Composition for preventing and improving skin aging and cosmetic containing same

By combining red rice extract and type 21 collagen, the problem of insufficient production of type I collagen in skin aging is solved, achieving significant anti-aging effects, especially on skin aging caused by UVA light exposure.

CN121818487APending Publication Date: 2026-04-10BETTER WAY (SHANGHAI) COSMETICS CO LTD
View PDF 0 Cites 0 Cited by

Patent Information

Authority / Receiving Office
CN · China
Patent Type
Applications(China)
Current Assignee / Owner
Filing Date
2026-01-26
Publication Date
2026-04-10

AI Technical Summary

Technical Problem

Existing technologies are insufficient to effectively promote the production of type I collagen in the skin, making it difficult to effectively address skin aging problems.

Method used

A combination of red rice extract and type 21 collagen is used. The red rice extract contains polyphenolic compounds and is prepared by stirring extraction and centrifugation. The red rice extract and type 21 collagen are mixed in a specific ratio to form a solution for use in skin care products.

Benefits of technology

It significantly promotes the production of type I collagen, effectively prevents and improves skin aging, especially skin aging caused by UVA light exposure, and enhances skin elasticity and firmness.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN121818487A_ABST
    Figure CN121818487A_ABST
Patent Text Reader

Abstract

The invention provides a composition for preventing and improving skin aging and a cosmetic containing the same. The composition comprises a red rice extract and type 21 collagen. The composition disclosed by the invention has a synergistic effect on promoting the generation of type I collagen, so that skin aging can be remarkably prevented and / or improved. Meanwhile, the composition and the product containing the composition play an important role in preventing and improving skin aging and treating and improving skin-related diseases.
Need to check novelty before this filing date? Find Prior Art

Description

Technical Field

[0001] This invention belongs to the field of composition, skin aging, and treatment and improvement of skin-related diseases. Specifically, the composition involved plays an important role in preventing and improving skin aging and treating and improving skin-related diseases. It also involves cosmetics containing the composition, which can be used to prevent and improve skin aging. Background Technology

[0002] Skin aging mainly includes endogenous aging and exogenous aging. Exogenous aging refers to the aging changes caused by environmental factors, primarily ultraviolet (UV) radiation, hence it is also called photoaging. Both long-wave ultraviolet (UVA) and medium-wave ultraviolet (UVB) can cause photoaging. Because UVB is 1000 times more damaging to the skin than UVA, it has long been considered the main spectrum causing photoaging. However, recent studies have shown that UVA is the primary spectrum causing skin photoaging.

[0003] The main clinical manifestations of photoaging are wrinkles, roughness, dryness, sagging, telangiectasia, increased fragility, and pigmentation. Long-term sun exposure can affect various cellular components and tissue structures of the skin, with the most characteristic change being alterations in the composition of the dermal extracellular matrix. The dermal extracellular matrix includes collagen fibers, elastic fibers, glycosaminoglycans, and proteoglycans, among which type I collagen is its main structural protein. Studies have shown that the reduction in dermal collagen content and structural damage is one of the important causes of skin aging. Type I collagen is the main biochemical component of collagen fibers. It is secreted by fibroblasts, aggregates extracellularly to form collagen fibrils, and then, with a small amount of bonding, synthesizes into collagen fibers. As one of the main components of the dermis, the content of collagen fibers is directly related to aging characteristics such as wrinkles and sagging.

[0004] Therefore, preventing the degradation of collagen and matrix molecules and promoting their synthesis are key to the formulation development of anti-aging skincare products. Similarly, the development of formulations for related medical aesthetic products and pharmaceutical products is also crucial in the fields of skin aging and the treatment and improvement of skin-related diseases.

[0005] Type 21 collagen is a non-fibrous collagen that is relatively rare in the adult human body, accounting for less than 1% of total collagen. Compared to other more well-known collagen types, research on type 21 collagen is relatively limited. Belonging to the small molecule collagen family and as part of the FACIT (fibrous-associated collagen with a disrupted triple helix) family, type 21 collagen plays a crucial role in connecting extracellular matrix components. Large-scale genotyping studies have revealed that the type 21 collagen gene is involved in collagen formation in various tissues, including the heart and aorta, and is associated with vascular remodeling and hypertension. This provides a new perspective for research on COL21A1 in promoting skin health and anti-aging. These properties give type 21 collagen unique application potential in the fields of skin health, anti-aging, and vascular health.

