CHK36 homologous cluster fully human TSH receptor blocking monoclonal antibody group as well as preparation method and application thereof

Blocking TSH with receptor binding to receptors by blocking TSH by whole human TSH receptor blocking monoclonal antibodies solves the complex problems of existing treatment methods and major side effects, and realizes effective treatment of Graves' disease and thyroid eye disease, reducing hyperthyroidism and related symptoms.

CN120230209APending Publication Date: 2025-07-01SHANGHAI NINTH PEOPLES HOSPITAL SHANGHAI JIAO TONG UNIV SCHOOL OF MEDICINE

Patent Information

Application Number
CN202411552352.8
Authority / Receiving Office
CN · China
Patent Type
Applications(China)
Current Assignee / Owner
Priority Date
2024-08-14
Filing Date
2024-11-01
Publication Date
2025-07-01

AI Technical Summary

Technical Problem

The existing treatment methods for Graves' disease and thyroid-related eye diseases have problems such as long treatment courses, high recurrence rates, large side effects and lack of effective means, especially for hyperthyroidism and thyroid eye diseases. The existing drug treatment is poor and has serious side effects.

Method used

A set of all-human TSH receptor blocking monoclonal antibodies has been developed to block the binding of TSH to receptors by specifically identifying and binding to TSH receptors, inhibiting the synthesis and secretion of thyroid hormones, and reducing the symptoms of hyperthyroidism and related eye diseases.

Benefits of technology

Effectively block the signal transduction of TSH and receptors, inhibit the synthesis and secretion of thyroid hormones, significantly reduce the inflammation and proliferation of goiter and thyroid eye disease, and provide a safer and more effective treatment plan.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure BDA0005115416880000121
    Figure BDA0005115416880000121
  • Figure BDA0005115416880000131
    Figure BDA0005115416880000131
  • Figure HDA0005115416890000011
    Figure HDA0005115416890000011
Patent Text Reader

Abstract

The invention discloses a group of blocking monoclonal antibodies of a CHK36 homologous cluster fully human TSH receptor (TSHR) as well as a preparation method and application of the blocking monoclonal antibodies. The method comprises the following steps: sorting plasma cells and memory single B cells for specifically recognizing TSHR in peripheral blood of a patient with high TSH-blocking antibody (TBAb) titer by using flow cytometry, cloning antibody light and heavy chains in vitro and performing recombinant expression, and performing antibody property screening verification by using hTSHR-CHO cells, so as to obtain the TSHR-TBAb-TSHR-TBAb. The blocking monoclonal antibody specifically targeting the human TSHR is obtained. The fully human TSH receptor blocking monoclonal antibody disclosed by the invention can be specifically combined with TSHR, and can effectively block signal transduction after the TSH is combined with the receptor; the synthesis and secretion of thyroid hormone are inhibited; according to the present invention, with the application of the compound, the expression and the fibrosis of the effector cell orbit fibroblast TSHR inhibiting the thyroid-related eye disease can be significantly reduced, and the wide application prospect is provided in the treatment of Graves' disease (Graves' disease, GD) and diseases caused by hyperthyroidism, such as thyroid eye disease (thyroid eye disease, TED), and the like.
Need to check novelty before this filing date? Find Prior Art

Description

Technical Field

[0001] The present invention belongs to the fields of monoclonal antibody technology and human antibody drugs, and relates to a group of fully human TSH receptor-blocking monoclonal antibodies, a preparation method thereof, and an application thereof. Background Art

[0002] The thyroid-stimulating hormone receptor (TSHR) belongs to the seven-transmembrane G protein-coupled receptor and is mainly present on the cell membrane of thyroid follicular epithelial cells. TSHR has a large extracellular domain, which is composed of a leucine-rich domain and a "hinge" region. Abnormal function of TSHR may lead to the occurrence of thyroid diseases. After thyroid-stimulating hormone (TSH) binds to and activates TSHR, downstream signal transduction can be mediated by the Gs and Gq / 11 pathways, regulating the transport and absorption of iodine, iodination, etc., and participating in the synthesis and release of thyroid hormones, as well as the growth and differentiation of thyroid cells. On the other hand, the large extracellular segment of TSHR can be divided into an α-subunit and a β-subunit, and the α-subunit is easily shed. Against the background of genetic susceptibility, under the action of external environmental factors such as infection and mental trauma, the TSHR peptide segment can serve as an exposed autoantigen, inducing the production of autoantibodies in the body, namely thyrotropin receptor antibody (TRAb), which participates in the occurrence and development of autoimmune thyroid disease (AITD), mainly including Graves' disease (GD) and Hashimoto's thyroiditis.

[0003] Graves' disease is an organ-specific autoimmune disease caused by the combined action of genetics and environment, with increased secretion of thyroid hormones, and is the most common cause of hyperthyroidism. There are a large number of GD patients, and the incidence in the population is about 0.2-2%. Like other autoimmune diseases, GD is more common in women of childbearing age, and the female incidence is about 5-10 times that of men. In recent years, with the change of living environment, the incidence of hyperthyroidism has been on the rise. If the symptoms of hyperthyroidism are not controlled in time, it can affect the heart, leading to arrhythmia or heart failure, etc. In women of childbearing age, it can cause menstrual disorders, difficulty in getting pregnant, miscarriage, etc. In addition, hyperthyroidism can mostly cause mental abnormalities such as nervousness, anxiety, irritability, etc., affecting the patient's study and life, and in severe cases, it can even cause mental disorders. At present, the treatment of GD mainly includes drugs, radioactive iodine and surgical treatment. The former has a long course of treatment, which is difficult for patients to adhere to, and has a high recurrence rate. About 60-70% of patients will relapse. Clinically, the treatment of GD has not changed substantially for many years, and it is still a choice between antithyroid drugs, radioactive iodine or surgery. Among them, the treatment of Graves' disease with antithyroid drugs has a history of nearly 70 years. Except in the United States, doctors around the world regard ATD as the first choice for the treatment of Graves' disease. However, after regular and systematic treatment, only some patients with hyperthyroidism can be cured, and the side effects are relatively large. A considerable number of patients will relapse after a certain period of time. When relapsed, the condition worsens, and generally radioactive iodine or surgery is required for treatment, which greatly increases the economic and psychological burden on patients. In addition, the treatment with radioactive iodine 131 nuclide is likely to cause permanent hypothyroidism; the complications of surgical treatment cannot be ignored. The current treatment dilemma of GD means that there is an urgent need to find better alternative drugs clinically.

[0004] TRAb is a general term for antibodies produced by the body against TSHR. It is a group of polyclonal antibodies that can be divided into TSH receptor stimulating antibodies (TSH-stimulating antibody, TSAb), TSH receptor blocking antibodies (TSH-stimulating blocking antibody, TBAb) and neutral antibodies. Their recognition epitopes on TSHR are not the same. The recognition epitopes of TSAb, TBAb and neutral antibodies are concentrated in the amino terminus (N-terminus), carboxyl terminus (C-terminus) and hinge region of the TSHR membrane extracellular region, respectively. Among them, thyroid stimulating antibody TSAb binds to TSHR on the membrane of thyroid follicular epithelial cells, produces a biological effect similar to TSH, causes hyperthyroidism, and is the direct cause of Graves' disease. TSAb further activates adenylate cyclase (AC) to stimulate the production of cAMP through stimulatory G protein coupling. The AC-cAMP pathway is in a continuously active state, stimulating thyroid cell proliferation, and the thyroid gland synthesizes and secretes excessive thyroid hormones, namely triiodothyronine (T3) and thyroxine (T4). TSH is subject to competitive inhibition and cannot normally play a feedback regulatory role on T3 and T4, resulting in a continuous increase in T3 and T4, causing a series of reactions in the body, and then leading to hyperfunction of thyroid cells. From a histological perspective, the thyroid gland of GD patients shows thickened and hypertrophic follicular cells. The gland shows typical lymphocyte infiltration of T cells and B cells, with characteristics of thyroiditis, occasionally a small amount of cell apoptosis and a certain degree of follicular destruction. TBAb binds to TSH to block the binding of TSH to the receptor, inhibiting thyroid hyperplasia and thyroid hormone production. GD patients have both stimulating and blocking antibodies in their bodies, and the final outcome of their thyroid function depends on which antibody is dominant. This makes exogenous supplementation of a certain dose of blocking antibodies to bind to TSHR, thereby improving the pathophysiological effects of autoantibodies and becoming a new effective treatment for GD.

[0005] In addition, TSH receptor blocking monoclonal antibodies can inhibit the synthesis and secretion of thyroid hormones by blocking the signal transduction after TSH binds to the receptor, thereby treating a series of diseases caused by hyperthyroidism such as thyroid eye disease (TED), also known as thyroid-associated ophthalmopathy (TAO), neonatal hyperthyroidism, human chorionic gonadotropin-induced hyperthyroidism, overactive thyroid, thyroid cancer, thyroiditis, and pretibial myxedema.

[0006] Thyroid eye disease is a common orbital disease in adults. It is an autoimmune disease closely related to Graves' disease. It can manifest as congestion and edema of the eyelids and conjunctiva, fibrosis and fatification of the orbital tissue, causing eye movement disorders, strabismus and diplopia, which can cause blindness and disability. It is difficult to diagnose and treat, and seriously affects the quality of life of patients. my country is one of the countries with a high incidence of GD in the world. The prevalence of TED in Asian GD patients is as high as 45%. The TED patient population is large, and their visual health and quality of life are seriously affected. TED, as a problem that has plagued the global medical science community for two centuries, currently lacks effective treatment methods. Although there are currently a variety of treatment options for TED, many patients do not respond well to existing drugs or cannot tolerate side effects. Although high-dose glucocorticoid shock therapy is effective in reducing inflammation, it has no obvious effect on proptosis and diplopia, and long-term use has great side effects, such as hypertension, diabetes, osteoporosis, gastric ulcers, etc. Some patients are insensitive to glucocorticoids and the effective rate is only 50-75%. In addition, there is a short-term effect, but it is easy to relapse after stopping the drug. Immunosuppressants can reduce ocular inflammation by suppressing the overreaction of the immune system, but they can cause serious side effects, such as increased risk of infection, liver and kidney damage, etc. Therefore, the market is in urgent need of new, safe and effective drugs.

