Yeast and its application in linseed oil fermentation and linseed hydroponic oil product

Abstract

The present invention belongs to the field of fermentation engineering, and specifically relates to a yeast and its application in linseed oil fermentation and a linseed hydroponic oil product. The genetically recombinant yeast expresses phenylalanine deaminase, tyrosine deaminase, cinnamic acid hydroxylase, 4-coumaric acid CoA ligase, chalcone synthase, chalcone isomerase, flavonoid 3-hydroxylase and stilbene synthase. The linseed hydroponic oil obtained by fermenting genetically recombinant yeast and linseed oil in the present invention has enhanced stability and is not prone to mutation; and the linseed hydroponic oil has a higher total flavonoid content, better antioxidant activity and tyrosinase inhibition activity than linseed oil.

Description

Technical Field

[0001] The invention belongs to the field of fermentation engineering, and specifically relates to a yeast and an application thereof in linseed oil fermentation and a linseed hydroponic oil product. Background Art

[0002] Flaxseed oil is a vegetable oil extracted from the seeds of the flax plant (scientific name: Linum usitatissimum). It contains a large amount of unsaturated fatty acids, especially the ω-3 and ω-6 series, among which the content of α-linolenic acid is relatively high. When used in cosmetics, flaxseed oil can increase skin luster and elasticity, eliminate fine wrinkles, and reduce spots. Flaxseed oil can also be used for skin care in all seasons, maintain skin moisture, nourish the skin, eliminate and delay the appearance of wrinkles, and slow down the degree of skin aging. Flaxseed oil can also prevent ultraviolet damage to the skin.

[0003] Flaxseed oil also contains a certain amount of flavonoids, which may come from the plant components of flaxseed itself, or are produced during the processing and extraction of flaxseed oil. Total flavonoids have a strong antioxidant effect, which can neutralize free radicals and prevent cell oxidation. Total flavonoids can also help repair damaged skin, promote skin cell regeneration and blood circulation. When skin problems occur, total flavonoids can accelerate the regeneration and repair of damaged cells and promote the skin's self-healing ability. Total flavonoids also have the effect of calming and soothing the skin, which can help eliminate skin inflammation and sensitivity and make the skin more comfortable. Therefore, adding total flavonoids to skin care products can help the skin resist free radical damage and environmental damage, repair damaged skin, and protect skin health.

[0004] However, it is precisely because flaxseed oil is rich in unsaturated fatty acids, especially linoleic acid, that flaxseed oil has poor stability and may deteriorate during storage and use. Summary of the invention

[0005] In order to solve the above problems, the present invention provides a method for preparing flaxseed hydroponic oil. The flaxseed hydroponic oil obtained by the preparation method can significantly improve the stability of flaxseed oil, and at the same time, the flavonoids in the flaxseed hydroponic oil are increased, which is conducive to the flaxseed hydroponic oil to produce a stronger skin protection effect.

[0006] In one aspect, the present invention provides a genetically recombinant yeast, which expresses phenylalanine deaminase, tyrosine deaminase, cinnamate hydroxylase, 4-coumarate CoA ligase, chalcone synthase, chalcone isomerase, flavonoid 3-hydroxylase and stilbene synthase.

[0007] Specifically, the amino acid sequence of the phenylalanine deaminase is shown in SEQ ID No.1, the amino acid sequence of the tyrosine deaminase is shown in SEQ ID No.2, the amino acid sequence of the cinnamate hydroxylase is shown in SEQ ID No.3, the amino acid sequence of the 4-coumarate CoA ligase is shown in SEQ ID No.4, the amino acid sequence of the chalcone synthase is shown in SEQ ID No.5, the amino acid sequence of the chalcone isomerase is shown in SEQ ID No.6, the amino acid sequence of the flavonoid 3-hydroxylase is shown in SEQ ID No.7, and the amino acid sequence of the stilbene synthase is shown in SEQ ID No.8.

[0008] Specifically, the yeast includes but is not limited to: Saccharomyces cerevisiae, Pichia pastoris, Kluyveromyces, Candida or Schizosaccharomyces pombe.

[0009] Preferably, the yeast may be Saccharomyces cerevisiae.

[0010] In another aspect, the present invention provides the use of the genetically recombinant yeast in linseed oil fermentation.