[0006] According to reports, red rice extract contains phenolic compounds such as anthocyanins and proanthocyanidins. Red rice extract can effectively resist ROS (reactive oxygen species) caused by blue light, inhibit melanin production and collagen degradation, and is an effective representative of biological protective ingredients.

[0007] The search for a more efficient product to promote collagen production is a technology that is still under development. Summary of the Invention

[0008] In view of the above-mentioned deficiencies in the prior art, the present invention provides a composition for preventing and improving skin aging and a cosmetic containing the same. The composition of the present invention has a synergistic effect on promoting the production of type I collagen, thereby significantly preventing and / or improving skin aging.

[0009] One aspect of the present invention provides a composition for preventing and / or improving skin aging, comprising red rice extract and type 21 collagen.

[0010] In this invention, the skin aging described can be caused by light exposure, preferably by UVA light. The UVA band generally refers to 320-400nm. It has strong penetrating power; UVA can reach the dermis layer of the skin, damaging elastic fibers and collagen fibers, thus causing skin aging.

[0011] In this invention, the red rice extract preferably includes phenolic compounds. These phenolic compounds preferably include polyphenolic compounds and / or phenolic acid compounds. The polyphenolic compounds are the main active ingredients. As those skilled in the art will know, the polyphenolic compounds generally include anthocyanins and / or proanthocyanidins.

[0012] In the red rice extract, the polyphenolic compound preferably accounts for more than 6% of the total mass of the red rice extract, for example, 10%, 20%, 25%, 30%, 40%, or 50%, and more preferably 20%-30% of the total mass of the red rice extract. In a specific embodiment of the present invention, based on the polyphenol content of 1.83 mg / mL in the plant extract, the polyphenolic compound accounts for 26.1% of the total mass of the red rice extract.

[0013] In this invention, the preferred method for preparing the red rice extract includes the following steps: red rice is extracted with an aqueous solution of alcohol, and the supernatant is collected by solid-liquid separation; wherein, the substance remaining after removing the solvent from the supernatant is the red rice extract; the alcohol may include one or more of monohydric alcohols, dihydric alcohols, and trihydric alcohols. It is expected by those skilled in the art that the substance remaining after removing the solvent from the supernatant is typically a solid.

[0014] The red rice is preferably red rice bran. The D50 particle size of the red rice bran is preferably 20-100 micrometers.

[0015] The monohydric alcohol may be an alkyl monohydric alcohol, preferably ethanol.

[0016] The diol may be an alkyl diol, preferably propylene glycol and / or butanediol; wherein the propylene glycol is preferably 1,2-propanediol.

[0017] The preferred mass ratio of the red rice to the aqueous solution of the alcohol is 1:(4-19), for example, 1:5 or 1:6.

[0018] The alcohol concentration in the aqueous solution is preferably 30-80%, for example 40%, 50%, 60% or 70%.

[0019] The extraction temperature is preferably 35-55℃.

[0020] The extraction time is preferably 8-13.0 hours.

[0021] The extraction method is stirring extraction. The stirring speed is preferably 150-200 rpm.

[0022] The solid-liquid separation is preferably performed by centrifugation.

[0023] The supernatant is preferably the supernatant after membrane filtration. The membrane filtration is to fully remove residual particulate matter. The filter membrane size can be conventional in the art, generally 0.22-8.00 μm, preferably 0.50 μm.

[0024] In the supernatant, the mass content of the red rice extract is preferably 0.5% or more, more preferably 0.5%-1%, for example 0.7%. Those skilled in the art will understand that the mass content of the red rice extract can be expressed as the solid content in the supernatant.

[0025] In this invention, the type 21 collagen can be conventional in the art. The molecular weight of the type 21 collagen can be 10,000-30,000 Da, for example, 20,000 Da, 22,000 Da, or 25,000 Da. In a specific embodiment of this invention, the amino acid sequence of the type 21 collagen is shown in SEQ ID NO. 1.

