A monoclonal antibody and its detection application

Abstract

The present invention discloses a monoclonal antibody and its detection application. The present invention also discloses antibody derivatives, nucleic acid sequences encoding the antibodies, and detection applications of the antibodies, particularly applications in ELISA and FACS assays. Also disclosed is a method for preparing the antibodies. The monoclonal antibodies of the present invention have broad application prospects and practical value.

Description

Technical Field

[0001] The present invention relates to the field of biomedicine technology, and in particular to a monoclonal antibody and its detection application. Background Art

[0002] Killer cell immunoglobulin-like receptor (KIR3DL2), a member of the killer cell immunoglobulin-like receptor (KIR) family, is primarily expressed on memory T cells and natural killer (NK) cells and is a key regulator of NK cell function. The interaction between KIR3DL2 and its ligand plays a significant role in the incidence, progression, and outcome of a variety of diseases, including pregnancy complications, viral infections, autoimmune diseases, and hematologic malignancies. Antibodies or antigen-binding fragments targeting KIR3DL2 have broad potential applications in diagnosis, therapy, and research.

[0003] Monoclonal antibodies play a vital role in medical diagnosis, treatment, and research. They are used to treat a variety of diseases, including cancer, autoimmune diseases, and infectious diseases. However, traditional methods for producing monoclonal antibodies are often costly and complex. Therefore, developing efficient nucleic acid molecules encoding monoclonal antibodies is of great importance. Currently, several technologies are used to produce monoclonal antibodies, and these antibodies have demonstrated their unique value in applications such as enzyme-linked immunosorbent assays (ELISAs) and flow cytometry (FACS).

[0004] Although existing monoclonal antibody technology has made significant progress in many areas, there is still a need for new monoclonal antibodies with improved specificity and expanded applications. Currently, the development of highly specific monoclonal antibodies against the KIR3DL2 protein remains a challenge. In addition, there is a need for further research and development of derivatives of these antibodies, nucleic acid molecules encoding their amino acid sequences, and their application in experimental techniques such as ELISA and FACS. Summary of the Invention

[0005] To overcome the deficiencies of the prior art, the present invention aims to provide a novel monoclonal antibody that has high specificity for the KIR3DL2 protein and is innovative in its amino acid sequence, derivatives, and applications.

[0006] In order to achieve the above object, the present invention provides the following technical solutions:

[0007] The first aspect of the present invention provides an anti-KIR3DL2 protein antibody or antigen-binding fragment, wherein the antibody or antigen-binding fragment comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises CDR1, CDR2, and CDR3 in the heavy chain variable region as shown in SEQ ID NO: 2; and the light chain variable region comprises CDR1, CDR2, and CDR3 in the light chain variable region as shown in SEQ ID NO: 6.

[0008] In the context of the present invention, the term "antibody" is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, humanized antibodies, chimeric antibodies, and multispecific antibodies (e.g., bivalent antibodies) formed from at least two intact antibodies, as long as they exhibit the desired biological activity. In the present invention, modified antibody sequences also fall within the scope of protection of the present invention. The term "modification" refers to any form of modification of an amino acid sequence, such as amino acid substitution, deletion, insertion, and / or addition. The term "substitution" refers to the replacement of one or more amino acids in the original amino acid sequence with a different amino acid. The term "deletion" refers to the removal of one or more amino acids from the original amino acid sequence. The term "insertion" or "addition" refers to a change in the amino acid sequence that results in the addition of one or more amino acids compared to the original amino acid sequence. In the present invention, modifications preferably occur in regions outside the variable region, such as the constant region or framework region of the antibody, and the modified antibody still retains the desired functional properties of the antibody or antigen-binding fragment thereof of the present invention, or has improved antigen binding properties.

[0009] Furthermore, the antibody includes a monoclonal antibody, a polyclonal antibody, a chimeric antibody, a humanized antibody or a murine antibody.

[0010] Furthermore, the antibody of the present invention is a monoclonal antibody.

[0011] The amino acid sequences of CDR1, CDR2 and CDR3 in the heavy chain variable region are shown as SFPMA, TIISSGGSSYYRDSVKG and GGSFAY, respectively; the amino acid sequences of CDR1, CDR2 and CDR3 in the light chain variable region are shown as KASQNINNYLN, NTNNLQM and FQHNNWPLT, respectively.