[0011] Specifically, the steps include:

[0012] S1. Cultivating the aforementioned genetically recombinant yeast to obtain seed solution A;

[0013] S2, culturing Antarctic Saccharomyces cerevisiae to obtain seed solution B;

[0014] S3, inoculating the seed solution A and the seed solution B into a fermentation medium for pre-fermentation to obtain a fermentation solution 1;

[0015] S4, adding linseed oil to the fermentation liquid 1 to continue fermentation to obtain fermentation liquid 2;

[0016] S5, separating the fermentation liquid 2 from water and oil to obtain an oil phase;

[0017] S6. Dehydrate the oil phase to obtain high-quality flaxseed hydroponic oil.

[0018] More specifically, the fermentation conditions in step S4 are 25-42° C., 12-144 h; and the amount of linseed oil added is 10%-900% wt.

[0019] Preferably, the fermentation conditions in step S4 are 28-32° C., 24-48 h; and the amount of linseed oil added is 50%-200% wt.

[0020] Further preferably, the fermentation conditions in step S4 are 30-32° C., 40-48 h; and the amount of linseed oil added is 50%-100% wt.

[0021] More preferably, the fermentation conditions in step S4 are 30° C., 48 h; and the amount of linseed oil added is 100% wt.

[0022] More specifically, the separation method in step S5 includes but is not limited to: at least one of static separation, centrifugal separation or membrane separation.

[0023] Preferably, the separation method in step S5 may be centrifugal separation.

[0024] More specifically, the dehydration method in step S6 includes but is not limited to: at least one of vacuum dehydration, anhydrous sodium sulfate dehydration or anhydrous calcium chloride dehydration.

[0025] Preferably, the dehydration method in step S6 may be anhydrous sodium sulfate dehydration.

[0026] In another aspect, the present invention provides a flaxseed hydroponic oil, wherein the flaxseed hydroponic oil is obtained by fermenting the aforementioned genetically recombinant yeast.

[0027] In yet another aspect, the present invention provides use of the aforementioned flaxseed hydroponic oil in preparing skin care products.

[0028] In yet another aspect, the present invention provides a skin care product, comprising the aforementioned flaxseed hydroponic oil.

[0029] Specifically, the skin care product further comprises cosmetically acceptable auxiliary materials.

[0030] More specifically, the auxiliary materials include, but are not limited to, at least one of an emollient, an emulsifier, a thickener, a humectant, a pH regulator, a skin protectant and a preservative.

[0031] Specifically, the cosmetics include but are not limited to: facial milk, facial cream or lipstick.

[0032] The technical effects achieved by the present invention are:

[0033] (1) Compared with flaxseed oil, flaxseed oil has enhanced stability and is less likely to change.

[0034] (2) The content of flavonoids in flaxseed hydroponic oil is significantly higher than that in flaxseed oil, which makes the fermented oil have better antioxidant activity and inhibits tyrosinase activity. BRIEF DESCRIPTION OF THE DRAWINGS

[0035] Figure 1The following is a schematic diagram of the arrangement of genes in the yeast genome; PAL: phenylalanine deaminase; TAL: tyrosine deaminase; C4H: 4-cinnamate hydroxylase; 4CL: 4-coumarate CoA ligase; CHS: chalcone synthase; CHI: chalcone isomerase; F3H: flavonoid 3-hydroxylase; STS: stilbene synthase. Pgk1, PTEF1, PTDH3, PITR1, PTDH1, PINO1, PSED1, PTDH2 are gk1, TEF1, TDH3, ITR1, TDH1, INO1, SED1, TDH2 promoters respectively; TCYC1 is the CYC1 terminator.

[0036] Figure 2 To determine the total flavonoids content of linseed hydroponic oil.

[0037] Figure 3 Determination of antioxidant capacity of flaxseed hydroponic oil.

[0038] Figure 4 To test the stability of flaxseed hydroponic oil - total flavonoids content.

[0039] Figure 5 To test the stability of flaxseed hydroponic oil - DPPH free radical scavenging rate.

[0040] Figure 6 Test for tyrosinase inhibition rate of flaxseed hydroponic oil.