[0026] In this invention, the preferred mass ratio of the red rice extract to the type 21 collagen is 1:(0.1-2), for example, 1:0.400, 1:0.420, 1:0.500, 1:0.600, 1:0.700, 1:0.714, 1:0.800, 1:0.900, 1:0.900, 1:1.420, or 1:1.500.

[0027] In this invention, the composition is preferably in the form of a solution.

[0028] In this invention, the composition may contain a solvent, which typically includes water. Optionally, to increase the solubility of the red rice extract and / or the type 21 collagen in water, the solvent may further include alkyl diols and / or alkyl monools. Preferably, the solvent includes one or more of ethanol, 1,2-propanediol, 1,3-propanediol, butanediol, and 1,2-hexanediol. The amount of alkyl diol added can be selected as needed, as long as it is sufficient to dissolve the red rice extract and the type 21 collagen, and no particular limitation is required.

[0029] In this invention, the concentration of the red rice extract in the composition is preferably above 10 ppm, more preferably 10-50 ppm, for example 17.5 ppm or 35 ppm. Those skilled in the art will understand from the examples that when the composition is applied in cosmetics, the concentration of the red rice extract in the cosmetic is preferably also above 10 ppm.

[0030] In this invention, the concentration of type 21 collagen is preferably above 2 ppm, more preferably 2-55 ppm, for example 20 ppm, 25 ppm, or 50 ppm. Those skilled in the art will understand from the embodiments that when the composition is used in cosmetics, the concentration of type 21 collagen in the cosmetic is preferably also above 2 ppm.

[0031] Those skilled in the art will know that in dilute solutions, when the solution density is close to 1 g / mL, 1 ppm ≈ 1 mg / L. In this invention, the density of each solution is close to 1 g / mL.

[0032] Another aspect of the present invention provides a composition for promoting the production of type I collagen, comprising the aforementioned red rice extract and the aforementioned type 21 collagen.

[0033] Another aspect of the present invention provides a cosmetic comprising a composition for preventing and / or improving skin aging, or the aforementioned composition for promoting type I collagen production.

[0034] In this invention, the term "cosmetics" can be used in the conventional sense, generally referring to products applied to human skin by smearing, spraying, applying alcohol, or other similar methods to achieve the purpose of cleansing, maintaining, beautifying, modifying, and altering appearance to maintain a good condition. In this invention, the dosage form of the cosmetics can be conventional in the art, including but not limited to creams, lotions, aerosols, liquids, or gels. The cosmetics of this invention can be makeup cosmetics, base cosmetics, skin care products, or sunscreen cosmetics. Further, the types of cosmetics include, but are not limited to, foundation, sunscreen, sunscreen lotion, sunscreen spray, hand cream, face cream, toner, makeup base, mask, or serum.

[0035] Positive effects: The composition of red rice extract and type 21 collagen in this invention has a synergistic effect on promoting the production of type I collagen, thereby significantly preventing and / or improving skin aging.

[0036] On the other hand, the composition provided by the present invention can be selectively used in the development of medical aesthetic product formulations, pharmaceutical product formulations, etc., according to actual conditions, and can be used for skin aging prevention / improvement, treatment and improvement of skin-related diseases, etc. Attached Figure Description

[0037] Figure 1 This is a comparison chart showing the detection results of type I collagen content in different concentrations of red rice extract solution and type 21 collagen solution in Example 1.

[0038] Figure 2 This is a comparison chart showing the detection results of type I collagen content in different proportions of red rice extract solution and type 21 collagen solution in Example 2.

[0039] Figure 3 This is a comparison chart showing the detection results of type I collagen content in different combinations of collagen solutions and red rice extract solutions in Example 3.

[0040] Figure 4This is a comparison chart showing the detection results of type I collagen content in different concentrations of type 3 collagen solution and red rice extract solution in Example 4.

[0041] Figure 5 This is a comparison chart showing the detection results of type I collagen content in the type 17 collagen solution and its combination with red rice extract solution in Example 5. Detailed Implementation

[0042] To make the technical means, inventive features, objectives, and effects of the invention readily understandable, the invention is further described below with reference to specific embodiments. However, the invention is not limited to the embodiments described below.

[0043] In this paper, the Bliss independent model and the Bürgi formula method are used to verify the synergistic effect between the compositions of the present invention.

