglycine diacetate trisodium salt), CMI (carboxymethyl inulin), EDDS (ethylenediamine disuccinic acid) or preferably sodium citrate

[0034] 1%-5% soap, preferably obtained from coconut fatty acids or palm kernel oil fatty acids

[0035] 3%-10% solvent, preferably a polyol such as glycerol

[0036] 0.4%-0.7% preservatives, preferably phenoxyethanol (2-phenoxyeth-1-ol), sodium benzoate, potassium sorbate, organic acid

[0037] 0.4%-0.7% viscosity modifier, preferably sodium chloride or hydroxyethylcellulose

[0038] Add water to 100%

[0039] Enzymes can be added to detergent formulations as desired.

[0040] The pH range of the final laundry detergent formulation is 8-9, preferably 8.2-8.8, more preferably 8.4-8.6.

[0041] Ingredients useful in formulating the liquid laundry detergent formulations of the present invention are described in more detail below.

[0042] Anionic surfactants

[0043] Anionic surfactants are a major component of laundry detergents and are therefore difficult to replace. One of the most prominent anionic surfactants is linear alkylbenzene sulfonate (LAS), which contains a variety of chain lengths, but since LAS is based on non-renewable sources and is not allowed for use in eco-labeled products, it is important in the context of the present invention to find alternative anionic surfactants with more sustainable characteristics. In the search for such LAS alternatives, alkyl ethoxy sulfates, especially SLES, have been shown to be useful.

[0044] Alkyl ethoxy sulfates (AES, alkyl poly(oxyethylene) sulfates) have the general formula CH 3 (CH 2 ) m (OCH 2 CH 2 ) n OSO 3 - It contains a combination of nonionic groups and anionic groups. It is a common anionic type of liquid detergent (usually liquid detergent made of citrate).

[0045] SLES is a specific type of AES with the chemical formula CH 3 (CH 2 ) 11 (OCH 2 CH 2 ) n OSO 3 The products are heterogeneous in the number of ethoxy groups, where n is an average value, such as SLES, 2EO indicating the presence of two ethoxy groups.

[0046] SLES is made by ethoxylation of dodecanol, which is produced industrially from palm kernel oil or coconut oil, and is considered safe for consumer use: testing in the United States has shown it to be safe for consumer use, and the Australian Government Department of Health and Ageing and its National Industrial Chemicals Notification and Assessment Service (NICNAS) have determined that SLES does not react with DNA.

[0047] Nonionic surfactants

[0048] Nonionic surfactants provide oil emulsification properties to detergents and are mostly easily formulated into liquid detergents. Detergents typically contain 3%-10% nonionic surfactants, but liquid formulations usually contain more. There are many types of nonionic surfactants, some of which are almost exclusively used in industry due to toxicological and biodegradability issues, such as alkylphenol ethoxylates (APEs).

[0049] APG (Alkyl Polyglucoside) is a sugar-based surfactant characterized by a sugar unit and a hydrophobic alkyl chain. APG may differ in alkyl chain length (straight chain and single branched chain) and the degree of polymerization of the sugar. APG is considered to be an attractive nonionic surfactant due to its low toxicity, biodegradability and production from natural renewable resources and is widely used in the food, drug and cosmetic industries. In a preferred embodiment of the present invention, the alkyl length is in the range of 6-16 and the degree of polymerization is 1-3.

[0050] Other nonionic surfactants are bio-based surfactants, for example, wherein the surfactant is a sugar-based nonionic surfactant, which may be hexyl-β-D-maltopyranoside, thiomaltopyranoside or cyclic maltopyranoside, such as described in EP 2516606 B1. Sophorolipids and rhamnolipids are also considered to be related. Sophorolipids are glycosides and esters of disaccharide sophorose (β-D-pyranose glucopyranosyl-(1→2-D-glucose)) combined with hydroxy fatty acids. They exist in a closed form (lactone) at low to medium pH, and are therefore nonionic, and in an open form at high pH, ​​wherein sophorolipids are anionic. Rhamnolipids are glycolipids that can be in the form of monorhamnolipids or dirhamnolipids, consisting of one or two rhamnose groups and 3-(hydroxyalkanoyloxy) alkanoic acid (HAA) fatty acid tails (such as 3-hydroxydecanoic acid).