[0041] Figure 7 Determination of fatty acid content of linseed hydroponic oil. DETAILED DESCRIPTION

[0042] The present invention will be further described in detail below in conjunction with specific examples. The following examples are not intended to limit the present invention, but are only intended to illustrate the present invention. The experimental methods used in the following examples are generally conventional, unless otherwise specified, and the materials, reagents, etc. used in the following examples are commercially available, unless otherwise specified.

[0043] Example 1 Construction of recombinant yeast

[0044] Phenylalanine deaminase, tyrosine deaminase, cinnamate hydroxylase, 4-coumarate CoA ligase, chalcone synthase, chalcone isomerase, flavonoid 3-hydroxylase and stilbene synthase were codon optimized and gene synthesized by Shanghai Biotech. The amino acid sequence of the phenylalanine deaminase is shown in SEQ ID No.1, the amino acid sequence of the tyrosine deaminase is shown in SEQ ID No.2, the amino acid sequence of the cinnamate hydroxylase is shown in SEQ ID No.3, the amino acid sequence of the 4-coumarate CoA ligase is shown in SEQ ID No.4, the amino acid sequence of the chalcone synthase is shown in SEQ ID No.5, the amino acid sequence of the chalcone isomerase is shown in SEQ ID No.6, the amino acid sequence of the flavonoid 3-hydroxylase is shown in SEQ ID No.7, and the amino acid sequence of the stilbene synthase is shown in SEQ ID No.8.

[0045] SEQ ID No.1:

[0046] ;

[0047] SEQ ID No.2:

[0048] MNTINEYLSLEEFEAIIFGNQKVTISDVVVNRVNESFNFLKEFSGNKVIYGVNTGFGPMAQYRIKESDQIQLQYNLIRSHSSGTGKPLSPVCAKAAILARLNTLSLGNSGVHPSVINLMSELINKDITPLIFEHGGVGASGDLVQLSHLALVLIGEGEVFYKGERRPTPEVFEIEGLKPIQVEIREGLALINGTSVMTGIGVVNVYHAKKLLDWSLKSSCAINELVQAYDDHFSAELNQTKRHKGQQEIALKMRQNLSDSTLIRKREDHLYSGENTEEIFKEKVQEYYSLRCVPQILGPVLETINNVASILEDEFNSANDNPIIDVKNQHVYHGGNFHGDYISLEMDKLKIVITKLTMLAERQLNYLLNSKINELLPPFVNLGTLGFNFGMQGVQFTATSTTAESQMLSNPMYVHSIPNNNDNQDIVSMGTNSAVITSKVIENAFEVLAIEMITIVQAIDYLGQKDKISSVSKKWYDEIRNIIPTFKEDQVMYPFVQKVKDHLINN;

[0049] SEQ ID No.3:

[0050] MDLLLLEKSLIAVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLLTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQNREGWEFEAASVVEDVKKNPDSATKGIVLRKRLQLMMYNNMFRIMFDRRFESEDDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICQDVKDRRIALFKKYFVDERKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVMKPRNC;

[0051] SEQ ID No.4:

[0052] MASSGDHIFRSKLPDILIPNNLSLPQYCFEHIAQFADKPCLVQTNGKSYTFAEVELYSRRIAAGFSMLGIQKGDVVMLLLPNCIEFVLLFLGLALRGAAATTCNPFYTAQEIAKQVNGSKAKLIITQSSFTNKAAEVSNVTHHSFKVMTTDEVLPRHLSMSALMEADEGRCPHEDINPDDVVALPYSSGTTGLPKGVMLTHRSLITSIAQQVDGDNPNIYMTPEDVVLCVLPMFHIYSLNTVLLCSLRVGASIVVMTKFEIAALLDVIQRFKVTIAPLVPPIVLALAKNPIVEKYDLSSIRMLMSGAAPLSKDLEACFQAHAPHAVIGQGYGMTEAGPVLAMCLGFAKHPFPVKGGACGTVVRNAEVKIIDPDTGASLGHNEPGEICIRGAQIMKGYVGDPEATVNTIDKEGFLHTGDIGFIDDDEEIFIVDRVKEIIKFKGFQVPPAELEAILLSHSDITDAACVPKKDEVAGEVPVAFIVRAHNADISAASIKEFVAKQVVFYKKLHEIFFVDTIPKSPSGKILRKELKLRLEQMV;

[0053] SEQ ID No.5:

[0054] MASATIPAPAPRKMERAEGPASVLAIGTAVPPNVVYQKDYPDFYFGVTNSNHKTELKDKFQRMCDKSCVSKRHLYLTEEILKANPSLCAYWEPSLDLRQDIVV WEBPKLGKQAASAAIKEWGQPKSKITHLIFCTTSGVDMPGADWALAKLLGLRSSVKRLVLYMQGCYGGGTVLRIAKDLAENNKGARVLVVCSEITAITFRGPS DTHLDSLVGQALFGDGASALIVGSDPVPAVERAWFELHWTGSDILPNSDGAIDGHLKEVGLTFHLMKDVPAIISKNIGGILKDALAKVFPAAHDQLDSSGTTA AAPPPPTYNDLFWITHPGGPAILDQVEDRLGLRKDKLASTRAVLDQFGNMSSATVLFIMDEMERKRSVEQLGTTGEGHEWGLLLLGFGPGLTCETVVLRSVPLV;

[0055] SEQ ID No.6:

[0056] MAASITAITVENLEYPAVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYLEDIAVASLAAKWKGKSSEELLETLDFYRDIISGPFEKLIRGSKIRELSGPEYSRKVM ENCVAHLKSVGTYGDAEAEAMQKFAEAFKPVNFPPGASVFYRPNGILGLSFSPDTSIPEKEAALIENKAVSSAVLETMIGEHAVSPDLKRCLAARLPALLNEGAFKIGN;

[0057] SEQ ID No.7:

[0058] MAPTTTLTALAEEKSLQQKFVRDEDERPKVAYNVFSNEIPVISLAGIDEIEGRRSEICRKIVEACEGWGVFQVVDHGVDANLIAEMTRLAREFFALPPEEKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIRARDYSRWPDKPEGWRAVTETYSEKLMDLACKLLEVLSEAMGLEK EALTKACVDMDQKVVINFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPEATVYPLKIREGEKPILEEPITFADMYKRKMSKDIELAKLKKLAKEKKLLQDQQDIEKAKLEIKSTDEIFA;

[0059] SEQ ID No.8:

[0060] MYLTEEILKENPNICAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGRPMSEITHLIFCTTSGVALPGVDYELIVLLGLDPSVKRYMMYHQGCFAGGTVLRLAKDLAENNKDARVLIVCSENTSITFRGPSETDMDSLVGQALFADGAAAIIIGSDPV PEVEKPLFEIVSTDQKLVPGSHGAIGGLLREVGLTFYLNKSVPDIISQNINDALSKAFDPLGISDYNSIFWIAHPGRAILDQVEQKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLMRKKSLEEGLKTTGEGLDWGVLLGFGPGLTIETVVLRSVAI.

[0061] In order to integrate the above genes into the Saccharomyces cerevisiae genome, rDNA was selected as the multi-copy integration site. The target gene was inserted between the intact non-transcribed spacer regions NTS1 and NTS2. The arrangement of the genes finally integrated into the genome Figure 1 As shown. The CRISPR-Cas9 gene editing method was used to integrate these genes into the yeast genome. The specific steps are:

[0062] (1) First, the Cas9 expression cassette was integrated into yeast, and the Cas9 protein was expressed through the constitutive promoter TEF1;

[0063] (2) Construction of fragments for homologous recombination: Since the fragment is too long and difficult to construct in one go, the above fragment is divided into three segments, and the adjacent fragments contain about 1000 bp homologous arms for homologous recombination and insertion into the genome. Fragment I: NTS2-Pgk1-PAL-PTEF1-TAL-PTDH3; Fragment II: PTDH3-C4H-PITR1-4CL-PTDH1-CHS-PINO1; Fragment III: CHS-PINO1-CHI-PSED1-F3H-PTDH2-STS-TCYC1-NTS1. The construction of the three fragments was completed by OverlapPCR.

[0064] (3) Construction of gRNA plasmid for gene editing. The gRNA plasmid was constructed according to the method described in the literature (Mans R, van Rossum HM, Wijsman M, et al. CRISPR / Cas9: a molecular Swiss army knife for simultaneous introduction of multiple genetic modifications in Saccharomyces cerevisiae [J]. FEMS yeast research, 2015, 15 (2): fov004.), and the URA marker was selected as the screening marker.