[0012] As used herein, the term "antigen-binding fragment" encompasses a portion of an intact antibody and generally refers to one or more fragments of an antibody that specifically bind to an antigen. The antigen-binding function of an antibody can be achieved by a full-length fragment of the antibody. These "antigen-binding fragments" can be antibody fragments in the form of Fab, Fv, ScFv, etc., which retain the ability to bind to the KIR3DL2 protein while having a smaller molecular size, facilitating tissue penetration or for specific therapeutic applications.

[0013] The "heavy chain variable region and light chain variable region" of the antibody respectively comprise amino acid sequences, which are capable of specifically binding to a specific epitope of the KIR3DL2 protein.

[0014] The second aspect of the present invention provides a nucleic acid molecule, which can encode the above-mentioned antibody or antigen-binding fragment thereof.

[0015] As used herein, the term "nucleic acid molecule" refers to any polymeric form of any length composed of ribonucleotides or deoxyribonucleotides. Typically, a nucleic acid molecule is a coding sequence, which may include, but is not limited to, prokaryotic sequences, cDNA from eukaryotic mRNA, genomic DNA sequences from eukaryotic (e.g., mammalian) DNA, and even recombinant DNA sequences. A transcription termination sequence will typically be located 3' to the coding sequence.

[0016] Furthermore, the nucleic acid molecule encoding the above-mentioned antibody includes a heavy chain variable region (VH) encoding sequence, a light chain variable region (VL) encoding sequence, a heavy chain constant region (CH) encoding sequence, and a light chain constant region (CL) encoding sequence.

[0017] The present invention provides one or more source species for preparing monoclonal antibodies, including but not limited to mice, rats, rabbits, hamsters, humans, non-human primates, goats, transgenic animals, in vitro cultured cell lines, etc.

[0018] Furthermore, the source of the monoclonal antibody prepared in the present invention is rat.

[0019] The third aspect of the present invention provides a vector comprising the aforementioned nucleic acid molecule.

[0020] In the present invention, a vector comprising the nucleic acid molecule of the present invention is provided. The term "vector" refers to an artificial construct that is capable of delivering and preferably expressing one or more target genes or sequences in a host cell. The vector of the present invention can be a plasmid vector, a viral vector, etc. In some embodiments, a vector refers to a linear or circular nucleic acid molecule that comprises a nucleic acid of the present invention that is operably linked to other segments that provide for autonomous replication in a recombinant host cell, or an expression cassette based on a nucleic acid molecule. "Operably linked" means that the nucleic acid sequence of interest is linked to a regulatory sequence (e.g., in an in vitro transcription / translation system or when the vector is introduced into a host cell) in a manner that allows expression of the nucleotide sequence.

[0021] Furthermore, the vector includes plasmid, phage, mammalian cell expression vector, baculovirus, yeast virus, plant expression vector and the like.

[0022] The vector of the present invention is a pcDNA series vector used for expressing proteins in mammalian cells.

[0023] Furthermore, the vector of the present invention is a pcDNA3.1 vector.

[0024] A fourth aspect of the present invention provides a recombinant cell, which comprises the aforementioned monoclonal antibody, the aforementioned nucleic acid molecule, and / or the aforementioned vector.

[0025] Furthermore, the cells include B lymphocytes, myeloma cells, lymphoma cells, hybridoma cells, CHO cells, HEK293 cells, insect cell lines, and the like.

[0026] The fifth aspect of the present invention provides an antibody derivative, which comprises a detectable label directly or indirectly coupled to the monoclonal antibody according to the first aspect of the present invention.

[0027] The detectable labels include enzyme labels, fluorescent labels, radioactive labels, chemiluminescent labels, magnetic labels and the like.

[0028] Furthermore, the detectable marker is an enzyme marker.

[0029] Furthermore, the enzyme marker is horseradish peroxidase.

[0030] A sixth aspect of the present invention provides a product for detecting KIR3DL2 protein, wherein the product comprises the aforementioned antibody or antigen-binding fragment thereof, the aforementioned nucleic acid molecule, the aforementioned vector, and / or the aforementioned recombinant cell.

[0031] Furthermore, the product was detected by ELISA and FACS methods.

[0032] The seventh aspect of the present invention provides a method for preparing the aforementioned antibody or antigen-binding fragment thereof, the method comprising culturing the recombinant cell described in the fourth aspect of the present invention.