[0007] Orbital fibroblasts (OF) are effector cells of TED autoimmune reactions, with thyroid stimulating hormone receptors (TSHR) and insulin-like growth factor-1 receptors (IGF-1R) on their surfaces. TSHR is ectopically expressed in CD34+ fibroblasts in the retrobulbar tissue of TED patients. The immune response of TED fluid begins with abnormal recognition of the autoantigen thyroid stimulating hormone receptor (TSHR), followed by the production of TRAb by activated B cells. IGF-1R is another possible TED autoantigen, but it is not clear whether there are autoantibodies that directly stimulate IGF-1R. Studies have shown that the signal transduction pathways mediated by IGF-1R and TSHR bind to each other, leading to the secretion of a large amount of hyaluronic acid (HAS). Currently, the antibody drug (Tepezza) targeting IGF-1R was approved by the FDA for the treatment of TED in 2020. After treatment, bulging eyes and diplopia can be significantly improved, and nearly 40% of patients with bulging eyes can basically return to normal bulging eyes. Although IGF-1R antibody drugs have significant efficacy, many significant side effects have been reported after large-scale clinical application, especially irreversible deafness and effects on the reproductive system, due to the widespread expression of IGF-1R in human organs. Since both stimulating and blocking antibodies coexist in GD patients, the final outcome of their thyroid function depends on which antibody is dominant. This makes exogenous supplementation of a certain dose of blocking antibodies to inhibit TSHR a new and effective solution for the treatment of thyroid eye disease.

[0008] Humanized monoclonal antibodies can be divided into murine-humanized monoclonal antibodies and fully human monoclonal antibodies. Although murine-humanized monoclonal antibodies reduce the proportion of non-human components to a certain extent, they still cannot completely eliminate all non-human components, and the affinity and original biological activity of the antibody will also be reduced to a certain extent during the modification process. In contrast, fully human monoclonal antibodies directly amplify antibody genes from human single B cells. By amplifying the antibody genes of isolated single plasma cells or memory B cells, a large number of naturally paired antibody heavy and light chain genes can be obtained. Then, by expressing the paired antibody heavy and light chain genes, antibodies with antigen specificity and neutralizing activity can be finally screened. This method has the advantages of being fast, high-throughput, and requiring a small amount of cells. The fully human antibodies prepared by this method retain rich gene diversity and natural pairing of the heavy and light chain variable regions, showing great advantages. Currently, the preparation of fully human antibodies against influenza, anthrax virus, and pneumococcus is based on this technology. Summary of the Invention

[0009] In view of the above-mentioned prior art, the present invention provides a group of fully human TSH receptor (TSHR)-blocking monoclonal antibodies or their antigen-binding fragments for the treatment of hyperthyroidism, and also provides the coding sequences of these antibodies and vectors containing these coding sequences.

[0010] In the present invention, the term "TSHR" refers to the full-length human thyroid-stimulating hormone receptor having the amino acid sequence shown in SEQ ID NO: 25, or a variant or fragment highly homologous to the thyroid-stimulating hormone receptor. Preferably, such a variant and fragment have 70-99.9% homology with the amino acid sequence shown in SEQ ID NO: 25.

[0011] The present invention provides a group of fully human TSH receptor-blocking monoclonal antibodies or their antigen-binding fragments, which bind to the TSH receptor and block the binding of TSH to the TSH receptor; the fully human TSH receptor-blocking monoclonal antibodies or their antigen-binding fragments include a heavy chain variable region and a light chain variable region;

[0012] Among them, the heavy chain variable region contains H-CDR1, H-CDR2, and H-CDR3, and the amino acid sequences of H-CDR1, H-CDR2, and H-CDR3 are shown in SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28 respectively;

[0013] Among them, the light chain variable region contains L-CDR1, L-CDR2, and L-CDR3. The amino acid sequence of L-CDR1 is selected from one of SEQ ID NOs: 29 to 34; the amino acid sequence of L-CDR2 is selected from one of SEQ ID NOs: 35 to 38; the amino acid sequence of L-CDR3 is selected from one of SEQ ID NOs: 39 to 44.

[0014] Preferably, the amino acid sequences of H-CDR1, H-CDR2, and H-CDR3 in the heavy chain variable region are shown as SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28 respectively; the amino acid sequences of L-CDR1, L-CDR2, and L-CDR3 in the light chain variable region are shown as SEQ ID NO: 29, SEQ ID NO: 35, and SEQ ID NO: 39 respectively.

[0015] Preferably, the amino acid sequences of H-CDR1, H-CDR2, and H-CDR3 in the heavy chain variable region are shown as SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28 respectively; the amino acid sequences of L-CDR1, L-CDR2, and L-CDR3 in the light chain variable region are shown as SEQ ID NO: 30, SEQ ID NO: 35, and SEQ ID NO: 40 respectively.

[0016] Preferably, the amino acid sequences of H-CDR1, H-CDR2, and H-CDR3 in the heavy chain variable region are shown as SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28 respectively; the amino acid sequences of L-CDR1, L-CDR2, and L-CDR3 in the light chain variable region are shown as SEQ ID NO: 31, SEQ ID NO: 36, and SEQ ID NO: 41 respectively.

[0017] Preferably, the amino acid sequences of H-CDR1, H-CDR2, and H-CDR3 in the heavy chain variable region are shown as SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28 respectively; the amino acid sequences of L-CDR1, L-CDR2, and L-CDR3 in the light chain variable region are shown as SEQ ID NO: 32, SEQ ID NO: 37, and SEQ ID NO: 42 respectively.

[0018] Preferably, the amino acid sequences of H-CDR1, H-CDR2, and H-CDR3 of the heavy chain variable region are shown in SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28, respectively; the amino acid sequences of L-CDR1, L-CDR2, and L-CDR3 of the light chain variable region are shown in SEQ ID NO: 33, SEQ ID NO: 38, and SEQ ID NO: 43, respectively.

[0019] Preferably, the amino acid sequences of H-CDR1, H-CDR2, and H-CDR3 of the heavy chain variable region are shown in SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28, respectively; the amino acid sequences of L-CDR1, L-CDR2, and L-CDR3 of the light chain variable region are shown in SEQ ID NO: 34, SEQ ID NO: 35, and SEQ ID NO: 44, respectively.

[0020] Among them, the amino acid sequence of the heavy chain variable region is selected from one of SEQ ID NO: 1, 3, 5, 7, 9, 11 or has at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more sequence identity with one of SEQ ID NO: 1, 3, 5, 7, 9, 11;

[0021] Among them, the amino acid sequence of the light chain variable region is selected from one of SEQ ID NO: 2, 4, 6, 8, 10, 12 or has at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more sequence identity with one of SEQ ID NO: 2, 4, 6, 8, 10, 12.

[0022] The antigen-binding fragment is selected from Fab, Fab', F(ab')2, Fv, single-chain Fv (scFv), Fav, dsFv, sc(Fv)2, single-domain antibody (dAb).

[0023] In the present invention, the nucleotide sequences encoding the heavy chain variable region and the light chain variable region of the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment are shown in SEQ ID NO: 13 - SEQ ID NO: 24.

[0024] Preferably, the nucleotide sequences encoding the heavy chain variable region and the light chain variable region of the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment have at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more sequence identity with SEQ ID NOs: 13 - SEQ ID NO: 24.

[0025] SEQ ID NO: 1 (Amino acid sequence of CHK8_1)

[0026] Val His Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Phe Asp Phe Asn Gln Tyr Ser Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Ser Tyr Ile Ser Ser Ser Ala Ala Thr Val Phe Tyr Ala Asp Ser Val Gln Gly Arg Leu Thr Ile Ser Arg Asp Asn Gly Lys Asn Ser Leu Phe Leu Gln Met Asn Ser Leu Arg Val Glu Asp Thr Ala Val Tyr Tyr Cys Val Arg Glu Ala Val Ile Val Asp Gly Met Pro Phe Glu Tyr Trp Gly Gln Gly Ala Leu Val Thr Val Ser Ser

[0027] (VHSEVQLVESGGGLVQPGGSLRLSCVASGFDFNQYSMNWVRQAPGKGLEWLSYISSS AATVFYADSVQGRLTISRDNGKNSLFLQMNSLRVEDTAVYYCVREAVIVDGMPFEYWGQGA LVTVSS)

[0028] SEQ ID NO: 2 (Amino acid sequence of CHK8_2)

[0029] Val His Ser Glu Ile Val Met Thr Gln Ser Pro Ala Thr Leu Ser Val SerPro Gly Glu Ser Ala ThrLeu Ser Cys ArgAla Ser Gln Ser Val Lys Thr Lys Leu ValTrp Tyr Gln GlnArg Pro Gly GlnAla ProArg Val Leu Ile Tyr Gly Ala Ser ThrArgAlaAla Gly Val Pro GlyArg Phe Ser Gly Ser Gly Ser GlyThr Glu Phe Thr Leu ThrIle Ser Ser Leu Gln Ser Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr SerAsnTrp Pro Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

[0030] (VHSEIVMTQSPATLSVSPGESATLSCRASQSVKTKLVWYQQRPGQAPRVLIYGASTRA AGVPGRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYSNWPPYTFGQGTKVEIK)

[0031] SEQ ID NO: 13 (Nucleotide sequence of CHK8_3)

[0032] GTACATTCTGAGGTGCAGCTGGTGGAGTCCGGTGGAGGCTTGGTTCAACCGGGGGGGTCCCTGAGACTCTCCTGTGTAGCCTCTGGATTCGACTTCAACCAATATAGCATGAACTGGGTCCGCCAGGCTCCAGGGAAGGGACTGGAGTGGCTTTCATACATCAGTAGCAGCGCTGCAACCGTGTTCTACGCAGACTCTGTGCAGGGCCGACTCACCATCTCCAGAGACAATGGCAAGAATTCACTCTTTCTGCAGATGAACAGCCTGAGAGTCGAGGACACGGCTGTCTATTACTGTGTCAGAGAAGCTGTTATAGTGGATGGCATGCCGTTTGAATACTGGGGCCAGGGAGCCCTGGTCACCGTCTCCTCAGC