[0065] (4) Yeast transformation: The three homologous recombination fragments constructed in step (2) and the gRNA plasmid constructed in step (3) were transferred into yeast competent cells, and positive clones were screened using SC-URA plates. SC-URA plate culture medium was purchased from Shanghai Weidi Biotechnology. The obtained positive clones were verified by colony PCR.

[0066] gRNA plasmid deletion: The correct cloned strain obtained in step (4) was cultured overnight in YPD liquid culture to lose the gRNA plasmid, and screened using SC+FOA plates to obtain recombinant yeast. The YPD liquid culture medium consists of 20 g / L peptone, 10 g / L yeast powder, and 20 g glucose. The SC+FOA plate culture medium consists of 6.7 g / L YNB, 0.77 g / L CSM culture medium, and 0.8 g / L FOA. YNB culture medium was purchased from Solebao Biotechnology, and CSM culture medium was purchased from Hepeng Biotechnology.

[0067] Example 2 Preparation method of linseed hydroponic oil

[0068] (1) Antarctic Saccharomyces cerevisiae and the recombinant yeast prepared in Example 1 were inoculated into yeast seed culture medium respectively, wherein the yeast seed culture medium contained 20 g / L peptone, 10 g / L yeast extract, and 20 g / L glucose, and cultured at 30° C. for 24 h.

[0069] (2) The prepared Antarctic pseudoyeast seed solution and recombinant yeast were transferred to the fermentation medium at an inoculation rate of 5%, respectively, and cultured at 30°C for 12 hours, and then linseed oil was added at 100% of the initial culture medium volume, and the culture was continued for 48 hours. The fermentation medium is: 20 g / L rice, 20 g / L soybean powder, and 10 g / L glucose.

[0070] (3) After fermentation, centrifuge at 10,000 rpm for 10 min and take the upper oil phase.

[0071] (4) adding anhydrous sodium sulfate and centrifuging at 10,000 r / min for 10 min to obtain finished flaxseed hydroponic oil.

[0072] Example 3 Determination of flavonoid content and antioxidant capacity of flaxseed hydroponic oil

[0073] The total flavonoids content of linseed oil and linseed hydroponic oil was determined respectively. The results are as follows Figure 2 As shown in the figure, it can be seen that the total flavonoids content of flaxseed hydroponic oil is 10.4 times that of flaxseed crude oil.

[0074] The antioxidant capacity of flaxseed oil and flaxseed hydroponic oil was determined by DPPH free radical scavenging test. Figure 3 As shown in the figure, the DPPH free radical scavenging rate of flaxseed hydroponic oil is 92.2%, while the DPPH free radical scavenging rate of flaxseed oil is 24.7%. The antioxidant capacity of flaxseed oil has been significantly improved.

[0075] Example 4 Flaxseed Hydroponic Oil Stability Test

[0076] The stability difference between flaxseed oil and flaxseed hydroponic oil was determined under accelerated light conditions. The determination indicators include sensory evaluation (color, odor, transparency), total flavonoid content determination, and DPPH free radical scavenging ability test. As shown in Table 1, flaxseed oil showed a phenomenon of husking after 24 days of exposure to light; while flaxseed hydroponic oil did not show a phenomenon of husking after 32 days of exposure to light. Figure 4 As shown in the figure, after 32 days of exposure to light, the total flavonoids content of flaxseed oil decreased by 14%, while the total flavonoids content of flaxseed hydroponic oil decreased by only 5%, indicating that the active substances in flaxseed hydroponic oil are more stable. Figure 5As shown in the figure, after 32 days of exposure to light, the DPPH free radical scavenging rate of flaxseed oil decreased by 51.6%, while the DPPH free radical scavenging rate of flaxseed hydroponic oil decreased by only 10.7%. These results all prove that the stability of flaxseed hydroponic oil is significantly improved compared with flaxseed oil.

[0077] Table 1 Flaxseed hydroponic oil stability test

[0078]

[0079] Example 5 Determination of tyrosinase inhibition rate of flaxseed hydroponic oil

[0080] Tyrosinase is a key enzyme in pigment biosynthesis. Inhibiting tyrosinase is a common method to reduce pigment spots. Therefore, tyrosinase inhibitors are widely used as whitening agents in cosmetics. The determination of tyrosinase inhibition rate is often used to reflect the whitening effect of substances. Figure 6 As shown, the tyrosinase inhibition rate of flaxseed oil is 17%, while that of flaxseed hydroponic oil is 68%. The tyrosinase inhibition effect of flaxseed hydroponic oil is 300% higher than that of flaxseed oil, indicating that the whitening effect of flaxseed hydroponic oil is far better than that of flaxseed oil.