[0051] Detergent

[0052] Adding builders to specifically remove Ca from water 2+ and Mg 2+ Phosphates are widely used in the production of detergents, because they severely impair the performance of anionic surfactants. Traditionally, phosphates have been the preferred builder, but their use has been greatly reduced or even banned due to the potential for eutrophication.

[0053] Sodium citrate (sodium salt of 2-hydroxypropane-1,2,3-tricarboxylate) is a widely used detergent builder in liquid detergents. Sodium citrate is produced from renewable raw materials, is biodegradable and inexpensive.

[0054] soap

[0055] Soaps are obtained by saponification of fats, i.e., carboxylates of fatty acids, e.g.

[0056] CH 3 [CH 2 ] n CH 2 COO - , where n can be different in a particular soap source, for example, soaps made from coconut fatty acids contain the major fatty acids found in coconut oil, namely, lauric acid (12:0), myristic acid (14:0), palmitic acid (16:0), oleic acid (18:1ω-9), stearic acid (18:0), and linoleic acid (18:2ω-6), which account for about 49% to about 2% of the fatty acids in coconut fatty acids.

[0057] The salt is preferably selected from alkali metal salts (especially sodium (Na) and potassium (K)), MEA (monoethanolamine, i.e., 2-aminoethan-1-ol, NH 2 CH 2 CH 2 OH), DEA (diethanolamine, i.e., 2,2'-iminodiethanol-1-ol, NH(CH 2 CH 2 OH) 2 ) and TEA (triethanolamine, i.e., 2,2',2"-nitrilotriethanol-1-ol, N(CH 2 CH 2 OH) 3 ). Since DEA forms toxic byproducts during manufacturing, this ingredient is less than ideal as a salt.

[0058] In the context of the present invention, soaps based on coconut fatty acids and soaps based on palm kernel fatty acids are preferably used, as these come from renewable, plant-based sources, have mild detergency and are used in detergents for cleaning applications.

[0059] Solvents

[0060] Unstructured liquid detergents, i.e., isotropic solutions of surfactants and builders, may also contain solvents such as ethanol, isopropanol (propan-2-ol), and polyols. Polyols are good solvents for surfactant systems and are typically selected from: glycerol (propane-1,2,3-triol), MPG (propane-1,2-diol), diethylene glycol (2,2′-oxydi(ethane-1-ol)), and dipropylene glycol (a mixture of three isomeric chemical compounds 4-oxa-2,6-heptanediol, 2-(2-hydroxy-propoxy)-propan-1-ol, and 2-(2-hydroxy-1-methyl-ethoxy)-propan-1-ol).

[0061] Typically 2% to 5% polyols stabilize the enzymes present in detergents.

[0062] In liquid detergents, the solvent is also often called the hydrotrope; the two terms are used interchangeably.

[0063] preservative

[0064] Phenoxyethanol (2-phenoxyethane-1-ol), isothiazolinones such as benzisothiazol-3(2H)-one (Proxel TM ) and 2-methylisothiazol-3(2H)-one, Bronopol (2-bromo-2-nitropropane-1,3-diol) and lactic acid. Different preservatives are subject to different regulatory restrictions, and their effectiveness depends on pH and other ingredients.

[0065] For the purposes of the present invention, it is important to select a preservative that is as environmentally friendly as possible while still acting as both a fungicide and a bactericide (broad spectrum). Thus, phenoxyethanol, sodium benzoate, potassium sorbate or organic acids are preferred over allergenic isothiazolinones and other formaldehyde-releasing preservatives (such as Bropol).

[0066] Viscosity modifier

[0067] In principle, all ingredients in a liquid detergent composition affect the viscosity of the final product. Some ingredients, such as amine oxides and betaine, are added specifically for this purpose. Xanthan gum can also be used as a thickener. For the purposes of the present invention, sodium salts are preferred, such as sodium sulfate or magnesium sulfate or magnesium chloride or preferably sodium chloride.