[0033] SEQ ID NO: 14 (CHK8_4 nucleotide sequence)

[0034] GTACATTCAGAAATAGTGATGACGCAGTCTCCAGCCACCCTGTCTGTGTCTCCAGGGGAGAGCGCCACCCTCTCCTGCAGGGCCAGTCAAAGTGTTAAGACCAAATTAGTCTGGTACCAACAGAGACCTGGACAGGCTCCCAGGGTCCTCATCTATGGTGCATCCACCAGGGCCGCTGGTGTCCCAGGCAGGTTCAGTGGCAGTGGGTCTGGGACAGAGTTCACTCTCACCATCAGCAGCCTGCAGTCTGAAGATTTTGCAGTTTATTACTGTCAGCAGTATAGTAACTGGCCTCCGTACACTTTTGGCCAGGGGACCAAGGTGGAAATCAAA

[0035] SEQ ID NO: 3 (CHK9_1 amino acid sequence)

[0036] Val His Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Phe Asp Phe Asn Gln Tyr Ser Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Ser Tyr Ile Ser Ser Ser Ala Ala Thr Val Phe Tyr Ala Asp Ser Val Gln Gly Arg Leu Thr Ile Ser Arg Asp Asn Gly Lys Asn Ser Leu Phe Leu Gln Met Asn Ser Leu Arg Val Glu Asp Thr Ala Val Tyr Tyr Cys Val Arg Glu Ala Val Ile Val Asp Gly Met Pro Phe Glu Tyr Trp Gly Gln Gly Ala Leu Val Thr Val Ser Ser

[0037] (VHSEVQLVESGGGLVQPGGSLRLSCVASGFDFNQYSMNWVRQAPGKGLEWLSYISS SAATVFYADSVQGRLTISRDNGKNSLFLQMNSLRVEDTAVYYCVREAVIVDGMPFEYWGQ GALVTVSS)

[0038] SEQ ID NO: 4 (Amino acid sequence of CHK9_2)

[0039] Val His Ser Glu Ile Val Met Thr Gln Ser Pro Ala Thr Leu Ser Val SerLeu Gly Glu Arg Val ThrLeu Ser Cys Arg Ala Ser Gln Ser Val Asn Ser Asn LeuAla Trp Tyr Gln Gln Lys Pro Gly Gln AlaPro Arg Leu Leu Ile Tyr Gly Ala SerThr Arg Ala Thr Gly Val Pro Val Arg Phe Ser Gly Ser Gly SerGly Thr Gly PheThr Leu Thr Ile Asn Ser Leu Gln Ser Glu Asp Phe Ala Arg Tyr Tyr Cys HisGlnTyr Asn Asn Trp Pro Glu Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

[0040] (VHSEIVMTQSPATLSVSLGERVTLSCRASQSVNSNLAWYQQKPGQAPRLLIYGASTR ATGVPVRFSGSGSGTGFTLTINSLQSEDFARYYCHQYNNWPETFGQGTKVEIK)

[0041] SEQ ID NO: 15 (Nucleotide sequence of CHK9_3)

[0042] GTACATTCTGAGGTGCAGCTGGTGGAGTCCGGTGGAGGCTTGGTTCAACCGGGGGGGTCCCTGAGACTCTCCTGTGTAGCCTCTGGATTCGACTTCAACCAATATAGCATGAACTGGGTCCGCCAGGCTCCAGGGAAGGGACTGGAGTGGCTTTCATACATCAGTAGCAGCGCTGCAACCGTGTTCTACGCAGACTCTGTGCAGGGCCGACTCACCATCTCCAGAGACAATGGCAAGAATTCACTCTTTCTGCAGATGAACAGCCTGAGAGTCGAGGACACGGCTGTCTATTACTGTGTCAGAGAAGCTGTTATAGTGGATGGCATGCCGTTTGAATACTGGGGCCAGGGAGCCCTGGTCACCGTCTCCTCAGC

[0043] SEQ ID NO: 16 (CHK9_4 nucleotide sequence)

[0044] GTACATTCAGAAATAGTGATGACGCAGTCTCCAGCCACCCTGTCTGTGTCTCTAGGGGAAAGAGTCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAACAGCAACTTGGCCTGGTATCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCACCAGGGCCACTGGTGTCCCAGTCAGATTCAGTGGCAGTGGGTCTGGGACAGGGTTCACTCTCACCATCAACAGCCTGCAGTCCGAAGATTTTGCACGTTATTACTGTCACCAGTATAATAACTGGCCTGAGACTTTTGGCCAGGGGACCAAGGTGGAAATCAAA

[0045] SEQ ID NO: 5 (CHK11_1 amino acid sequence)

[0046] Val His Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Phe Asp Phe Asn Gln Tyr Ser Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Ser Tyr Ile Ser Ser Ser Ala Ala Thr Val Phe Tyr Ala Asp Ser Val Gln Gly Arg Leu Thr Ile Ser Arg Asp Asn Gly Lys Asn Ser Leu Phe Leu Gln Met Asn Ser Leu Arg Val Glu Asp Thr Ala Val Tyr Tyr Cys Val Arg Glu Ala Val Ile Val Asp Gly Met Pro Phe Glu Tyr Trp Gly Gln Gly Ala Leu Val Thr Val Ser Ser

[0047] (VHSEVQLVESGGGLVQPGGSLRLSCVASGFDFNQYSMNWVRQAPGKGLEWLSYISS SAATVFYADSVQGRLTISRDNGKNSLFLQMNSLRVEDTAVYYCVREAVIVDGMPFEYWGQ GALVTVSS)

[0048] SEQ ID NO: 6 (Amino acid sequence of CHK11_2)

[0049] Val His Ser Glu Ile Val Met Thr Gln Ser Pro Ala Thr Leu Ser Val SerPro Gly Glu Arg Ala ThrLeu Ser Cys Arg Ala Ser Gln Thr Ile Gly Ser Asn LeuAla Trp Tyr Gln Gln Lys Pro Gly Gln Pro ProArg Leu Leu Ile Tyr Gly Ala SerThr Arg Ala Thr Gly Ile Pro Ala Arg Phe Ser Gly Ser Gly Ser GlyThr Glu PheThr Leu Thr Ile Ser Ser Leu Gln Ser Glu Asp Ser Ala Val Tyr Tyr Cys Gln GlnTyr SerAsn Trp Pro Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys

[0050] (VHSEIVMTQSPATLSVSPGERATLSCRASQTIGSNLAWYQQKPGQPPRLLIYGASTRA TGIPARFSGSGSGTEFTLTISSLQSEDSAVYYCQQYSNWPPLTFGGGTKVEIK)

[0051] SEQ ID NO: 17 (Nucleotide sequence of CHK11_3)

[0052] GTACATTCTGAGGTGCAGCTGGTGGAGTCCGGTGGAGGCTTGGTTCAACCGGGGGGGTCCCTGAGACTCTCCTGTGTAGCCTCTGGATTCGACTTCAACCAATATAGCATGAACTGGGTCCGCCAGGCTCCAGGGAAGGGACTGGAGTGGCTTTCATACATCAGTAGCAGCGCTGCAACCGTGTTCTACGCAGACTCTGTGCAGGGCCGACTCACCATCTCCAGAGACAATGGCAAGAATTCACTCTTTCTGCAGATGAACAGCCTGAGAGTCGAGGACACGGCTGTCTATTACTGTGTCAGAGAAGCTGTTATAGTGGATGGCATGCCGTTTGAATACTGGGGCCAGGGAGCCCTGGTCACCGTCTCCTCAGC

[0053] SEQ ID NO: 18 (CHK11_4 nucleotide sequence)

[0054] GTACATTCAGAAATAGTGATGACGCAGTCTCCAGCCACCCTGTCTGTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGACTATTGGTAGCAACTTGGCCTGGTACCAGCAGAAACCTGGACAGCCTCCCAGGCTCCTCATCTATGGTGCATCCACCAGGGCCACTGGTATTCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGAGTTCACTCTCACCATCAGCAGCCTGCAGTCTGAAGATTCTGCAGTTTATTACTGTCAGCAGTATAGTAACTGGCCTCCGCTCACTTTCGGCGGGGGGACCAAGGTGGAGATCAAA

[0055] SEQ ID NO: 7 (CHK14_1 amino acid sequence)

[0056] Val His Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Phe Asp Phe Asn Gln Tyr Ser Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Ser Tyr Ile Ser Ser Ser Ala Ala Thr Val Phe Tyr Ala Asp Ser Val Gln Gly Arg Leu Thr Ile Ser Arg Asp Asn Gly Lys Asn Ser Leu Phe Leu Gln Met Asn Ser Leu Arg Val Glu Asp Thr Ala Val Tyr Tyr Cys Val Arg Glu Ala Val Ile Val Asp Gly Met Pro Phe Glu Tyr Trp Gly Gln Gly Ala Leu Val Thr Val Ser Ser

[0057] (VHSEVQLVESGGGLVQPGGSLRLSCVASGFDFNQYSMNWVRQAPGKGLEWLSYISS SAATVFYADSVQGRLTISRDNGKNSLFLQMNSLRVEDTAVYYCVREAVIVDGMPFEYWGQ GALVTVSS)

[0058] SEQ ID NO: 8 (Amino acid sequence of CHK14_2)

[0059] Val His Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu SerPro Gly Glu Arg Ala ThrLeu Ser Cys Arg Ala Ser Gln Ser Val Thr Ser Gly GlnLeu Val Trp Tyr Gln Gln Lys Pro Gly GlnAla Pro Arg Leu Leu Ile Tyr Gly GluSer Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser Gly Ser GlySer Gly Thr AspPhe Ala Leu Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr CysGlnGln Tyr Gly Thr Ser Ile Ala Phe Gly Gly Gly Thr Lys Val Glu Ile Lys

[0060] (VHSEIVLTQSPGTLSLSPGERATLSCRASQSVTSGQLVWYQQKPGQAPRLLIYGESSR ATGIPDRFSGSGSGTDFALTISRLEPEDFAVYYCQQYGTSIAFGGGTKVEIK)

[0061] SEQ ID NO: 19 (Nucleotide sequence of CHK14_3)