[0044] The Bliss independent model method uses the incidence of drug-induced adverse events as the efficacy index, with the efficacy value ranging from 0 to 1. Taking drugs A and B as an example, the drug effects of drugs A and B are considered as independent events. Using the probability formula PAB = PA + PB - PA * PB, this formula is used to calculate the expected additive effect of combined drug use: EAB = EA + EB - EA * EB. The ratio of the actual efficacy value to the value calculated by this formula is called CI, and the calculation formula is as follows: CI>1 indicates synergy, CI=1 indicates addition, and CI<1 indicates antagonism.

[0045] The Bliss independent model method introduces the probability summation formula to obtain the efficacy values ​​(incidence rates) of drug A alone, drug B alone, and combination drug A+B from the experiment, and directly calculates the CI value according to the above formula.

[0046] The Bürgi formula, also known as the effect ratio method, is based on the principle that the sum of half the equivalent doses of two drugs should equal the original effect. A sum greater than the original effect indicates a synergistic effect, while a sum less than the original effect indicates an antagonistic effect. The formula for testing this effect is: If q>1, it is synergistic; if q=1, it is additive; if q<1, it is antagonistic. In the formula, a and b are two equivalent doses of drugs A and B, respectively, and E(a) = E(b).

[0047] The red rice bran plant powder in the following examples was sourced from Yunnan Yingge Biotechnology Co., Ltd.

[0048] In the following examples, the % in the 70% alcohol-water solution refers to the percentage of the mass of the corresponding alcohol to the total mass of the alcohol-water solution.

[0049] Example 1 Take a clean beaker and weigh 10g of the above-mentioned red rice bran plant powder. Grind the red rice bran plant powder to a D50 particle size of 20-100μm. Place the ground red rice bran plant powder in the beaker, add 50g of a 70% aqueous solution of butanediol, seal the beaker, and extract by stirring at 35-55℃ for 8-13 hours at a stirring speed of 150-200rpm. Centrifuge to separate the solid and liquid. Filter the supernatant through a 0.50μm filter membrane to obtain the plant extract, then concentrate under reduced pressure to one-third of its volume, filter through a 0.5μm filter membrane, and prepare the test solution with water (hereinafter referred to as the red rice extract solution, with a total solvent volume of 50g). In this example, the alcohol in the 50g 70% aqueous solution of butanediol can be replaced with alkyl monohydric alcohols and / or other alkyl dihydric alcohol solvents.

[0050] According to Method 2 of GB / T 8313-2008, the total polyphenol content of the obtained plant extract was 1.83 mg / mL.

[0051] The solid content of the plant extract was found to be 0.7% (w / w), meaning that 1 mL of the plant extract contained 7 mg of red rice extract, and the density of the plant extract was approximately 1 g / mL.

[0052] Example 1 I. Purpose of Testing and Reference Basis 1.1 Purpose of the test: This test is an assessment of the content of type I collagen.

[0053] After determining a suitable sample concentration, HFF-1 cells were inoculated onto plates for 24 hours, and the original cell culture medium was replaced with PBS. The cells were then irradiated with UVA (5 J / cm²). 2 After adding the test sample or control prepared with fresh complete culture medium, incubate for another 24 hours, collect the cell culture medium, and detect the extracellular secretion of type I collagen (Collagen I).

[0054] 1.2 Reference Basis: T / SHRH 031-2020 Cosmetic Firming and Anti-wrinkle Efficacy Test - In Vitro Fibroblast Type I Collagen Content Determination.

[0055] II. Sample Information Sample names: Red rice extract solution from Example 1 (solvent: butylene glycol and water = 7:3), and type 21 collagen solution.

[0056] The type 21 collagen solution was purchased from Hemei Biotechnology, and the type 21 collagen content ranged from 0.1% to 1.1% (w / w). The solvents were water, 1,2-hexanediol, and 1,3-propanediol. In this experiment, the type 21 collagen content in the sample was 1% (w / w). Based on a density of 1 g / mL, 1 mL of type 21 collagen solution contained 10 mg of type 21 collagen.

[0057] The amino acid sequence of type 21 collagen is shown in SEQ ID NO. 1 below. SEQ ID NO. 1 is: GKPGLQGPKGDPGLPGNPGYPGQPGQDGKPGYQGIAGTPGVPGSPGIQGARGLPGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGEKGNAGFPGL PGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSKGEPGIQGMPGASGLKGEPGATG.