[0033] Furthermore, the specific steps include: 1) using the aforementioned vector to transform into host cells; 2) culturing the host cells in step 1) under suitable conditions; 3) isolating and purifying the aforementioned monoclonal antibody from the culture medium of the host cells.

[0034] The eighth aspect of the present invention provides a method for detecting KIR3DL2 protein or its functional domain, comprising incubating the aforementioned antibody or antigenic fragment thereof with the KIR3DL2 protein or its functional domain.

[0035] Preferably, the functional domain of the KIR3DL2 protein is the extracellular domain where amino acids 22 to 337 of the KIR3DL2 protein are located.

[0036] Preferably, the KIR3DL2 protein is of murine origin.

[0037] Furthermore, the rat anti-mouse KIR3DL2 antibody is 12C5E6.

[0038] The ninth aspect of the present invention provides the use of the aforementioned monoclonal antibody or antigen-binding fragment thereof in preparing a product, wherein the use is in preparing a product for detecting KIR3DL2 protein.

[0039] Preferably, the KIR3DL2 protein is a free protein or a protein expressed on the cell membrane.

[0040] Preferably, the product is detected by ELISA and FACS methods.

[0041] Preferably, the functional domain of the KIR3DL2 protein is the extracellular domain where amino acids 22 to 337 of the KIR3DL2 protein are located.

[0042] Furthermore, the antibody can bind to the mKIR3DL2-His recombinant protein in a gradient-dependent manner.

[0043] Furthermore, the antibody can bind well to cells overexpressing mKIR3DL2 protein.

[0044] The term "CDR sequence" as used herein refers to the amino acid sequence within the complementarity determining region (CDR) of an antibody molecule. These sequences are part of the variable region of an antibody and play a crucial role in the binding of the antibody to the antigen. CDR sequences are key regions that enable an antibody to recognize and bind to a specific antigen. Within an antibody molecule, CDR sequences are divided into three regions: CDR1, CDR2, and CDR3. The term "CDR" may refer to CDRs determined by any method recognized in the art.

[0045] Advantages and beneficial effects of the present invention: The present invention provides a 12C5E6 antibody, which has good binding activity with cells overexpressing mKIR3DL2 protein and has broad application prospects. BRIEF DESCRIPTION OF THE DRAWINGS

[0046] Figure 1 This is a diagram of the Elisa assay detecting the binding activity of 12C5E6 antibody to the antigen.

[0047] Figure 2 This is a graph of cell apoptosis analyzed by flow cytometry (Ctrl represents untreated cells, Flag antibody serves as a positive control, the abscissa PE represents the fluorescence intensity of specific PE-labeled antibodies on the cells, and the ordinate SSC represents the internal granularity and complexity of the cells). DETAILED DESCRIPTION

[0048] The present invention will be further described below with reference to specific examples. It should be understood that the specific embodiments described herein are presented by way of example and are not intended to limit the present invention. The main features of the present invention may be applied to various embodiments without departing from the scope of the present invention.

[0049] Example Preparation and Physicochemical Property Testing of mKIR3DL2-His Recombinant Protein

[0050] 1. Experimental Materials

[0051] Reagents: HAT (Sigma, H0262); complete culture medium (Beijing Zhongke Maichen Technology Co., Ltd., CM10040); 96-well clear flat-bottom polystyrene microplates (Corning, CLS 9018); anti-mouse secondary antibody (Jackson ImmunoResearch, 115-035-003); HT (Sigma, H0137); human embryonic kidney HEK293T cells (System Biosciences); Chinese hamster ovary carcinoma CHO cells (ECACC, 85051005); Protein A affinity chromatography (Nanomicron Technology, NMab™ ProProtein A, 17010-150100); high-affinity 96-well plate (Corning, 3590); PBST (PBS, Xi'an Hitech Biotechnology, BF001; Tween-20, Sangon Biotechnology, A100777); BSA (Sangon Biotechnology, A500023-0100); TMB (Beijing Meikewande, 1001).

[0052] 2. Experimental Plan

[0053] 1. Antibody Preparation

[0054] (1) Preparation of mKIR3DL2-His recombinant protein: The mouse KIR3DL2 extracellular domain (amino acids 22-337) was constructed into the pCDNA3.1 vector and a His tag was added to the C-terminus. The constructed vector was transfected into HEK293 transient transfected cells. After cell sample treatment, affinity purification, and multi-step purification, the mKIR3DL2-His recombinant protein was obtained.