[0062] GTACATTCTGAGGTGCAGCTGGTGGAGTCCGGTGGAGGCTTGGTTCAACCGGGGGGGTCCCTGAGACTCTCCTGTGTAGCCTCTGGATTCGACTTCAACCAATATAGCATGAACTGGGTCCGCCAGGCTCCAGGGAAGGGACTGGAGTGGCTTTCATACATCAGTAGCAGCGCTGCAACCGTGTTCTACGCAGACTCTGTGCAGGGCCGACTCACCATCTCCAGAGACAATGGCAAGAATTCACTCTTTCTGCAGATGAACAGCCTGAGAGTCGAGGACACGGCTGTCTATTACTGTGTCAGAGAAGCTGTTATAGTGGATGGCATGCCGTTTGAATACTGGGGCCAGGGAGCCCTGGTCACCGTCTCCTCAGC

[0063] SEQ ID NO: 20 (Nucleotide sequence of CHK14_4)

[0064] GTACATTCAGAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTACCAGCGGCCAGTTAGTCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGACTCCTCATCTATGGTGAATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCGCTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTATGGTACTTCAATCGCTTTCGGCGGAGGGACCAAGGTGGAGATCAAA

[0065] SEQ ID NO: 9 (Amino acid sequence of CHK20_1)

[0066] Val His Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Phe Asp Phe Asn Gln Tyr Ser Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Ser Tyr Ile Ser Ser Ser Ala Ala Thr Val Phe Tyr Ala Asp Ser Val Gln Gly Arg Leu Thr Ile Ser Arg Asp Asn Gly Lys Asn Ser Leu Phe Leu Gln Met Asn Ser Leu Arg Val Glu Asp Thr Ala Val Tyr Tyr Cys Val Arg Glu Ala Val Ile Val Asp Gly Met Pro Phe Glu Tyr Trp Gly Gln Gly Ala Leu Val Thr Val Ser Ser

[0067] (VHSEVQLVESGGGLVQPGGSLRLSCVASGFDFNQYSMNWVRQAPGKGLEWLSYISS SAATVFYADSVQGRLTISRDNGKNSLFLQMNSLRVEDTAVYYCVREAVIVDGMPFEYWGQ GALVTVSS)

[0068] SEQ ID NO: 10 (Amino acid sequence of CHK20_2)

[0069] Val His Ser Asp Ile Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val SerLeu Gly Glu Arg AlaSer Ile Asn Cys Lys Ser Ser Arg Thr Val Leu Tyr Ser SerAsp Asn Lys Asn Tyr Leu Thr Trp PheGln Gln Lys Pro Gly Gln Pro Pro Lys ValLeu Phe Phe Trp Ala Ser Thr Arg Ala Ser Gly Val ProAsp Arg Phe Ser Gly SerGly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Ala Glu AspVal AlaVal Tyr Tyr Cys Gln Gln Tyr Val Ser Val Pro Phe Thr Phe Gly Pro Gly Thr LysVal Asp IleLys

[0070] (VHSDIVMTQSPDSLAVSLGERASINCKSSRTVLYSSDNKNYLTWFQQKPGQPPKVLF FWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYVSVPFTFGPGTKVDIK)

[0071] SEQ ID NO: 21 (Nucleotide sequence of CHK20_3)

[0072] GTACATTCTGAGGTGCAGCTGGTGGAGTCCGGTGGAGGCTTGGTTCAACCGGGGGGGTCCCTGAGACTCTCCTGTGTAGCCTCTGGATTCGACTTCAACCAATATAGCATGAACTGGGTCCGCCAGGCTCCAGGGAAGGGACTGGAGTGGCTTTCATACATCAGTAGCAGCGCTGCAACCGTGTTCTACGCAGACTCTGTGCAGGGCCGACTCACCATCTCCAGAGACAATGGCAAGAATTCACTCTTTCTGCAGATGAACAGCCTGAGAGTCGAGGACACGGCTGTCTATTACTGTGTCAGAGAAGCTGTTATAGTGGATGGCATGCCGTTTGAATACTGGGGCCAGGGAGCCCTGGTCACCGTCTCCTCAGC

[0073] SEQ ID NO: 22 (CHK20_4 nucleotide sequence)

[0074] GTACATTCGGACATCGTGATGACCCAGTCTCCAGACTCCCTGGCTGTGTCTCTGGGCGAGAGGGCCTCCATCAACTGCAAGTCCAGCCGGACTGTTTTATACAGCTCCGACAATAAGAACTACTTAACTTGGTTCCAGCAAAAACCAGGACAGCCTCCTAAGGTGCTCTTTTTCTGGGCATCTACCCGGGCATCCGGGGTCCCTGACCGATTCAGTGGCAGCGGGTCTGGGACAGATTTCACTCTCACCATCAGTAGCCTGCAGGCTGAAGATGTGGCAGTTTATTACTGTCAGCAATATGTAAGTGTTCCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAA

[0075] SEQ ID NO: 11 (CHK36_1 amino acid sequence)

[0076] Val His Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Phe Asp Phe Asn Gln Tyr Ser Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Ser Tyr Ile Ser Ser Ser Ala Ala Thr Val Phe Tyr Ala Asp Ser Val Gln Gly Arg Leu Thr Ile Ser Arg Asp Asn Gly Lys Asn Ser Leu Phe Leu Gln Met Asn Ser Leu Arg Val Glu Asp Thr Ala Val Tyr Tyr Cys Val Arg Glu Ala Val Ile Val Asp Gly Met Pro Phe Glu Tyr Trp Gly Gln Gly Ala Leu Val Thr Val Ser Ser

[0077] (VHSEVQLVESGGGLVQPGGSLRLSCVASGFDFNQYSMNWVRQAPGKGLEWLSYISS SAATVFYADSVQGRLTISRDNGKNSLFLQMNSLRVEDTAVYYCVREAVIVDGMPFEYWGQ GALVTVSS)

[0078] SEQ ID NO: 12 (Amino acid sequence of CHK36_2)

[0079] Val His Ser Glu Ile Val Met Thr Gln Ser Pro Ala Thr Leu Ser Val SerPro Gly Glu Arg Ala ThrLeu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Asn IleAla Trp Tyr Gln Gln Lys Pro Gly Gln Ala ProArg Leu Leu Ile Tyr Gly Ala SerThr Arg Ala Thr Gly Ile Pro Ala Arg Phe Arg Gly Ser Gly Ser GlyThr Glu PheThr Leu Thr Ile Ser Ser Leu Gln Ser Glu Asp Phe Ala Val Tyr Tyr Cys Gln GlnTyrAsn Asn Trp Pro Pro Ile Thr Phe Gly Gln Gly Thr Arg Leu Glu Ile Lys

[0080] (VHSEIVMTQSPATLSVSPGERATLSCRASQSVSSNIAWYQQKPGQAPRLLIYGASTRA TGIPARFRGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPITFGQGTRLEIK)

[0081] SEQ ID NO: 23 (Nucleotide sequence of CHK36)

[0082] GTACATTCTGAGGTGCAGCTGGTGGAGTCCGGTGGAGGCTTGGTTCAACCGGGGGGGTCCCTGAGACTCTCCTGTGTAGCCTCTGGATTCGACTTCAACCAATATAGCATGAACTGGGTCCGCCAGGCTCCAGGGAAGGGACTGGAGTGGCTTTCATACATCAGTAGCAGCGCTGCAACCGTGTTCTACGCAGACTCTGTGCAGGGCCGACTCACCATCTCCAGAGACAATGGCAAGAATTCACTCTTTCTGCAGATGAACAGCCTGAGAGTCGAGGACACGGCTGTCTATTACTGTGTCAGAGAAGCTGTTATAGTGGATGGCATGCCGTTTGAATACTGGGGCCAGGGAGCCCTGGTCACCGTCTCCTCAGC

[0083] SEQ ID NO: 24 (CHK36_4 nucleotide sequence)

[0084] GTACATTCAGAAATAGTGATGACGCAGTCTCCAGCCACCCTGTCTGTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAACATAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCACCAGGGCCACTGGTATCCCAGCCAGGTTCAGAGGCAGTGGGTCTGGGACAGAGTTCACTCTCACCATCAGCAGCCTGCAGTCTGAAGATTTTGCAGTTTATTACTGTCAGCAGTATAATAACTGGCCTCCGATCACCTTCGGCCAAGGGACACGACTGGAGATTAAA

[0085] SEQ ID NO: 25 (human TSHR amino acid sequence)

[0086] MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTALPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLMCNESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQEDEIIGFGQELKNPQEETLQAFDSHYDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACAIMVGGWVCCFLLALLPLVGISSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCCYVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFICMAPISFYALSAILNKPLITVSNSKILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYRGQRVPPKNSTDIQVQKVTHEMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL

[0087] Table 1: CDR regions of the heavy chain (H) and light chain (L) of the fully human TSH receptor-blocking monoclonal antibody of the CHK36 homologous cluster

[0088]

[0089]

[0090] The present invention includes a group of fully human TSH receptor-blocking monoclonal antibodies or their antigen-binding fragments, namely CHK36, CHK9, CHK8, CHK14, CHK20, and CHK11. This group of antibodies has a high homology with CHK36, so it is named a group of CHK36 homologous cluster fully human TSH receptor-blocking monoclonal antibodies or their antigen-binding fragments. In the above table, k1-70 is a reported TSH receptor-blocking monoclonal antibody with blocking activity. In comparison, the sequences provided by the present invention are very different and have no homology at all.

[0091] Preferably, the present invention provides a group of fully human TSH receptor-blocking monoclonal antibodies or their antigen-binding fragments, named CHK36 homologous cluster fully human TSH receptor-blocking monoclonal antibodies or their antigen-binding fragments.

[0092] In the present invention, the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment is an antagonist of TSH.

[0093] In the present invention, the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment is an antagonist of thyroid-stimulating antibody.

[0094] In the present invention, the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment respectively contains a V H region (heavy chain variable region), and the V H region contains complementarity-determining regions (CDRs) with amino acid sequences as shown in SEQ ID NO: 26 - SEQ ID NO: 28 (see Table 1).