[0081] Example 6 Test on the stability of linolenic acid in linseed hydroponic oil

[0082] The fatty acid composition of linseed hydroponic oil was determined by gas chromatography, and the changes in linolenic acid content were determined under light conditions. Figure 7 As shown, the linolenic acid content in flaxseed hydroponic oil is about 50%, and the unsaturated fatty acid content is 88%. It meets the requirements of flaxseed oil fatty acid composition in GB / T8235-2019bz flaxseed oil. Figure 7 It can also be seen that after being placed under light conditions for 32 days, the linolenic acid content and unsaturated fatty acid content in the flaxseed hydroponic oil did not change significantly, proving the excellent stability of the flaxseed hydroponic oil.

Claims

1. A genetically recombinant yeast, characterized in that: The genetically recombinant yeast expresses phenylalanine deaminase, tyrosine deaminase, cinnamic acid hydroxylase, 4-coumaric acid CoA ligase, chalcone synthase, chalcone isomerase, flavonoid 3-hydroxylase and stilbene synthase.

2. The genetically recombinant yeast according to claim 1, characterized in that: The amino acid sequence of the phenylalanine deaminase is shown in SEQ ID No.1, the amino acid sequence of the tyrosine deaminase is shown in SEQ ID No.2, the amino acid sequence of the cinnamate hydroxylase is shown in SEQ ID No.3, the amino acid sequence of the 4-coumarate CoA ligase is shown in SEQ ID No.4, the amino acid sequence of the chalcone synthase is shown in SEQ ID No.5, the amino acid sequence of the chalcone isomerase is shown in SEQ ID No.6, the amino acid sequence of the flavonoid 3-hydroxylase is shown in SEQ ID No.7, and the amino acid sequence of the stilbene synthase is shown in SEQ ID No.

8.

3. The genetically recombinant yeast according to claim 1 or 2, characterized in that: The yeast is Saccharomyces cerevisiae, Pichia pastoris, Kluyveromyces, Candida or Schizosaccharomyces pombe.

4. Use of the genetically recombinant yeast according to any one of claims 1 to 3 in linseed oil fermentation.

5. The use according to claim 4, characterized in that: The following steps are involved: S1. Cultivating the genetically recombinant yeast according to any one of claims 1 to 3 to obtain seed liquid A; S2, culturing Antarctic Saccharomyces cerevisiae to obtain seed solution B; S3, inoculating the seed solution A and the seed solution B into a fermentation medium for pre-fermentation to obtain a fermentation solution 1; S4, adding linseed oil to the fermentation liquid 1 to continue fermentation to obtain fermentation liquid 2; S5, separating the fermentation liquid 2 from water and oil to obtain an oil phase; S6. Dehydrating the oil phase to obtain flaxseed hydroponic oil.

6. The use according to claim 5, characterized in that: The fermentation conditions in step S4 are 25-42° C., 12-144 h; and the amount of linseed oil added is 10%-900% wt.

7. The use according to claim 6, characterized in that: The fermentation conditions in step S4 are 28-32° C., 24-48 h; and the amount of linseed oil added is 50%-200% wt.

8. The use according to claim 5, characterized in that: The separation method in step S5 is at least one of static separation, centrifugal separation or membrane separation.

9. The use according to claim 5, characterized in that: The dehydration method in step S6 is at least one of vacuum dehydration, anhydrous sodium sulfate dehydration or anhydrous calcium chloride dehydration.

10. A flaxseed hydroponic oil, characterized in that: The flaxseed hydroponic oil is obtained by fermenting the genetically recombinant yeast according to any one of claims 1 to 3.

11. Use of the flaxseed hydroponic oil according to claim 10 in preparing skin care products.

12. A skin care product, characterized in that: The skin care product comprises the flaxseed hydroponic oil according to claim 10.

13. The skin care product according to claim 12, characterized in that: The skin care product further comprises cosmetically acceptable auxiliary materials.

Images