[0055] SEQ ID of mKIR3DL2-His recombinant protein NO:1:HVGSHDKPFLYAWPSYVVPLGQNVTLTCDSHRGSNIFKLYKEEGSPIPQLHETTFQKSQVFGPVTTEHAGTYRCFHPQYANVLSAHSEPLKIIISGIYLKPFLLILQSPLVNSGGNVTLECHSENMFDTYILISHRMGIIKNSVQVSAEHHESGSHVTYS IGPMTPDLVGTYTCYGANSYYPYEWSDPSDPIDIKITGVYKKPSLSVLMGPVLMMSGETMTLSCISDHQFDMFHMSREGVPQGQGMPGVQIHSGKFEAKFLLSSMIQKGNYRCYGSFRNSSHVWSSPSDPLYLPAKGNCPACTEEDPKIHNCKNLRHHHHHHHH.

[0056] (2) Preparation of mouse KIR3DL2 monoclonal antibody: ① Immunization: mKIR3DL2-His recombinant protein was emulsified with adjuvant and immunized into 6-8 week old female rats. 1 / 3 of the volume was injected into two points on the back and one point in the abdominal cavity, avoiding injection into the left spleen of the mouse. The first immunization dose was 100 μg, and the second to fourth immunization doses were 50 μg. Immunization was conducted every 14 days. The polyclonal antibody titer against the immunogen in the rat serum was detected by ELISA. The rat with the highest titer was immunized with 100 μg protein without adjuvant by intraperitoneal injection.

[0057] ②Cell fusion: Aseptically prepare a suspension of immune-qualified rat spleen cells, fuse it with mouse myeloma sp2 / 0 cells (ATCC) at a ratio of 5:1, then place it in a 96-well cell culture plate and screen with complete medium containing HAT. Change half the medium once a week, and clones will be visible in 2 weeks.

[0058] ③ Hybridoma supernatant screening: Hybridoma cell culture supernatants were screened using an enzyme-linked immunosorbent assay (ELISA) technique: 96-well transparent flat-bottom polystyrene microplates were coated with recombinant mKIR3DL2-His protein. After blocking, the hybridoma cell culture supernatant obtained in the previous step was added, followed by horseradish peroxidase (HRP)-conjugated anti-mouse secondary antibody. Clones whose supernatants reacted positively with mKIR3DL2-His protein but negatively with control His protein were selected, indicating that these hybridoma cells secreted rat anti-mouse KIR3DL2 antibodies. These cells were cultured in complete medium containing HT and subcloned.

[0059] ④ Subcloning: For each selected hybridoma cell line, count the cells and dilute them to 1 cell / 200 μL in complete culture medium containing HT. Plate the cells in a 96-well cell culture plate and incubate at 37°C. After single clones are formed, screen the hybridoma subclones whose supernatants react positively with the mKIR3DL2-His protein by ELISA.

[0060] 5. Flow cytometry to detect antibody binding to cell surface N1: Human embryonic kidney HEK293T cells expressing mKIR3DL2-Flag were used, and positive hybridoma lines were screened by FACS using a BD Accuri™ C6. Hybridoma supernatant samples were used to stain the cells, followed by secondary antibody binding using FITC-conjugated goat anti-rat IgG. Cell lines transfected with the corresponding empty vector plasmid served as negative controls. Flow cytometry analysis was performed using FlowJo software, and hybridoma lines positive by both FACS and ELISA were selected for cloning.

[0061] ⑥ Hybridoma Sequencing and Antibody Purification: The cDNA coding sequence of the antibody secreted by hybridoma cell lines that were positive in both FACS and ELISA was determined and translated into an amino acid sequence. The resulting hybridoma, clone number 12C5E6, was then purified. Reverse translation was performed using codons preferentially expressed in Chinese hamster ovary carcinoma (CHO) cells to determine the coding cDNA sequence for 12C5E6. After synthesis, the cDNA was inserted into the pcDNA3.1 vector and transfected into CHO cells via electroporation for expression. Following expression, the CHO cell culture supernatant was harvested and the antibody protein was isolated and purified using Protein A affinity chromatography. Purity and other quality control tests were performed and the protein was quantified.