[0095] In the present invention, the antibody respectively contains a V L region (light chain variable region), and the V L region contains CDRs with amino acid sequences as shown in SEQ ID NO: 29, 35, 39 (see Table 1) or CDRs with amino acid sequences as shown in SEQ ID NO: 30, 35, 40 (see Table 1) or CDRs with amino acid sequences as shown in SEQ ID NO: 31, 36, 41 (see Table 1) or CDRs with amino acid sequences as shown in SEQ ID NO: 32, 37, 42 (see Table 1) or CDRs with amino acid sequences as shown in SEQ ID NO: 33, 38, 43 (see Table 1) or CDRs with amino acid sequences as shown in SEQ ID NO: 34, 35, 44 (see Table 1).

[0096] In the present invention, the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment contains one or more amino acid sequences that are substantially homologous to these CDRs.

[0097] The fully human TSH receptor-blocking monoclonal antibody or antigen-binding fragment thereof provided by the present invention binds to the TSH receptor to inhibit the signal transduction of the TSH receptor; inhibits the synthesis and secretion of thyroid hormones, reducing hyperthyroidism caused by various reasons; can significantly reduce goiter caused by hyperthyroidism and other reasons after binding to the TSH receptor; and alleviates the inflammation, edema, hyperplasia, etc. of thyroid-associated ophthalmopathy.

[0098] The thyroid-associated ophthalmopathy (TAO) described in the present invention is also known as thyroid eye disease (TED).

[0099] The present invention also provides a preparation, drug or pharmaceutical composition, which contains the fully human TSH receptor-blocking monoclonal antibody or antigen-binding fragment thereof as described above.

[0100] The present invention also provides a reagent or kit, which contains the fully human TSH receptor-blocking monoclonal antibody or antigen-binding fragment thereof as described above.

[0101] The present invention also provides a nucleotide encoding the fully human TSH receptor-blocking monoclonal antibody or antigen-binding fragment thereof as described above, and its nucleotide sequence is one of the following sequences:

[0102] (a) The nucleotide sequence encoding the heavy chain variable region is shown as one of SEQ ID NO: 13, 15, 17, 19, 21, 23; the nucleotide sequence encoding the light chain variable region is shown as one of SEQ ID NO: 14, 16, 18, 20, 22, 24;

[0103] (b) A nucleotide sequence having at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more sequence identity with SEQ ID NO: 13 - SEQ ID NO: 24;

[0104] (c) A nucleotide sequence obtained by adding, substituting, deleting or inserting one or several nucleotides to the nucleotide sequence shown in SEQ ID NO: 13 - SEQ ID NO: 24;

[0105] (d) A nucleotide sequence that hybridizes under stringent conditions to the nucleotide sequence of the foregoing (a), (b) or (c) or its full-length complement; or,

[0106] (e) A nucleotide sequence that is different from the nucleotide sequences in (a), (b), (c), and (d) above due to the degeneracy of the genetic codon;

[0107] Wherein, the nucleotide sequence of the nucleotide or a part thereof encodes an antibody V H domain; and antibody V L domain or a CDR selected from those shown in SEQ ID NO: 26 - SEQ ID NO: 44 (see Table 1).

[0108] The present invention also provides a vector, which contains the nucleotide as described above.

[0109] The present invention also provides a host cell, which contains the nucleotide as described above, and / or the vector as described above.

[0110] The present invention also provides a cell, which is an isolated cell containing the fully human TSH receptor - blocking monoclonal antibody or its antigen - binding fragment as described above, and / or the nucleotide as described above, and / or the vector as described above.

[0111] The present invention also provides a cell, which is an isolated cell expressing the fully human TSH receptor - blocking monoclonal antibody or its antigen - binding fragment as described above.

[0112] The present invention also provides a cell, which is an isolated cell secreting the fully human TSH receptor - blocking monoclonal antibody or its antigen - binding fragment as described above.

[0113] The present invention also provides a composition, which contains a TSH receptor autoantibody at a determined concentration and contains a fully human TSH receptor - blocking monoclonal antibody or its antigen - binding fragment as described above.

[0114] The present invention also provides a pharmaceutical composition for administering to a mammalian subject to treat a thyroid - related disorder, which contains the fully human TSH receptor - blocking monoclonal antibody or its antigen - binding fragment as described above and a pharmaceutically acceptable carrier;

[0115] Wherein, the thyroid - related disorder is selected from: hyperthyroidism, thyroid - associated ophthalmopathy (Graves' ophthalmopathy), neonatal hyperthyroidism, human chorionic gonadotropin - induced hyperthyroidism, thyroid hyperactivity, thyroid cancer, thyroiditis, and pretibial myxedema, etc.

[0116] Furthermore, the preparation, drug or pharmaceutical composition may further comprise physiologically compatible excipients, including buffers, diluents, excipients, fillers, binders, wetting agents, disintegrants, absorption promoters, surfactants, adsorption carriers, lubricants, etc.

[0117] Furthermore, the preparation, drug or pharmaceutical composition can be made into injections, sterile powders for injection, tablets, pills, capsules, lozenges, spirits, powders, granules, syrups, solutions, tinctures, aerosols, powder sprays, or suppositories, etc. The preparations, drugs or pharmaceutical compositions of the above various dosage forms can all be prepared according to conventional methods in the pharmaceutical field.

[0118] Furthermore, the preparation, drug or pharmaceutical composition can be introduced into the body, such as muscle, intradermal, subcutaneous, intravenous, mucosal tissue, by injection, spraying, nasal dropping, eye dropping, penetration, absorption, physical or chemical mediated methods; or be introduced into the body after being mixed or encapsulated with other substances.

[0119] Preferably, the reagent or kit for detecting hyperthyroidism and thyroid-related ophthalmopathy contains the fully human TSH receptor-blocking monoclonal antibody.

[0120] Furthermore, the nucleotide sequence or at least part of the sequence can be expressed through a suitable expression system to obtain the corresponding protein or polypeptide. These expression systems include but are not limited to bacterial, insect cell and mammalian cell expression systems.

[0121] Furthermore, the vector can be a plasmid, a virus or a fragment thereof, as well as various different types of vectors known to those skilled in the art.

[0122] Preferably, the host cell is CHO-K1 cell, etc.

[0123] Specifically, the composition may comprise a TSHR autoantibody with a determined concentration having TSH antagonist activity, and include a fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment according to the present invention.

[0124] Furthermore, the pharmaceutical composition is suitable for administration to humans; preferably, the pharmaceutical composition according to the present invention has no significant adverse effects on the immune system of the subject.

[0125] Furthermore, the pharmaceutical composition includes one or more additional thyroid-stimulating hormone receptor antagonists.

[0126] Furthermore, the pharmaceutical composition is used to treat a thyroid-related disorder in an injectable form.

[0127] Preferably, the pharmaceutical composition for treating Graves' ophthalmopathy is in the form of an intravenous injection preparation or an eye drop.

[0128] Preferably, the pharmaceutical composition for treating pretibial myxedema is in a form of topical administration.

[0129] Specifically, the pharmaceutical composition comprises any antibody according to the present invention and any pharmaceutically acceptable carrier, adjuvant or vehicle. Pharmaceutically acceptable carriers, adjuvants and vehicles for use in the pharmaceutical compositions of the present invention include, but are not limited to, buffering substances (such as phosphates), glycine, ion exchangers, aluminum oxide, aluminum stearate, lecithin, serum proteins (such as human serum albumin), sorbic acid, potassium sorbate, water, sodium chloride, salts or electrolytes (such as protamine sulfate), disodium hydrogen phosphate, potassium hydrogen phosphate, partial glyceride mixtures of saturated vegetable fatty acids, zinc salts, silica sols, cellulose-based substances, polyethylene glycols, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polypropylene block polymers, magnesium trisilicate, polyvinylpyrrolidone, polyethylene glycol and lanolin.

[0130] The pharmaceutical composition may be in the form of capsules, tablets, aqueous suspensions, solutions, rectal suppositories, enemas, ointments, lotions, creams, nasal sprays, inhalants. Preferably, they are solution and ointment preparations.

[0131] Specifically, the pharmaceutical composition may be in the form of a sterile injectable preparation, such as a sterile injectable oil suspension or aqueous suspension. Such suspensions can be prepared using suitable dispersing or wetting agents (such as Tween 80) and suspending agents according to techniques known in the art. The sterile injectable reagent can also be a sterile injectable solution or suspension made from a non-toxic parenterally acceptable diluent or solvent, such as a solution dissolved in 1,3-butanediol. Acceptable carriers and solvents that can be used are water, mannitol, Ringer's solution and isotonic sodium chloride solution. In addition, sterile non-volatile oils are commonly used as solvents or suspending media. For this purpose, any mild non-volatile oil can be used, including synthetic monoglycerides or diglycerides. Fatty acids (such as oleic acid and its glyceride derivatives) can be used to prepare injectables. The above oil solutions or suspensions may also contain long-chain alcohol diluents or dispersing agents.

[0132] Specifically, the pharmaceutical composition can be administered by topical administration, by inhalation via spraying, orally, parenterally, by eye drops or eye ointments, orally, vaginally, rectally, nasally or via an implantable reservoir, etc. Preferably, it is oral administration or injection administration. The term "parenteral" as used in the present invention includes subcutaneous, intradermal, intrasynovial, intrasternal, intravenous, intramuscular, intralesional, intracranial, intra-articular and intrathecal injection or infusion techniques.

[0133] Specifically, the pharmaceutical composition can also be administered rectally in the form of suppositories. These compositions can be prepared by mixing the compounds of the present invention with suitable non-irritating excipients that are solid at room temperature but liquid at rectal temperature, and thus will dissolve in the rectum to release the active ingredient. Such materials include, but are not limited to, beeswax, cocoa butter, and polyethylene glycol.

[0134] Specifically, the pharmaceutical composition can be administered orally in any orally acceptable dosage form, including but not limited to tablets, capsules, aqueous suspensions, and solutions. For oral tablets, common carriers include corn starch and lactose. Lubricants such as magnesium stearate are usually also added. For oral capsule form, useful diluents include lactose and dry corn starch. When an aqueous suspension is for oral administration, its active ingredient is combined with emulsifying and suspending agents. If desired, certain flavoring and / or sweetening and / or coloring agents can also be added.