[0068] polymer

[0069] Generally, polymers are preferably avoided because they are derived from petrochemical non-renewable resources and they can be replaced (partially or completely) by enzymes, in particular DNA enzymes, cellulases or xyloglucanases (see, for example, WO 2021 / 0580222 and WO 2021 / 058023). When adding polymers for, for example, soil removal, the polymer can be selected from, for example, poly(ethyleneimine) and polyethylene and / or polypropylene terephthalate.

[0070] Enzymes

[0071] Enzymes can improve the washing performance of liquid laundry detergents and can be added as needed. Preferably, the one or more enzymes are selected from the group consisting of amylases, proteases, peroxidases, cellulases, beta-glucanases, xyloglucanases, hemicellulases, xanthanases, xanthan lyases, lipases, acyltransferases, phospholipases, esterases, laccases, catalases, arylesterases, amylases, alpha-amylases, glucoamylases, cutinases, pectinases, pectin lyases, keratinases, reductases, oxidases, phenoloxidases. , lipoxygenase, ligninase, carrageenase, pullulanase, tannase, arabinosidase, hyaluronidase, chondroitinase, xyloglucanase, xylanase, pectin acetylesterase, polygalacturonase, rhamnogalacturonase, other endo-β-mannanase, exo-β-mannanase, pectin methylesterase, cellobiohydrolase, transglutaminase, lichenase, laminarinase, DNA enzyme or any combination thereof. The technician will know that the amount of enzyme depends on the type of enzyme and the actual washing conditions (e.g., country / region, detergent for colored or white clothes), but in general, the amount of enzyme in the liquid detergent is in the range of 10ppm to 700ppm.

[0072] Detailed Description of the Liquid Laundry Detergent Formulations of the Invention

[0073] The inventors of the present invention have surprisingly found that a liquid laundry detergent formulation comprising the following ingredients (in wt.%) has comparable performance to the commercially available environmentally friendly liquid laundry detergent OVAQ Non-Bio:

[0074] 8% AES, preferably SLES, more preferably SLES, 2EO

[0075] 4% alkyl polyglucoside (APG), preferably APG, C 8 -C 14 Glucoside

[0076] 4% Sodium Citrate

[0077] 2% soap, preferably obtained from coconut fatty acids

[0078] 4% polyols, such as glycerin

[0079] 0.5% viscosity modifier, preferably sodium chloride

[0080] 0.4% - 0.6% preservative, preferably phenoxyethanol (2-phenoxyeth-1-ol) (can be added to the final product). The total percentage of surfactants in the above formulation is 14% (including soap), which is much lower than the level of surfactants in the above commercially available detergents (17% - 18%). In the experimental part it is demonstrated that the initial decrease in washing performance in terms of stain removal and whiteness caused by the reduction in the total surfactant level can be reversed by the addition of enzymes ( Pure 300L and / or a cellulase having SEQ ID NO: 1). Thus, the present inventors replaced surfactants with fully renewable, biodegradable and non-petrochemically derived enzymes while maintaining performance.

[0081] Embodiments of the present invention

[0082] The following examples disclose the liquid detergent formulations and uses of the present invention:

[0083] 1. A liquid laundry detergent composition comprising

[0084] a. 7%-9%, preferably 8% AES

[0085] b. 3%-5%, preferably 4% APG

[0086] c. 3%-5%, preferably 4% detergent

[0087] d. 1%-3%, preferably 2% soap

[0088] e. 3%-5%, preferably 4% polyol.

[0089] 2. The liquid laundry detergent composition according to embodiment 1, further comprising less than 0.7% preservative, such as 0.2%-0.7%, preferably 0.4%-0.6% preservative, and less than 0.7% viscosity regulator, such as 0.2%-0.7%, preferably 0.4%-0.6% viscosity regulator.