[0058] III. Testing Information 3.1 Detection Principle Type I collagen is a major component of the extracellular matrix of dermal cells. It is synthesized intracellularly by dermal fibroblasts, secreted extracellularly, and then polymerized to form collagen fibers under the action of terminal procollagen peptidase, after the telopeptides separate. Human dermal fibroblasts can be used as a cell model to study the enhancement of type I collagen content in cosmetics. By measuring the upregulation rate of type I collagen content after administration of the test substance, compared with the blank control and the test substance, the efficacy of the test substance in promoting collagen synthesis can be evaluated. Type I collagen content is determined using an enzyme-linked immunosorbent assay (ELISA).

[0059] The specific principle is as follows: Type I collagen specifically binds to collagen antibodies coated on an ELISA plate, and then binds to anti-type I collagen antibodies labeled with a substrate. The substrate is catalyzed by the enzyme to generate a colored product. The content of type I collagen is positively correlated with the intensity of the color of the product. The optical density (OD value) is measured at a wavelength of 450 nm using an ELISA reader to calculate the type I collagen content.

[0060] 3.2 Test Environment All experiments were conducted in a clean, sterile cell culture room, and all reagents and consumables were sterile.

[0061] 3.3 Main Reagents and Consumables Cell culture medium (WINST, high glucose), high-quality fetal bovine serum (Gibco), phosphate-buffered saline (Basal Media, PBS), trypsin (Basal Media, Trypsin, 0.25%), cell culture flasks (Thermo, T25, T75), cell culture plates (Corning, 12-well plate, 96-well plate), pipettes (Thermo, 5mL, 15mL), centrifuge tubes (Corning, 15mL, 50mL), disposable cell counting chamber (Countstar), TGF-β1 (Novoprotein), Human Pro-collagen 1 α1 ELISA Kit (Yisheng Biotechnology).

[0062] 3.4 Instruments and Equipment Adjustable pipette (Eppendorf), analytical balance (BSA124S), inverted microscope, low-speed centrifuge (Likang), constant temperature incubator (Likang), electric pipette (Eppendorf), cell counter (Countstar), clean bench (Thermo), digital display constant temperature water bath (HH-6), liquid nitrogen tank, ordinary refrigerator, full-band microplate reader (MD).

[0063] 3.5 Cell lines The cell line used in this test was human foreskin fibroblast HFF-1 (provided by Fenghui Biotechnology), with cell passages from 7th to 9th.

[0064] 3.6 Detection of Type I Collagen Content (1) Cell seeding: dilute to 1×10 5 Inoculate at a seeding density of cells / mL, seed cells into 12-well plates with 1 mL / well of cell dilution, and incubate in a cell culture incubator (37℃, 5%CO2, 95%RH) for 24±2 h.

[0065] (2) Experimental groups: Control group, Model group, positive and sample group. Three replicate wells were set up for this test.

[0066] (3) Solution preparation 1) Samples: The red rice extract solution and type 21 collagen solution from Example 1 were prepared in 1 mL of culture medium (DMEM medium containing 10% FBS and 1% double antibiotics) to concentrations of 0.125%, 0.25%, 0.5%, and 1%. The red rice extract solution and type 21 collagen solution from Example 1 were combined to prepare four concentrations: 0.0625% + 0.0625% (v / v), 0.125% + 0.125% (v / v), 0.25% + 0.25% (v / v), and 0.5% + 0.5% (v / v). (v / v refers to the volume of the red rice extract solution or the volume of the type 21 collagen solution / the volume of the culture medium). 2) Positive control: TGF-β1 stock solution diluted to 100 ng / mL; 3) Type I collagen standards: At 4°C, remove 100 ng of each lyophilized standard powder and centrifuge at 10,000 rpm for 30 seconds. Dissolve each standard in 1 mL of sample diluent, and gently pipette 5-8 times to aid dissolution. Prepare standard S7 and set aside. Arrange seven 1.5 mL centrifuge tubes (S0-S6) sequentially, and add 250 μL of sample diluent to each. Transfer 250 μL of standard S7 to the first centrifuge tube (S6) and gently pipette to mix. Transfer 250 μL from S6 to the second EP tube (S5) and gently pipette to mix. Repeat this serial dilution process for the standards. S0 is the sample diluent.