[0135] Specifically, the pharmaceutical composition can be administered in the form of a nasal spray or an inhalant. These compositions are prepared according to techniques well known in the field of pharmaceutical formulations and can be prepared as a saline solution using benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and / or other dispersing or solubilizing agents known in the art.

[0136] Specifically, when the desired treatment involves an area or organ that is easily accessible by topical application, topical administration of the pharmaceutical composition of the present invention is particularly useful. For topical skin administration, the pharmaceutical composition should be formulated with a suitable ointment containing the active ingredient suspended or dissolved in a carrier. Carriers for topical use of the compounds of the present invention include, but are not limited to, mineral oil, white petrolatum, propylene glycol, liquid petrolatum, emulsifying wax, polyoxyethylene polyoxypropylene compounds, and water. Alternatively, the pharmaceutical composition can be formulated with a suitable cream or lotion containing the active compound suspended or dissolved in a carrier. Suitable carriers include, but are not limited to, mineral oil, polysorbate 60, cetyl esters wax, cetyl alcohol, sorbitan monostearate, benzyl alcohol, 2-octyldodecanol, and water. The pharmaceutical composition of the present invention can also be used for the lower intestine by rectal suppository formulations or in the form of a suitable enema. The present invention also includes topical transdermal plasters.

[0137] The present invention also provides a method for preparing a fully human TSH receptor-blocking monoclonal antibody or an antigen-binding fragment thereof, and the preparation method specifically comprises the following steps:

[0138] First step: Sort plasma cells and memory B cells against TSHR in the peripheral blood of patients with relatively high TBAb activity, extract single-cell RNA and synthesize cDNA, and verify the amplification of heavy chain H, light chain λ, and light chain κ of the sorted single cells by nested PCR. Select single-cell clones with both heavy chain and light chain being positive for subsequent cloning;

[0139] Second step: Clone the BCR heavy chain and light chain of all single B cells into the heavy chain expression vector AbVec-IGHG1, the λ light chain expression vector AbVec-hIgKappa, or the λ light chain expression vector AbVec-hIgLambda by in vitro amplification with nested PCR;

[0140] Third step: After successfully obtaining the heavy chain and light chain recombinant plasmids, sequence and perform alignment analysis on the obtained candidate clones to clarify the nucleotide and amino acid sequence numbers of the obtained candidate antibodies; Transfect the heavy chain and light chain expression plasmids to express monoclonal antibodies in vitro; Further verify the antigen-binding ability and antibody blocking activity, and finally obtain an antibody combination that can specifically target the target antigen, namely the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment.

[0141] The present invention also provides a method for treating a thyroid-related disorder in a mammalian subject or in cells derived from the subject, the method comprising contacting the subject or the cells with the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above.

[0142] Wherein, the thyroid-related disorder is selected from: hyperthyroidism, thyroid-related ophthalmopathy (Graves' ophthalmopathy), neonatal hyperthyroidism, human chorionic gonadotropin-induced hyperthyroidism, excessive thyroid activity, thyroid cancer, thyroiditis, and pretibial myxedema, etc.

[0143] The present invention also provides a method for inhibiting the stimulation of the TSH receptor by thyroid-stimulating antibodies in the thyroid of a mammalian subject, the method comprising contacting the subject with the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment of the present invention;

[0144] Preferably, prevent the binding of thyroid-stimulating antibodies to the TSH receptor.

[0145] The present invention also provides a method for inhibiting the binding of thyroid-stimulating autoantibodies to the TSH receptor outside the thyroid in a mammalian subject, the method comprising contacting the subject with the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above;

[0146] Specifically, the extra-thyroid TSH receptor is located in the retro-orbital tissue and / or pretibial tissue of the subject;

[0147] Preferably, the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment can block the binding of TSH receptor autoantibody to the extra-thyroid TSH receptor.

[0148] The present invention also provides a method for treating thyroid cancer or metastatic thyroid cancer in a subject or in thyroid cells derived from the subject, the method comprising contacting the cancer cells with the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above, with the aim of inhibiting the constitutive thyrotropin receptor activity in the cells;

[0149] Preferably, the regrowth of the thyroid cancer cells is prevented or delayed.

[0150] The present invention also provides a method for treating hyperthyroidism caused by constitutive thyroid activity in a subject or in thyroid cells derived from the subject, the method comprising contacting the subject or the cells with the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above, with the aim of inhibiting such hyperthyroidism.

[0151] The present invention also provides a method for identifying a molecule that can inhibit the binding of thyroid-stimulating antibody to the TSH receptor, the method comprising providing at least one fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above as a reference;

[0152] Preferably, a molecule that can prevent the binding of thyroid-stimulating antibody to the TSH receptor is selected.

[0153] The present invention also provides a method for identifying a molecule that can inhibit the binding of thyroid-blocking antibody to the TSH receptor, the method comprising providing at least one fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above as a reference;

[0154] Preferably, a molecule that can prevent the binding of thyroid-blocking antibody to the TSH receptor is selected.

[0155] Specifically, the thyroid-related disorders are selected from hyperthyroidism, thyroid-associated ophthalmopathy (Graves' ophthalmopathy), neonatal hyperthyroidism, human chorionic gonadotropin-induced hyperthyroidism, hyperthyroidism, thyroid cancer, thyroiditis, and pretibial myxedema, etc.

[0156] Preferably, the subject treated in the above method is a human.

[0157] In the present invention, the preparation method includes the following steps: sorting plasma cells and memory single B cells that specifically recognize TSHR from the peripheral blood of patients with high titers of TSH receptor-blocking antibodies (TSH-stimulating blocking antibody, TBAb) by flow cytometry, cloning the heavy and light chains of the antibody in vitro and recombinantly expressing them, and screening and verifying the antibody properties using hTSHR-CHO cells to obtain a blocking monoclonal antibody that specifically targets the human TSHR. Through the preparation method of the fully human TSH receptor-blocking monoclonal antibody for the treatment of hyperthyroidism proposed by the present invention, the target antibody sequence can be obtained in 3 weeks to 1 month.

[0158] Furthermore, the present invention verifies the antibody properties and evaluates the effects in vitro using hTSHR-CHO cells.

[0159] The present invention also provides the use of the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above for the treatment of a thyroid-related disorder.

[0160] The present invention also provides the use of the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above in the preparation of a drug for the treatment of a thyroid-related disorder.

[0161] The present invention also provides the application of the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above in the preparation of a reagent or kit for detecting TSH receptor antibodies.

[0162] The present invention also provides the application of the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment as described above in the preparation of a reagent or kit or product for detecting hyperthyroidism and thyroid-related ophthalmopathy.

[0163] The present invention also provides the application of the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment, or the substance as described above, or the method as described above in the preparation of a preparation, drug or pharmaceutical composition for detecting TSH receptor antibodies, the preparation of a drug for the treatment of hyperthyroidism and thyroid-related ophthalmopathy, the preparation of a drug for inhibiting thyroid hyperplasia and / or thyroid hormone production, the preparation of a drug for TSH receptor blockade, and the preparation of a drug for antagonizing the activation effect of TSH on the TSH receptor.

[0164] Specifically, the thyroid-related disorders in the above method are selected from hyperthyroidism, thyroid-related ophthalmopathy (Graves' ophthalmopathy), neonatal hyperthyroidism, human chorionic gonadotropin-induced hyperthyroidism, thyroid hyperactivity, thyroid cancer, thyroiditis, and pretibial myxedema, etc.

[0165] The method of the present invention, since it does not require immunizing animals, amplifies antibody genes directly from human single B cells, and amplifies the antibody genes of isolated single plasma cells or memory B cells, thereby obtaining a large number of naturally paired antibody heavy and light chain genes. Then, by expressing the paired antibody heavy and light chain genes, antibodies with antigen specificity and neutralizing activity are finally screened. The method of the present invention has the advantages of being fast, high-throughput, and requiring a small amount of cells. The fully human antibodies prepared retain rich gene diversity and natural pairing of the heavy and light chain variable regions, having great advantages. Compared with the traditional hybridoma antibody preparation technology, the method of the present invention can significantly shorten the experimental period. The traditional hybridoma antibody preparation technology generally takes about 3 months to obtain antibody sequences, while the present invention only needs 3 weeks to 1 month to obtain antibody sequences, greatly reducing the workload and cost of antibody preparation.

[0166] The beneficial effects of the present invention also include: the fully human TSH receptor-blocking monoclonal antibody or its antigen-binding fragment of the present invention can effectively block the signal transduction after TSH binds to the receptor; inhibit the synthesis and secretion of thyroid hormones; significantly inhibit the fibrosis of orbital fibroblasts, the effector cells of thyroid-associated ophthalmopathy. It can be used to treat a series of diseases caused by hyperthyroidism such as thyroid ophthalmopathy, neonatal hyperthyroidism, human chorionic gonadotropin-induced hyperthyroidism, thyroid hyperactivity, thyroid cancer, thyroiditis, and pretibial myxedema, etc., having broad application prospects. BRIEF DESCRIPTION OF THE DRAWINGS

[0167] In order to more clearly illustrate the technical solutions in the embodiments of the present invention or the prior art, the following will briefly introduce the drawings required for the description of the embodiments or the prior art. Obviously, the drawings in the following description are only some embodiments of the present invention. For those skilled in the art, without creative efforts, other drawings can be obtained according to these drawings.

[0168] Figure 1 This is for the flow cytometry technology of the present invention to sort plasma cells and memory single B cells that specifically recognize TSHR from peripheral blood. Using Biotin-AF647-labeled TSHR protein as a bait, the other antibodies used for sorting are: CD19-PacificBlue, IgM-PE, CD27-BV605, CD38-PE-Cy7. Finally, the TSHR-specific plasma cells and memory single B cells sorted are CD19 + IgM - CD27 + CD38 - TSHR + .

[0169] Figure 2This is the screening graph of the blocking activity of the anti-human TSHR monoclonal antibody of the present invention. The results shown are the mean ± standard deviation (n = 3). The dotted line value is 30%.

[0170] Figure 3 This is the result of the phylogenetic tree analysis of the anti-human TSHR monoclonal antibody sequence of the present invention. The percentage of replicate trees in which the related taxa clustered together in the bootstrap test (1000 replicates) is shown below the branches.