[0090] 3. A liquid laundry detergent composition according to any one of embodiments 1 or 2, wherein

[0091] a. AES is SLES, preferably SLES, 2EO

[0092] b.APG is APG, C 8 -C 14 Glucoside

[0093] c. The builder is sodium citrate

[0094] d. Soap is obtained from coconut fatty acids

[0095] e. The polyol is glycerol.

[0096] 4. The liquid laundry detergent composition of any of embodiments 2 or 3, wherein the preservative is 0.5% phenoxyethanol and the viscosity modifier is 0.5% sodium chloride.

[0097] 5. A liquid laundry detergent composition according to any one of embodiments 1 to 4 comprising

[0098] a.8% SLES,2EO

[0099] b.4% C 8 -C 14 Glucoside

[0100] c.4% sodium citrate

[0101] d. 2% soap obtained from coconut fatty acids

[0102] e.4% glycerol.

[0103] 6. The liquid laundry detergent composition of any of the preceding embodiments, further comprising one or more enzymes selected from the group consisting of amylases, proteases, peroxidases, cellulases, beta-glucanases, xyloglucanases, hemicellulases, xanthanases, xanthan lyases, lipases, acyltransferases, phospholipases, esterases, laccases, catalases, arylesterases, amylases, alpha-amylases, glucoamylases, cutinases, pectinases, pectin lyases, keratinase The invention relates to an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following: an enzyme comprising the following:

[0104] 7. A liquid laundry detergent composition according to any preceding embodiment wherein the pH of the formulation when dissolved in demineralized water at 25°C at 3.3 g / l is pH 4 to 10, preferably 6 to 9, more preferably 8 to 9.

[0105] 8. A method for treating textiles at home, the method comprising the following steps

[0106] a. Treating textiles with an aqueous solution of 0.15 to 20 g / L, more preferably 1 to 10 g / L of a detergent composition according to any one of Embodiments 1 to 7

[0107] b. Optionally rinsing and drying the textile.

[0108] Examples

[0109] Materials and Methods

[0110] Detergent

[0111] ·Ovi-Clean non-biological, enzyme-free (commercially available, enzyme-free)

[0112] Plant-based green detergent

[0113]

[0114] Table 1: Plant-based green detergent; pH of detergent is 8.5.

[0115] Small fabric swatch

[0116] The swatches included a combination of food, technical stains, and dirt.

[0117]

[0118]

[0119]

[0120] Table 2: Small fabric samples

[0121] Fabric

[0122] Fabrics include a combination of cotton, polycotton and synthetic standard textiles.

[0123] Material source W-80A; cotton knitwear CFT CN-42; double rib, double knit, cotton with optical brightener CFT5 CN-11; printed, woven, bleached, cotton without optical brighteners CFT T-266; Viscose Cotton Wool Printed Thin Fabric CFT W-10A; cotton (WFK standard) CFT W-20A; polyester / cotton CFT T-720; Crimped, double knit polyester CFT10 W-30A; Polyester CFT W-40A; Polyamide CFT W-12AW; Cotton terry cloth without optical brightener CFT

[0124] Table 3: Fabrics

[0125] The above commercial test materials are available from the Center for Testmaterials BV (Stoomloggerweg 11, 3133 KT, Vlaardingen, The Netherlands), or from Warwick Equest Ltd (Unit 55, Consett Business Park, Consett, County Durham, DH8 6BN, UK).

[0126] Enzymes

[0127] · Pure 300L - A liquid enzyme blend containing protease, amylase, pectin lyase, mannanase and lipase. Pure 300L is available from Novozymes A / S upon request.

[0128] · Cellulase with SEQ ID NO: 1:

[0129] QKPGETKEVH PQLTTFRCTK RGGCKPATNF IVLDSLSHPIHRAEGLGPGG CGDWGNPPPKDVCPDVESCA KNCIMEGIPD

[0130] YSQYGVTTNG TSLRLQHILP

[0131] DGRVPSPRVY LLDKTKRRYE MLHLTGFEFT FDVDATKLPC

[0132] GMNSALYLSE MHPTGAKSKY NPGGAYYGTG YCDAQCFVTP

[0133] FINGLGNIEG KGSCCNEMDI WEANSRASHV APHTCNKKGL

[0134] YLCEGEECAFEGVCDKNGCGWNNYRVNVTD

[0135] YYGRGEEFKV NTLKPFTVVT QFLANRRGKL EKIHRFYVQD

[0136] GKVIESFYTN

[0137] KEGVPYTNMIDDEFCEATGS RKYMELGATQ GMGEALTRGM

[0138] VLAMSIWWDQ GGNMEWLDHG EAGPCAKGEG APSNIVQVEP

[0139] FPEVTYTNLR WGEIGSTYQE VQKPKPKPGH GPRSD

[0140] A phosphodiesterase having SEQ ID NO: 2:

[0141] VPVNPEPDAT SVENVALKTG SGDSQSDPIK ADLEVKGQSA

[0142] LPFDVDCWAI

[0143] LCKGAPNVLQ RVNEKTKNSN RDRSGANKGP FKDPQKWGIK

[0144] ALPPKNPSWS

[0145] AQDFKSPEEY AFASSLQGGT NAILAPVNLA SQNSQGGVLN

[0146] GFYSANKVAQ

[0147] FDPSKPQQTKGTWFQITKFTGAAGPYCKALGSNDKSVCDK

[0148] NKNIAGDWGF

[0149] DPAKWAYQYD EKNNKFNYVG K

[0150] Example 1: Terg-o-tometer (TOM) assay for WP

[0151] The Terg-o-tometer is the industry standard. Incubate 1L of wash solution in a temperature controlled environment of a water bath. Mix the solution for 5 minutes and then add 1L to each beaker. The temperature in the beaker is measured to be 30.0°C or the desired temperature. Washed and rinsed swatches are dried in a drying oven overnight and are

[0152] The measurements were performed as shown in Table 2.

[0153]

[0154]

[0155] Table 4: Conditions for the Terg-o-tometer washing test

[0156] Example 2: Method for evaluating wash performance (WP)

[0157] Washing performance is expressed as Δ reflectivity (remission) value (ΔRem).After washing and rinsing, the small piece of cloth sample is spread and flattened and allowed to air-dry overnight at room temperature.The light reflection evaluation of the small piece of cloth sample dried is carried out using the Datacolor 800V reflection spectrophotometer with large aperture.Measure under the condition of UV-free in the incident light, and extract the reflectivity at 460nm.Measure the small aperture by 2 layers (2 pieces in the same type of small piece of cloth sample from the same beaker), and measure 1 time on each small piece of cloth sample on the front side marked with beaker number and small piece of cloth sample number.Calculate the enzyme effect for each stain by obtaining the measured value from the small piece of cloth sample washed with enzyme and subtracting the measured value from the small piece of cloth sample not washed with enzyme.Total enzyme performance is calculated as the mean value of single ΔRem.

[0158] Example 3: Method for assessing whiteness by TOM determination

[0159] Whiteness is expressed as Δ reflectivity value (ΔRem).After washing and rinsing, the small piece of cloth sample is spread and laid flat and allowed to air-dry overnight at room temperature.The light reflection evaluation of the small piece of cloth sample is carried out using the Datacolor 800V reflection spectrophotometer with large aperture.Measure under the condition of UV-free in the incident light, and extract the reflectivity at 460nm.Measure the small aperture by 2 layers (2 pieces in the same type of small piece of cloth sample from the same beaker), measure 1 time on each small piece of cloth sample on the front side marked with beaker number and small piece of cloth sample number.Calculate the enzyme effect for each stain by obtaining the measured value from the small piece of cloth sample washed with enzyme and subtracting the measured value from the small piece of cloth sample not washed with enzyme.Total enzyme performance is calculated as the mean value of single ΔRem.

[0160]

[0161]

[0162] Table 5: Terg-o-tometer whiteness conditions: SBL2004 is the dirt ballast on the swatches, while carbon black is the liquid product added as dirt. Two pieces of 5*5 cm SBL2004 and 0.15 g / L carbon black were used in this study.