[0067] (4) Induction of sample loading: When the cell confluence in the 12-well plate reaches more than 80%, add 5 J / cm². 2 After UVA induction, the plates were washed twice with PBS, and 1 mL of PBS was used for each group. The blank control group was not induced with UVA. After the samples were added, the 12-well plates were placed in an incubator (37℃, 5%CO2, 95%RH) and incubated for 24±2 h.

[0068] 5. Detection: Detect the standards using ELISA and plot a standard curve. Then, detect the COL I content in the supernatant of each group (e.g., ...). Figure 1 (As shown on the ordinate). Detection of Col I content in HFF-1 cells after UVA-induced senescence in samples of red rice extract solution and type 21 collagen solution is shown below. Figure 1 As shown.

[0069] The experiments in each group are as follows: Control group: Added with an equal amount of cell culture medium; Negative control group (Model): 5 J / cm 2 After UVA irradiation induction, an equal volume of cell culture medium was added; Positive control group: 5 J / cm 2After UVA irradiation induction, an equal volume of cell culture medium containing 100 ng / mL TGF-β1 was added; Sample group: 5J / cm 2 After UVA irradiation induction, cell culture medium containing the corresponding concentration of the sample was added; Compared with the blank control group, ###, P<0.001; Compared with the negative control group, **, P < 0.01, ***, P < 0.001; Mean ± SD, n = 3.

[0070] Based on the test results, the enhancement rate, CI value, and q value of the sample group are shown in Table 1 below.

[0071] Table 1 Based on the test results, the following conclusions can be drawn: (1) Compared with the blank control group, the Col I content in the negative control group was significantly reduced, proving that the model was successfully constructed; (2) Compared with the negative control group, the positive control group with 100 ng / mL TGF-β1 significantly increased the Col I content, further proving that the model was successfully constructed; (3) Compared with the negative control group, red rice extract solutions and type 21 collagen solutions at concentrations of 0.125%, 0.25%, 0.5%, and 1% significantly increased Col I content, with increases of 17.83%, 18.87%, 46.07%, and 87.08%, and 34.62%, 47.70%, 49.78%, and 70.28%, respectively. The combination of red rice extract solutions at concentrations of 0.0625% + 0.0625%, 0.125% + 0.125%, 0.25% + 0.25%, and 0.5% + 0.5% with type 21 collagen solution significantly increased Col I content, with increases of 30.02%, 43.54%, 105.65%, and 138.79%, respectively. (4) According to the Bliss independent model, the CI values ​​of the two concentrations of 0.25% red rice extract solution + 0.25% type 21 collagen solution and 0.5% red rice extract solution + 0.5% type 21 collagen solution were 1.449 and 1.443, respectively, both greater than 1, indicating a synergistic effect.

[0072] (5) According to the Bürgi formula, the q-value of the compound group of 0.25% red rice extract solution + 0.25% type 21 collagen solution with 0.5% red rice extract solution is 2.293, and the q-value with 0.5% type 21 collagen solution is 2.122; the q-value of the compound group of 0.5% red rice extract solution + 0.5% type 21 collagen solution with 1% red rice extract solution is 1.594, and the q-value with 1% type 21 collagen solution is 1.975; the q-values ​​of the compound groups of red rice extract solution + type 21 collagen solution are both greater than 1, indicating a synergistic effect.

[0073] Based on the above in vitro cell experiment results, the following conclusions can be drawn under the experimental conditions of this study: Red rice extract solutions at concentrations of 0.125%, 0.25%, 0.5%, and 1%, type 21 collagen solutions, and their combinations significantly upregulated the secretion of type 1 collagen. Furthermore, the combinations of 0.25% red rice extract solution + 0.25% type 21 collagen solution and 0.5% red rice extract solution + 0.5% type 21 collagen solution exhibited synergistic effects.