[0171] Figure 4 This is the evaluation of the inhibitory effect of the CHK36 antibody on orbital fibroblasts in the present invention. The horizontal line numbers represent the statistical differences (P values) of the antibody group compared with the control group (Control). A value less than or equal to 0.05 indicates a significant difference. Detailed implementation manners

[0172] Combined with the following specific embodiments and drawings, the present invention will be further described in detail. The processes, conditions, experimental methods, etc. for implementing the present invention, except for the specifically mentioned content below, are all general knowledge and well-known common sense in the art, and the present invention has no particularly restricted content.

[0173] The following description of at least one exemplary embodiment is actually only illustrative and in no way limits the present invention and its application or use. Based on the embodiments in the present invention, all other embodiments obtained by those of ordinary skill in the art without creative efforts belong to the scope of protection of the present invention.

[0174] In all the examples shown and discussed here, any specific value should be construed as merely exemplary and not as a limitation. Therefore, other examples of the exemplary embodiments may have different values.

[0175] The present invention provides a group of fully human TSH receptor (TSHR) blocking monoclonal antibodies for the treatment of hyperthyroidism, as well as their preparation methods and applications. The method of the present invention includes the following steps: sorting plasma cells and memory single B cells that specifically recognize TSHR in the peripheral blood of patients with high titers of TSH-stimulating blocking antibodies (TBAb) by flow cytometry, cloning the heavy and light chains of the antibody in vitro and recombinantly expressing them, and using hTSHR-CHO cells to screen and verify the properties of the antibody, so as to obtain blocking monoclonal antibodies that specifically target human TSHR. The fully human TSH receptor blocking monoclonal antibody of the present invention can specifically bind to TSHR and has good inhibitory activity in in vitro and in vivo experiments, and has broad application prospects in the treatment and development of Graves' disease.

[0176] Unless otherwise specified, the test materials used in the examples are all conventional biochemical reagents.

[0177] Example 1

[0178] Single cell sorting: Collect the peripheral blood of volunteers with high TBAb titers. Add the immunodensity gradient centrifugation human B cell enrichment mixture (STEMCELL, catalog number: 15024) to the blood sample, and use -1077 (Sigma, catalog number: 10771) for density gradient centrifugation to obtain B cells in the peripheral blood. Sort and collect CD19 + IgM - CD27 + CD38 - TSHR + plasma cells and memory single B cells ( Figure 1 ).

[0179] Variable region cloning of heavy and light chains: Use the SPRlselect nucleic acid fragment screening kit (Beckman Coulter, catalog number: B23317) to capture and bind the RNA of single cells, and synthesize cDNA according to the instructions of the SuperScript TM IV One-Step RT-PCR System (Invitrogen, catalog number: 12594100). Using cDNA as a template, use DreamTaq Green PCR 2X MasterMix (ThermoFisher, catalog number: K1081) to perform PCR amplification on the variable regions of the antibody heavy and light chains respectively. Subsequently, perform agarose gel electrophoresis detection on the amplified PCR products, cut and recover the bands with fragment sizes that meet the expectations, use the QIAquick Gel Extraction Kit (QIAGEN, catalog number: 28704) to purify the DNA fragments and send them for sequencing. Analyze the sequencing results through the IgBLAST function of NCBI or the IMGT database, and select the corresponding V and J gene cloning primers to perform cloning PCR on the heavy and light chains. Subsequently, use HiFi DNA Assembly Master Mix (NEB, catalog number: E2621L) for fragment ligation, and clone the obtained variable region sequences of the heavy and light chains into the corresponding heavy and light chain expression vectors containing the constant regions of the heavy and light chains (NCBI GenBank numbers: FJ475055, FJ475056, FJ517647). After transformation, spread the plates and pick clones, and sequence to determine the final sequence.

[0180] Blocking antibody screening:

[0181] 1. Antigen-binding ability screening: Co-transfect the antibody heavy and light chain expression vectors into 293T cells at a ratio of 1:1. After culturing at 37°C and 5% CO2 for 3 days, centrifuge to collect the culture supernatant, and detect the titer of the TRAb antibody in the supernatant according to the instructions of the Human Anti-Thyrotropin Receptor Antibody Enzyme-Linked Immunosorbent Assay Kit (Kelux, product number: ELK9540). Remove the heavy and light chain combinations with binding ability lower than the blank control group, and perform blocking activity screening on the remaining combinations.

[0182] 2. Blocking activity screening: Co-transfect the antibody heavy and light chain expression vectors into 293T cells at a ratio of 1:1. After culturing at 37°C and 5% CO2 for 3 days, centrifuge to collect the culture supernatant. Use 100 μL of the supernatant and add 1 IU / L bTSH (Sigma) at the same time. After incubating hTSHR-CHO cells for 2 hours, collect the cell lysate and detect the change in the cAMP level of the cells (R&D, product number: KGE002B).

[0183] Antibody expression and purification: Co-transfect the antibody heavy and light chain expression vectors into 293F cells at a ratio of 1:1; after culturing at 37°C, 8% CO2, and shaking at 130 rpm for 5 days, centrifuge to collect the culture supernatant, filter through 0.45 μm, and purify by Protein A (GenScript, product number: L00210) affinity chromatography to obtain an antibody protein with high purity; determine the antibody concentration by Bradford protein concentration method (Beyotime, product number: P0006) and NanoDrop A280 method.

[0184] Evaluation of in vitro TSHR inhibition effect: Dilute the purified monoclonal antibody according to different concentration gradients, add 5 ng / ml bTSH, and incubate hTSHR-CHO cells for 2 hours. Then collect the cell lysate and detect the change in the cAMP level of the cells. If the percentage of inhibited cAMP production is greater than 30%, it is considered that the monoclonal antibody has inhibitory activity. It is found that when the monoclonal antibody concentration is 1 μg / mL, it can effectively antagonize the activation of the TSH receptor by TSH and shows concentration dependence. Among them, CHK36 can reach 94% in inhibiting cAMP production at 1 μg / mL, and the inhibitory activity is as high as 92% at a concentration of 2 μg / mL.

[0185] Phylogenetic tree analysis: Use MEGA 11 analysis software to perform phylogenetic analysis of the antibody, construct a phylogenetic tree using the neighbor-joining method, and evaluate the reliability of the phylogenetic tree using the Bootstrap value. The percentage of replicated trees in which the relevant taxa cluster together in the bootstrap test (1000 replicates) is shown below the branches, and the evolutionary distance is calculated using the Poisson correction method. Figure 3The results are displayed for the unrooted optimal tree combined with the in vitro inhibitory activity assay. Antibody K1-70 is a reported inhibitory antibody, and the rest are antibodies obtained in this screening. The closer the evolutionary distance, the closer the inhibitory activity. In a group of THSR inhibitory monoclonal antibodies screened by the present invention, CHK36 and CHK9 have a very close evolutionary distance, and their inhibitory efficiency on TSHR function is similar. They are the two human monoclonal antibodies with the strongest inhibitory activity in this group of monoclonal antibodies (the inhibitory activity is greater than 90% at 2μg / mL). Further analysis results show that K1-70 is far from the strongest inhibitory antibody CHK36 in the present invention, indicating that the sequence difference between the two antibodies is large, and they are two TSHR inhibitory monoclonal antibodies with completely different sequences. The TSHR inhibitory monoclonal antibody screened by the present invention with the closest evolutionary distance to K1-70 is CHK11, and its inhibitory activity is 75% when the antibody concentration is 2μg / mL, indicating that the inhibitory efficiency of K1-70 on TSHR is lower than that of the strongest inhibitory antibody CHK36 screened this time.

[0186] Evaluation of the inhibitory effect on orbital fibroblasts (OF cells): OF cells were cultured in a 10 cm dish containing DMEM with 10% FBS, and when they grew to 70%, they were subcultured to a 12-well plate and cultured for 16 hours with DMEM containing 1% FBS. After adding 50 ng / ml of the inhibitory antibody SH1, the culture was continued for 24 hours. The cells were collected to extract RNA, and RT-qPCR was performed to detect the expression level of mRNA of fibrosis-related genes. The results showed that the TSHR inhibitory monoclonal antibody CHK36 could significantly inhibit the expression of collagen 1A2 (COL1A2), a fibrosis marker ( Figure 4 ).

[0187] Unless otherwise defined, all technical and scientific terms used in the present invention have the same meaning as those commonly understood by those skilled in the art of the present invention. The terms used in the specification of the present invention are only for the purpose of describing specific embodiments and are not intended to limit the present invention.

[0188] As used in the present invention, the terms "include" and "comprising" are open expressions, that is, including the contents specified in the present invention but not excluding other contents.

[0189] As used herein, the term "and / or" includes any and all combinations of one or more of the associated listed items.

[0190] The protection content of the present invention is not limited to the above embodiments. Without departing from the spirit and scope of the inventive concept, changes and advantages that can be thought of by those skilled in the art are included in the present invention and are protected by the attached claims.

Claims

1. A group of fully human TSH receptor blocking monoclonal antibodies or antigen-binding fragments thereof, characterized in that: The fully human TSH receptor blocking monoclonal antibody or its antigen binding fragment binds to the TSH receptor to block the binding of TSH to the TSH receptor; the fully human TSH receptor blocking monoclonal antibody or its antigen binding fragment comprises a heavy chain variable region and a light chain variable region; Wherein, the heavy chain variable region comprises H-CDR1, H-CDR2 and H-CDR3, and the amino acid sequences of H-CDR1, H-CDR2 and H-CDR3 are shown in SEQ ID NO:26, SEQ ID NO:27 and SEQ ID NO:28, respectively; The light chain variable region comprises L-CDR1, L-CDR2 and L-CDR3, the amino acid sequence of the L-CDR1 is selected from one of SEQ ID NOs: 29 to 34; the amino acid sequence of the L-CDR2 is selected from one of SEQ ID NOs: 35 to 38; the amino acid sequence of the L-CDR3 is selected from one of SEQ ID NOs: 39 to 44.