[0163] Example 4: Results of evaluating wash performance (WP)

[0164] Washing performance was evaluated using the TOM assay (Example 1) as described in Example 2. The following three detergents were evaluated for WP:

[0165] Plant-based green detergent (PBG)

[0166] Plant-based green detergent (PBG) and add 3% Pure 300L(MP300L)

[0167] Commercial benchmark detergent (Ovitra non-bio, enzyme-free)

[0168] The WP evaluation results for different stains are provided below:

[0169]

[0170]

[0171] Table 6: Delta reflectivity values ​​at 460 nm for WP

[0172] The results clearly show that the plant-based green detergent formulation (PBG), in which surfactants were partially replaced by enzymes, improved the washing performance compared to the commercial benchmark detergent (higher values ​​indicate better washing performance).

[0173] Example 5: Results of whiteness evaluation

[0174] Whiteness was evaluated using the TOM assay (Example 3) as described in Example 3. The following three detergents were evaluated for whiteness effect:

[0175] Plant-based green detergent (PBG)

[0176] Plant-based green detergent (PBG) and addition of 0.2 ppm of cellulase having SEQ ID NO: 1

[0177] Commercial benchmark detergent (Ovitra non-bio, enzyme-free)

[0178] 1.5% for each condition Pure 300L (MP300L) as background enzyme

[0179] The whiteness evaluation results for the different stains are provided below:

[0180]

[0181] Table 7: Delta reflectance values ​​at 460 nm for whiteness

[0182] The results clearly show that the plant-based green detergent formulation (PBG) wherein the surfactant was partially replaced by the cellulase having SEQ ID NO: 1 improved whiteness (higher values ​​indicate better performance) compared to the commercial benchmark detergent.

[0183] Example 6: Full Scale Wash (FSW) Assay

[0184] Washing performance in a laundry setting is ultimately tested in a programmable electronic domestic washing machine, and a Miele machine (e.g., Miele 1935WPSWTL, fuzzy logic disabled) is often used as a reference machine due to its consistent performance and consistent quality of results. Standard wash conditions as listed in the table were used for the tests. Washed and rinsed swatches were dried overnight in a drying oven and measured as shown in Table 8 below.

[0185] Detergent dosage 50g / wash program Cotton, short, water-filled Fabric load Up to 4kg (CO:PE=65:35) pH Unregulated Main washing time 51 minutes temperature Adjust to 20℃, 30℃ or 40℃ Water hardness 14°dH <![CDATA[Ca 2+ Mg 2+ :CO 3 2- Ratio]]> 4:1:7.5 dirt W-SBL2004

[0186] Table 8: Conditions of FSW test of WP

[0187]

[0188] Table 9: Conditions of FSW test for whiteness

[0189] Example 7: Full Scale Washing (FSW) for Whiteness Assessment

[0190] Whiteness was assessed using a full scale wash assay (Example 6, Table 9).

[0191] The whiteness performance of the following detergents was evaluated:

[0192] Add 0.2 ppm cellulase with SEQ ID NO: 1 and 0.5 ppm phosphodiesterase with SEQ ID NO: 2 and 3% Medley Pure 300L Plant Based Green Detergent (PBG)

[0193] Ecover Washmittel, purchased in Germany in July 2022

[0194] Persil Kraft Gel, purchased in Germany in July 2022

[0195] Skip Active Clean, purchased in France in July 2022

[0196] All detergent / textile combinations were washed at 20° C. and 40° C. The results of the whiteness evaluation of the different textiles are provided below (Table 10a and Table 10b).

[0197]

[0198] Table 10a: Performance comparison of plant-based green detergents and commercial detergents

[0199]

[0200] Table 10b: Performance comparison of plant-based green detergents and commercial detergents

[0201] The results clearly show that the plant-based green detergent formulation (PBG) (wherein the surfactant was partially replaced by a cellulase having SEQ ID NO: 1 and a phosphodiesterase having SEQ ID NO: 2) improved whiteness at both 20°C and 40°C (higher values ​​indicate better performance) compared to the commercial benchmark detergent.