[0062] 2. Antibody Binding Ability Analysis

[0063] (1) Elisa assay for 12C5E6 antibody binding capacity

[0064] ① Antigen coating: Add 1 μg / mL mouse KIR3DL2-His recombinant protein to a high-affinity 96-well plate. Add 100 μL to each of the 8 wells (16 wells) and seal the plate and incubate at 4°C overnight.

[0065] ②Wash away the antigen: Remove the antigen solution and wash the plate three times with 0.05% PBST buffer, 200 μL / well each time.

[0066] ③ Blocking: Aspirate or invert the plate to remove all the washing solution; block with PBS buffer containing 1% BSA, 300 μL per well, and incubate at room temperature for 1 hour after sealing; remove the blocking solution, wash the plate twice with 0.05% PBST buffer, 200 μL / well each time, and aspirate or invert the plate to remove all the washing solution.

[0067] ④ Incubation with primary antibody: Add the experimental group antibody 12C5E6 or the control group antibody Blank at 200 ng / mL in the first well of each group, and dilute in a 2-fold gradient to 7 wells in sequence. The last well is blank buffer, for a total of 8 wells, with 100 μL per well. Seal the plate and incubate at room temperature for 1 hour. Remove the antibody solution and wash the plate five times with 0.05% PBST buffer, 200 μL / well each time. Aspirate or invert the plate to remove all the washing solution.

[0068] ⑤ Incubate with secondary antibody: Add secondary antibody Goat Anti-Rat IgG-HRP at a dilution of 1:5000, 100 μL per well, seal the plate and incubate at room temperature for 1 hour; remove the secondary antibody solution and wash the plate 5 times with 0.05% PBST buffer, 200 μL / well each time, and remove all the washing solution by aspirating or inverting the plate.

[0069] ⑥ Color development: Add TMB substrate solution, 100 μL per well, and develop in the dark at room temperature; after reaching the desired intensity, add 1 M H2SO4 solution, 50 μL per well, to terminate the reaction; measure the absorbance at 450 nm using an enzyme-linked immunosorbent assay; plot a curve based on the correlation between the sample readings and the two sets of antibody concentrations.

[0070] (2) FACS detection of the ability of 12C5E6 antibody to bind to cells ① Human embryonic kidney HEK293T cells were transfected with mKIR3DL2-Flag plasmid, and the cells were digested into single cells 24 hours after transfection.

[0071] ② Dilute 12C5E6 antibody to a concentration of 5 μg / mL and use Flag antibody as a positive control. Incubate the antibodies at room temperature for 1 h.

[0072] ③ Dilute Goat anti-Rat IgG Alexa Fluor™ 546 secondary antibody at 1:500 and incubate at room temperature for 1 hour.

[0073] ④ The ability of the 12C5E6 antibody to bind to cells was verified by FACS using a BD Accuri™ C6. Flow cytometry was followed by analysis using FlowJo software.

[0074] 3. Experimental Results

[0075] The sequence of a monoclonal antibody 12C5E6 was screened.

[0076] The amino acid sequence encoding antibody 12C5E6 is shown below: the amino acid sequence encoding the heavy chain variable region, sequence number SEQ ID NO: 2: EVQLVESGGVLVQPGRSMKLSCTASGFSFSSFPMAWVRQAPTRGLEWVATIISSGGSSYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCATGGSFAYWGQGTLVTVSS.

[0077] Among them, the amino acid sequences encoding the heavy chain variable regions CDR1, CDR2, and CDR3 are SFPMA, TIISSGGSSYYRDSVKG, and GGSFAY, and the sequence numbers are SEQ ID NO: 3, 4, and 5, respectively.

[0078] The amino acid sequence encoding the light chain variable region is SEQ ID NO: 6: DIQMTQSPSLLSAYVGDGVTINCKASQNINNYLNWYQQKLGEAPKLLIYNTNNLQMVTPSRFSGSGSGTDYTLTISSLQPEDFGTYFCFQHNNWPLTFGSGTTLEIK.

[0079] Among them, the amino acid sequences encoding the light chain variable regions CDR1, CDR2, and CDR3 are KASQNINNYLN, NTNNLQM, and FQHNNWPLT, respectively, and the sequence numbers are SEQ ID NOs: 7, 8, and 9, respectively.

[0080] The binding ability of 12C5E6 antibody was detected by ELISA. Figure 1 As shown, the absorbance value of the antibody is greater than 2, which is much greater than that of the negative control group, indicating that the 12C5E6 antibody has a good affinity for the recombinant protein antigen and can bind to the mKIR3DL2-His recombinant protein in a gradient-dependent manner.