[0074] Example 2 (Study on Optimal Compound Concentration) The following experimental groups were tested according to the method in Example 1: Control group: Added with an equal amount of cell culture medium; Negative control group (Model): 5 J / cm 2 After UVA irradiation induction, an equal volume of cell culture medium was added; Positive control group: 5 J / cm 2 After UVA irradiation induction, an equal volume of cell culture medium containing 100 ng / mL TGF-β1 was added; Sample group: 5J / cm 2 After UVA irradiation induction, cell culture medium containing the corresponding concentration of the sample was added.

[0075] The sample groups were 0.25% red rice extract solution + 0.25% type 21 collagen solution, 0.4% red rice extract solution + 0.1% type 21 collagen solution, 0.45% red rice extract solution + 0.05% type 21 collagen solution, 0.05% red rice extract solution + 0.45% type 21 collagen solution, and 0.1% red rice extract solution + 0.4% type 21 collagen solution.

[0076] The test results are as follows: Figure 2 As shown. According to Figure 2It can be seen that, under the HFF-1 cell UVA-induced model, the combination ratio of 0.25% red rice extract solution + 0.25% type 21 collagen solution in this test concentration was superior to other combinations. Based on the test results, the increase rate of Col I content in each sample group relative to the negative control group was calculated, and the results are shown in Table 2 below.

[0077] Table 2 In Table 2, some groups used the same test samples as in Example 1. The differences in the test results are due to experimental errors, which may be caused by inconsistencies in the sensitivity of cells from different batches. This does not affect the comparison results between the experimental groups.

[0078] Example 3 (Study on the combination of different collagen proteins) The following experimental groups were tested according to the method in Example 1: Control group: Added with an equal amount of cell culture medium; Negative control group (Model): 5 J / cm 2 After UVA irradiation induction, an equal volume of cell culture medium was added; Positive control group: 5 J / cm 2 After UVA irradiation induction, an equal volume of cell culture medium containing 100 ng / mL TGF-β1 was added; Sample group: 5J / cm 2 After UVA irradiation induction, cell culture medium containing the corresponding concentration of the sample was added.

[0079] The sample groups were 0.25% red rice extract solution + 0.25% type 21 collagen solution, 0.25% red rice extract solution + 0.25% type 3 collagen solution, and 0.25% red rice extract solution + 0.25% type 17 collagen solution, respectively.

[0080] The test results are as follows: Figure 3 As shown. The type 3 collagen (molecular weight 24000 Da) and type 17 collagen (molecular weight 20000 Da) selected in this effect example are two collagens with similar molecular weights and high homology to the type 21 collagen in effect example 1. According to... Figure 3 It can be seen that, under the HFF-1 cell UVA-induced model, red rice extract solution + type 21 collagen solution is superior to other collagen combinations.

[0081] Example 4 (Study on the compounding of type 3 collagen) The following experimental groups were tested according to the method in Example 1: Control group: Added with an equal amount of cell culture medium; Negative control group (Model): 5 J / cm 2 After UVA irradiation induction, an equal volume of cell culture medium was added; Positive control group: 5 J / cm 2 After UVA irradiation induction, an equal volume of cell culture medium containing 100 ng / mL TGF-β1 was added; Sample group: 5J / cm 2 After UVA irradiation induction, cell culture medium containing the corresponding concentration of the sample was added.

[0082] The sample groups were 0.5% red rice extract solution, 0.5% type 3 collagen solution, 0.25% red rice extract solution + 0.25% type 3 collagen solution, 0.4% red rice extract solution + 0.1% type 3 collagen solution, and 0.45% red rice extract solution + 0.05% type 3 collagen solution, respectively.

[0083] The test results are as follows: Figure 4 As shown in Table 3, the experimental results in Table 3 indicate that the combination of red rice extract and type 3 collagen had no synergistic effect in the HFF-1 cell UVA-induced model.

[0084] Table 3 Example 5 (Study on the compounding of type 17 collagen) The following experimental groups were tested according to the method in Example 1: Control group: Added with an equal amount of cell culture medium; Negative control group (Model): 5 J / cm 2 After UVA irradiation induction, an equal volume of cell culture medium was added; Positive control group: 5 J / cm 2 After UVA irradiation induction, an equal volume of cell culture medium containing 100 ng / mL TGF-β1 was added; Sample group: 5J / cm 2 After UVA irradiation induction, cell culture medium containing the corresponding concentration of the sample was added.