[0202] Example 8: Full Scale Washing (FSW) for Evaluation of WP

[0203] A full-scale wash assay (Example 6, Table 8) was used to evaluate WP.

[0204] The following detergents were evaluated for their WP effects:

[0205] Add 0.2 ppm cellulase with SEQ ID NO: 1 and 0.5 ppm phosphodiesterase with SEQ ID NO: 2 and 3% Medley Pure 300L Plant Based Green Detergent (PBG)

[0206] Ecover Washmittel, purchased in Germany in July 2022

[0207] Persil Kraft Gel, purchased in Germany in July 2022

[0208] Skip Active Clean, purchased in France in July 2022

[0209] All detergent / textile combinations were washed at 20° C. and 40° C. The results of the WP evaluation of different textiles are provided below (Table 11a and Table 11b).

[0210] The results clearly show that the plant-based green detergent formulation (PBG) (wherein the surfactant was partially replaced by a cellulase having SEQ ID NO: 1 and a phosphodiesterase having SEQ ID NO: 2) improved the washing performance at both 20°C and 40°C compared to the commercial benchmark detergent (higher values ​​indicate better performance).

[0211]

[0212]

[0213] Table 11a: Delta reflectance values ​​at 460 nm for FSW at 20°C

[0214]

[0215]

[0216] Table 11b: Delta reflectance values ​​at 460 nm for FSW at 40°C

Claims

1. A liquid laundry detergent composition comprising a. 7%-9%, preferably 8% AES b. 3%-5%, preferably 4% APG c. 3%-5%, preferably 4% detergent d. 1%-3%, preferably 2% soap e. 3%-5%, preferably 4% polyol At least AES and APG are plant-based surfactants.

2. The liquid laundry detergent composition of claim 1 further comprising less than 0.7% preservative and less than 0.7% viscosity modifier.

3. A liquid laundry detergent composition according to any one of claims 1 or 2, wherein a. AES is SLES, preferably SLES, 2EO b.APG is APG, C8-C 14 Glucoside c. The builder is sodium citrate d. Soap is obtained from coconut fatty acids e. The polyol is glycerol.

4. A liquid laundry detergent composition according to any one of claims 2 or 3, wherein the preservative is 0.5% phenoxyethanol and the viscosity modifier is 0.5% sodium chloride.

5. A liquid laundry detergent composition according to any one of claims 1 to 4 comprising a.8% SLES, 2EO b.4% C8-C 14 Glucoside c.4% sodium citrate d. 2% soap obtained from coconut fatty acids e.4% glycerol.

6. A liquid laundry detergent composition according to any one of the preceding claims, further comprising one or more enzymes selected from the group consisting of amylases, proteases, peroxidases, cellulases, beta-glucanases, xyloglucanases, hemicellulases, xanthanases, xanthan lyases, lipases, acyltransferases, phospholipases, esterases, laccases, catalases, arylesterases, amylases, alpha-amylases, glucoamylases, cutinases, pectinases, pectinase, lyases, keratinase ... Proteases, reductases, oxidases, phenoloxidases, lipoxygenases, ligninases, carrageenase, pullulanases, tannases, arabinosidases, hyaluronidases, chondroitinases, xyloglucanases, xylanases, pectin acetylesterases, polygalacturons, rhamnogalacturons, other endo-β-mannanases, exo-β-mannanases, pectin methylesterases, cellobiohydrolases, transglutaminases, lichenases, laminarinase, DNases, or any combination thereof.

7. A liquid laundry detergent composition according to any one of the preceding claims, wherein the AES and APG are derived from palm kernel oil or coconut oil and glucose and vegetable oil.

8. A liquid laundry detergent composition according to any one of the preceding claims wherein the pH of the formulation when dissolved in demineralised water at 25°C at 3.3 g / l is from pH 4 to 10, preferably from 6 to 9, more preferably from 8 to 9.

9. A method for treating textiles at home, comprising the following steps a. Treating textiles with an aqueous solution of 0.15 to 20 g / L, more preferably 1 to 10 g / L of a detergent composition according to any one of claims 1 to 8 b. Optionally rinsing and drying the textile.

Images