[0081] By FACS analysis, as Figure 2 As shown in Figure 3, we observed that the fluorescently labeled 12C5E6 antibody could bind well to cells overexpressing mKIR3DL2 protein.

[0082] The above embodiments are only provided for understanding the method and core concept of the present invention. It should be noted that, without departing from the principles of the present invention, a number of improvements and modifications may be made to the present invention by a person skilled in the art, and such improvements and modifications shall fall within the scope of protection of the claims of the present invention.

Claims

1. An anti-KIR3DL2 antibody or an antigen-binding fragment thereof, characterized in that: The antibody or antigen-binding fragment thereof comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises CDR1, CDR2, and CDR3 in the heavy chain variable region as shown in SEQ ID NO: 2; and the light chain variable region comprises CDR1, CDR2, and CDR3 in the light chain variable region as shown in SEQ ID NO:

6.

2. The antibody or antigen-binding fragment thereof according to claim 1, wherein The amino acid sequences of CDR1, CDR2 and CDR3 in the heavy chain variable region are shown as SFPMA, TIISSGGSSYYRDSVKG and GGSFAY, respectively; the amino acid sequences of CDR1, CDR2 and CDR3 in the light chain variable region are shown as KASQNINNYLN, NTNNLQM and FQHNNWPLT, respectively.

3. The antibody or antigen-binding fragment thereof according to claim 1, wherein The antibody is a monoclonal antibody.

4. The antibody or antigen-binding fragment thereof according to claim 1, wherein The antibody is a chimeric antibody.

5. The antibody or antigen-binding fragment thereof according to claim 1, wherein The antibody is a humanized antibody.

6. The antibody or antigen-binding fragment thereof according to claim 1, wherein The antibody is a mouse antibody.

7. A nucleic acid molecule, characterized in that The nucleic acid molecule encodes the antibody or antigen-binding fragment thereof according to any one of claims 1 to 6.

8. A carrier, characterized in that The vector comprises the nucleic acid molecule of claim 7.

9. A recombinant cell, characterized in that The recombinant cell comprises the antibody or antigen-binding fragment of any one of claims 1 to 6, the nucleic acid molecule of claim 7, and / or the vector of claim 8.

10. An antibody derivative, characterized in that The antibody derivative comprises the antibody or antigen-binding fragment according to any one of claims 1 to 6, and a detectable label directly or indirectly coupled to the antibody or antigen-binding fragment.

11. The antibody derivative according to claim 10, characterized in that The detectable labels include enzyme labels, fluorescent labels, radioactive labels, chemiluminescent labels, and magnetic labels.

12. The antibody derivative according to claim 11, characterized in that The enzyme marker is horseradish peroxidase.

13. A product for detecting KIR3DL2 protein or its functional domain, characterized in that: The product comprises the antibody or antigen-binding fragment thereof according to any one of claims 1 to 6, the nucleic acid molecule according to claim 7, the vector according to claim 8, and / or the recombinant cell according to claim 9; The functional domain of the KIR3DL2 protein is the extracellular domain where amino acids 22-337 of the KIR3DL2 protein are located.

14. The product according to claim 13, characterized in that The products were detected by ELISA or FACS methods.

15. A method for preparing the antibody or antigen-binding fragment thereof according to any one of claims 1 to 6, characterized in that: The method refers to culturing the recombinant cell according to claim 9.

16. A method for detecting KIR3DL2 protein or its functional domain for non-disease diagnosis or treatment purposes, characterized in that: Incubate the KIR3DL2 protein or its functional domain with the antibody or antigen fragment according to any one of claims 1 to 6; The functional domain of the KIR3DL2 protein is the extracellular domain where amino acids 22-337 of the KIR3DL2 protein are located.

17. Use of the antibody or antigen-binding fragment thereof according to any one of claims 1 to 6 in preparing a product, characterized in that: The application is the application in preparing a product for detecting KIR3DL2 protein or its functional domain; The functional domain of the KIR3DL2 protein is the extracellular domain where amino acids 22-337 of the KIR3DL2 protein are located.

18. The use according to claim 17, characterized in that The KIR3DL2 protein is a free protein or a protein expressed on the cell membrane.

19. The use according to claim 17, characterized in that The product was detected by ELISA and FACS methods.

Images