2. The fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1, characterized in that: The amino acid sequence of the heavy chain variable region is selected from one of SEQ ID NO: 1, 3, 5, 7, 9, 11 or has at least 85% sequence identity with one of SEQ ID NO: 1, 3, 5, 7, 9, 11; The amino acid sequence of the light chain variable region is selected from one of SEQ ID NO: 2, 4, 6, 8, 10, 12 or has at least 85% sequence identity with one of SEQ ID NO: 2, 4, 6, 8, 10, 12.

3. The fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2, characterized in that: The antigen binding fragment is selected from Fab, Fab', F(ab')2, Fv, single-chain Fv (scFv), Fav, dsFv, sc(Fv)2, and single domain antibody (dAb).

4. The fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2, characterized in that: The fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof is a TSH antagonist; and / or is an antagonist of thyroid stimulating antibodies.

5. A substance as described in any one of the following, characterized in that The substances include: (1) A preparation, a drug or a pharmaceutical composition, comprising the fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof as claimed in claim 1 or 2; (2) A reagent or a kit, comprising the fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof according to claim 1 or 2; (3) A nucleotide encoding the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof as claimed in claim 1 or 2, wherein the nucleotide sequence comprises: (a) the nucleotide sequence encoding the heavy chain variable region is shown in one of SEQ ID NOs: 13, 15, 17, 19, 21, and 23; the nucleotide sequence encoding the light chain variable region is shown in one of SEQ ID NOs: 14, 16, 18, 20, 22, and 24; (b) a nucleotide sequence having at least 85% sequence identity to one of SEQ ID NO: 13 to SEQ ID NO: 24; (c) a nucleotide sequence after one or more nucleotides are added, substituted, deleted or inserted into the nucleotide sequence shown in SEQ ID NO: 13 to SEQ ID NO: 24; (d) a nucleotide sequence that hybridizes under stringent conditions to the nucleotide sequence of (a), (b) or (c) above or its full-length complement; or, (e) a nucleotide sequence that is different from the nucleotide sequences of (a), (b), (c), and (d) above due to the degeneracy of the genetic code; Wherein, the nucleotide sequence of the nucleotide or a part thereof encodes antibody V H Domain and antibody V L A domain or a CDR selected from SEQ ID NO: 26 to SEQ ID NO: 44; (4) A vector comprising the nucleotide described in (3); (5) A host cell, comprising the nucleotide described in (3) and / or the vector described in (4); (6) A cell, wherein the cell is an isolated cell comprising the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2, and / or the nucleotide according to (3), and / or the vector according to (4); and / or, An isolated cell expressing the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof as claimed in claim 1 or 2; and / or, An isolated cell secreting the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof as claimed in claim 1 or 2; (7) A composition comprising a determined concentration of TSH receptor autoantibodies and a fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof according to claim 1 or 2; (8) A pharmaceutical composition for administration to a mammalian subject to treat a thyroid-related disorder, the pharmaceutical composition comprising the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2 and a pharmaceutically acceptable carrier; Wherein, the thyroid-related disease is selected from: hyperthyroidism, thyroid-related eye disease (Graves' ophthalmopathy), neonatal hyperthyroidism, human chorionic gonadotropin-induced hyperthyroidism, overactive thyroid, thyroid cancer, thyroiditis and pretibial myxedema.

6. The substance according to claim 5, characterized in that The pharmaceutical composition is suitable for administration to humans.

7. The substance according to claim 5, characterized in that The pharmaceutical composition includes one or more additional thyroid stimulating hormone receptor antagonists.

8. The substance according to claim 5, characterized in that The pharmaceutical composition comprises the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2 and any pharmaceutically acceptable carrier, adjuvant or vehicle.

9. The substance according to claim 5, characterized in that The administration of the pharmaceutical composition includes oral administration, parenteral administration, administration by spray inhalation, topical administration, administration by eye drops or eye ointment, rectal administration, nasal administration, oral administration, vaginal administration, and administration via an implanted reservoir.

10. The substance according to claim 5, characterized in that The pharmaceutical composition may be in the form of capsules, tablets, aqueous suspensions, solutions, rectal suppositories, enemas, ointments, lotions, creams, nasal sprays, and inhalants.

11. The substance according to claim 5, characterized in that The pharmaceutical composition is used to treat a thyroid-related disorder in an injectable form.

12. The substance according to claim 5, characterized in that The pharmaceutical composition is used for treating pretibial myxedema in a topical administration form; and / or, The pharmaceutical composition is used for treating Graves' ophthalmopathy in the form of intravenous injection preparation or eye drops.

13. Any of the following methods, characterized in that: The method comprises: (1) A method for preparing a fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof, the preparation method specifically comprising the following steps: In the first step, plasma cells and memory B cells targeting TSHR in the peripheral blood of patients with high TBAb activity were sorted, and single-cell RNA was extracted and cDNA was synthesized. The sorted single cells were amplified and verified by nested PCR for heavy chain H, light chain λ and light chain κ, and single-cell clones that were positive for both heavy and light chains were selected for subsequent cloning; In the second step, the BCR heavy and light chains of all single B cells were cloned into the heavy chain expression vector AbVec-IGHG1, the λ light chain expression vector AbVec-hIgKappa or the λ light chain expression vector AbVec-hIgLambda by nested PCR in vitro amplification; In the third step, after the heavy chain and light chain recombinant plasmids are successfully obtained, the obtained candidate clones are sequenced and compared and analyzed to determine the number of nucleotide and amino acid sequences of the obtained candidate antibodies; heavy chain and light chain expression plasmids are transfected to express monoclonal antibodies in vitro; the antigen binding ability and antibody blocking activity are further verified, and finally an antibody combination that can specifically target the target antigen, namely the fully human TSH receptor blocking monoclonal antibody, is obtained; (2) A method for treating a thyroid-related disorder in a mammalian subject or in a cell derived from the subject, the method comprising contacting the subject or the cell with the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2; (3) A method for inhibiting thyroid stimulating antibodies from stimulating TSH receptors in the thyroid gland of a mammalian subject, the method comprising contacting the subject with the fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof according to claim 1 or 2; (4) A method for inhibiting the binding of thyroid stimulating autoantibodies to extrathyroidal TSH receptors in a mammalian subject, the method comprising contacting the subject with a fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof according to claim 1 or 2; (5) A method for treating thyroid cancer or metastatic thyroid cancer in a subject or in thyroid cells derived from a subject, the method comprising contacting the cancer cells with a fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof according to claim 1 or 2, with the purpose of inhibiting constitutive thyroid stimulating hormone receptor activity in the cells; (6) A method for treating thyroid hyperactivity caused by constitutive thyroid activity in a subject or in thyroid cells derived from the subject, characterized in that the method comprises contacting the subject or the cell with a fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof according to claim 1 or 2, in order to inhibit such thyroid hyperactivity; (7) A method for identifying a molecule that can inhibit the binding of a thyroid stimulating antibody to a TSH receptor, the method comprising providing at least one fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof according to claim 1 or 2 as a reference; (8) A method for identifying a molecule that can inhibit the binding of a thyroid blocking antibody to a TSH receptor, the method comprising providing at least one fully human TSH receptor blocking monoclonal antibody or an antigen-binding fragment thereof according to claim 1 or 2 as a reference.

14. The method according to claim 13, characterized in that The thyroid-related disorder is selected from the group consisting of hyperthyroidism, thyroid-related eye disease (Graves' ophthalmopathy), neonatal hyperthyroidism, human chorionic gonadotropin-induced hyperthyroidism, overactive thyroid, thyroid cancer, thyroiditis, and pretibial myxedema.

15. The method according to claim 13, characterized in that The subject is a human.

16. The method according to claim 13, characterized in that In the method (3), the method prevents the binding of thyroid stimulating antibodies to TSHR.

17. The method according to claim 13, characterized in that Method (4), wherein the extrathyroidal TSH receptor is located in the retro-orbital tissue and / or anterior tibial tissue of the subject; and / or, The fully human TSH receptor blocking monoclonal antibody or the antigen binding fragment thereof blocks the binding of TSHR autoantibodies to the extrathyroidal TSHR.

18. The method according to claim 13, characterized in that In method (5), the method prevents or delays the regrowth of thyroid cancer cells.

19. The method according to claim 13, characterized in that In the method (7), the method selects a molecule to be tested that can prevent the binding of thyroid stimulating antibodies to TSHR.

20. The method according to claim 13, characterized in that In method (8), the method selects a molecule that can prevent thyroid blocking antibodies from binding to TSHR.

21. Any of the following applications, characterized in that: The applications include: (1) Use of the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2 for treating a thyroid-related disease; (2) Use of the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2 in the preparation of a medicament for treating a thyroid-related disease; (3) Use of the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2 in the preparation of a reagent or kit for detecting TSH receptor antibodies; (4) Use of the fully human TSH receptor blocking monoclonal antibody or antigen-binding fragment thereof according to claim 1 or 2 in the preparation of a reagent, kit or product for detecting hyperthyroidism or thyroid-related eye diseases; (5) Use of the fully human TSH receptor blocking monoclonal antibody or its antigen-binding fragment according to claim 1 or 2, or the substance according to claim 5, or the method according to claim 13 in the preparation of a preparation, a drug or a pharmaceutical composition for detecting TSH receptor antibodies, the preparation of a drug for treating hyperthyroidism and thyroid-related eye diseases, the preparation of a drug for inhibiting thyroid hyperplasia and / or thyroid hormone production, the preparation of a TSH receptor blocking drug, and the preparation of a drug for antagonizing the activation effect of TSH on TSH receptors.

22. The use according to claim 21, characterized in that The thyroid-related disorder is selected from the group consisting of hyperthyroidism, thyroid-related eye disease (Graves' ophthalmopathy), neonatal hyperthyroidism, human chorionic gonadotropin-induced hyperthyroidism, overactive thyroid, thyroid cancer, thyroiditis, and pretibial myxedema.

Citation Information

Patent Citations

  • Human monoclonal antibodies to the thyrotropin receptor which act as antagonists

    CN101657468A

  • Secretory thyroid-stimulating hormone receptor and method for assaying antibody against thyroid- stimulating hormone receptor by using the same

    JP2001292782A

Cited By

  • Fully human TSH receptor-blocking monoclonal antibodies targeting CHK36 homolog cluster, preparation method therefor, and application thereof

    WO2026032068A1