[0085] The sample groups were 0.5% red rice extract solution, 0.5% type 17 collagen solution, and 0.25% red rice extract solution + 0.25% type 17 collagen solution, respectively.

[0086] The test results are as follows: Figure 5As shown in Table 4, the experimental results in Table 4 indicate that the combination of red rice extract and type 17 collagen had no synergistic effect in the HFF-1 cell UVA-induced model.

[0087] Table 4 The preferred embodiments of the present invention have been described in detail above. It should be understood that those skilled in the art can make numerous modifications and variations based on the concept of the present invention without creative effort. Therefore, all technical solutions that can be obtained by those skilled in the art based on the concept of the present invention through logical analysis, reasoning, or limited experimentation on the basis of existing technology should be within the scope of protection defined by the claims.

Claims

1. A composition for preventing and / or improving skin aging, characterized by comprising, It comprises red rice extract and collagen type 21.

2. The composition for preventing and / or improving skin aging according to claim 1, wherein The red rice extract comprises phenolic compounds; The phenolic compounds comprise polyphenolic compounds and phenolic acid compounds; The polyphenolic compounds comprise anthocyanins and / or proanthocyanidins; the polyphenolic compounds account for more than 6% of the total mass of the red rice extract, for example 10%, 20%, 26.1%, 30%, 40%, 45% or 50%.

3. The composition for preventing and / or improving skin aging according to claim 1, wherein The preparation method of the red rice extract comprises the following steps: after red rice is extracted with an aqueous alcohol solution, the supernatant is collected by solid-liquid separation; and the substance obtained after removing the solvent from the supernatant is the red rice extract.

4. The composition for preventing and / or improving skin aging according to claim 3, wherein The alcohol is an alkyl dihydric alcohol; And / or, the mass ratio of the red rice to the aqueous alcohol solution is 1:(4-19); And / or, the mass concentration of the alcohol in the aqueous alcohol solution is 30-80%; And / or, the solid-liquid separation is centrifugation; And / or, in the supernatant, the mass content of the red rice extract is more than 0.5%.

5. The composition for preventing and / or improving skin aging according to claim 4, wherein The alkyl dihydric alcohol is butanediol and / or 1,2-propanediol; And / or, the mass ratio of the red rice to the aqueous alcohol solution is 1:5; And / or, the mass concentration of the alcohol in the aqueous alcohol solution is 40%, 50%, 60% or 70%; And / or, in the supernatant, the mass content of the red rice extract is 0.5-1%, for example 0.7%.

6. The composition for preventing and / or improving skin aging according to any one of claims 1 to 5, wherein In the composition, the mass ratio of the red rice extract to the collagen type 21 is 1:(0.1-2), for example 1:0.400, 1:0.420, 1:0.500, 1:0.600, 1:0.700, 1:0.714, 1:0.800, 1:0.900, 1:1.420 or 1:1.500; And / or, the composition further comprises a solvent, which comprises one or more of water, an alkyl dihydric alcohol and an alkyl monohydric alcohol; the alkyl monohydric alcohol is preferably ethanol; and the alkyl dihydric alcohol preferably comprises one or more of 1,2-propanediol, 1,3-propanediol, butanediol and 1,2-hexanediol.

7. The composition for preventing and / or improving skin aging according to claim 6, wherein In the composition, the concentration of the red rice extract is more than 10 ppm; And / or, in the composition, the concentration of the collagen type 21 is more than 2 ppm.

8. The composition for preventing and / or improving skin aging according to claim 6, wherein In the composition, the concentration of the red rice extract is 10-50 ppm, for example 17.5 ppm or 35 ppm; And / or, in the composition, the concentration of the collagen type 21 is 2-55 ppm, for example 25 ppm or 50 ppm.

9. A composition for promoting production of collagen type I, characterized by, It comprises the red rice extract according to any one of claims 1-8 and the collagen type 21 according to any one of claims 1-8.

10. A cosmetic product, characterized by, It comprises the composition for preventing and / or improving skin aging according to any one of claims 1-8 or the composition for promoting the production of collagen type I according to claim 9; The cosmetic product comprises a makeup cosmetic product, a base cosmetic product, a skin care product or a sunscreen cosmetic product.