Populus euphratica pebch1 gene, recombinant vector and application of encoded protein in salt tolerance of poplar and the recombinant vector
By overexpressing the PeBCH1 gene in poplar trees and using a recombinant vector to improve the salt tolerance of poplar trees, the problem of lack of effective gene resources in existing technologies was solved, and the growth and antioxidant capacity of poplar trees under salt stress were enhanced.
Patent Information
- Application Number
- CN202610958134.7
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- Filing Date
- 2026-06-30
- Publication Date
- 2026-08-25
AI Technical Summary
Current technologies lack gene resources that can effectively improve the salt tolerance of poplar trees, making it difficult to verify the biological function of the PeBCH1 gene in poplar trees and its role in regulating the salt tolerance of poplar trees.
We provided the PeBCH1 gene, recombinant vector, and its encoded protein from Populus euphratica, and verified its function in the salt stress response process of Populus euphratica through stable genetic transformation experiments. Overexpression of the PeBCH1 gene from Populus euphratica was used to improve the salt tolerance of Populus euphratica.
Overexpression of the PeBCH1 gene in Populus euphratica can improve the salt tolerance of poplar, enhance its water retention and growth maintenance capabilities under salt stress, reduce leaf yellowing and root growth inhibition, reduce cell membrane damage, and improve reactive oxygen species scavenging capacity.
Smart Images
Figure CN122629092A_ABST
Abstract
Description
Technical Field
[0001] This invention relates to the technical field of poplar plant genetic engineering and stress-resistance molecular breeding, specifically to the application of the Populus euphratica PeBCH1 gene, recombinant vector, and its encoded protein in the salt tolerance of poplar and the recombinant vector. Background Technology
[0002] Poplar is a fast-growing timber species and an ecological protection species. However, severe soil salinization in many areas causes osmotic stress, ion toxicity, oxidative damage, and damage to the photosynthetic system, resulting in leaf yellowing, cell membrane damage, decreased photosynthetic efficiency, and reduced biomass, thus limiting the growth and development of poplar in saline-alkali areas. Therefore, identifying salt-tolerant genes in poplar and conducting molecular breeding is of significant application value for improving the salt tolerance of poplar.
[0003] Populus euphratica, commonly found in deserts, is cold-resistant, drought-resistant, salt-tolerant, and wind-resistant, exhibiting strong vitality. It is a unique and valuable forest resource in arid regions and a typical salt-tolerant woody plant, thus becoming an important material for screening salt-tolerant gene resources in forest trees. The BCH gene encodes β-carotene hydroxylase, a key enzyme in the carotenoid biosynthesis pathway. Previous studies have shown that the BCH gene participates in plant responses to stresses such as salt, drought, and oxidative stress. However, the biological function of the PeBCH1 gene in Populus euphratica and its role in regulating salt tolerance in poplar have not been reported. Existing studies mainly verify the function of the BCH gene through heterologous expression in model plants such as Arabidopsis thaliana and tobacco. However, woody and herbaceous plants differ in their growth and development characteristics and stress response mechanisms; therefore, the above research results cannot directly reflect the biological role of PeBCH1 in poplar. Given the extremely strong salt tolerance of Populus euphratica, whether PeBCH1 can serve as an effective gene resource for improving the salt tolerance of poplar, and its mechanism of action in regulating salt tolerance in poplar, still require further investigation. Summary of the Invention
[0004] Therefore, the purpose of this invention is to provide the application of the Populus euphratica PeBCH1 gene, recombinant vector and its encoded protein in the salt tolerance of poplar trees, and to solve the problem of lack of gene resources that can effectively improve the salt tolerance of poplar trees in the prior art, so as to provide new gene resources and technical means for the molecular breeding of salt-tolerant poplar varieties.
[0005] To solve the above-mentioned technical problems, the present invention provides the following technical solution:
[0006] The application of the Populus euphratica PeBCH1 gene, recombinant vector, and PeBCH1 protein in the salt tolerance of poplar trees is disclosed. The nucleotide sequence of the Populus euphratica PeBCH1 gene is shown in SEQ ID NO.1, the recombinant vector contains the nucleotide sequence shown in SEQ ID NO.1, and the Populus euphratica PeBCH1 protein is encoded by the nucleotide sequence shown in SEQ ID NO.1.
[0007] This invention, through 84K Poplar genetic transformation experiments, verified that the PeBCH1 gene in Populus euphratica participates in the poplar's response to salt stress and has the function of regulating the poplar's salt stress response. Since the recombinant vector contains the Populus euphratica PeBCH1 gene, and the PeBCH1 protein is encoded by this gene, both the recombinant vector containing this gene and its encoded PeBCH1 protein can be used to improve the salt tolerance of poplar. This lays the foundation for studying the poplar's response mechanism to salt stress and also provides a theoretical basis for breeding salt-tolerant poplar varieties.
[0008] Preferably, the amino acid sequence of the Populus euphratica PeBCH1 protein is shown in SEQ ID NO.2.
[0009] Preferably, overexpression of the PeBCH1 gene in Populus euphratica can improve the salt tolerance of poplar. Stable genetic transformation with 84K Populus euphratica and salt stress treatment further clarified the specific function of the PeBCH1 gene in Populus euphratica under salt stress, and also clarified the positive regulation of salt tolerance by the PeBCH1 gene in Populus euphratica.
[0010] Preferably, overexpression of the PeBCH1 gene in Populus euphratica can increase the relative water content and biomass of poplar under salt stress, and reduce leaf yellowing and root growth inhibition. Overexpression of the PeBCH1 gene in Populus euphratica exhibits good water retention and growth maintenance capabilities under high salt conditions; therefore, overexpression of this gene can improve the salt tolerance of poplar.
[0011] Preferably, overexpression of the PeBCH1 gene in Populus euphratica can reduce cell membrane damage in poplar trees under salt stress. Overexpression of the PeBCH1 gene in Populus euphratica improves the salt tolerance of poplar trees by reducing cell membrane damage under salt stress. Reducing cell membrane damage in poplar trees under salt stress refers to reducing their electrolyte leakage rate.
[0012] Preferably, overexpression of the PeBCH1 gene in Populus euphratica can enhance the reactive oxygen species (ROS) scavenging capacity of poplar under salt stress. Overexpression of the PeBCH1 gene in Populus euphratica can increase the activity of antioxidant enzymes in poplar under salt stress and reduce the accumulation of oxidative damage-related substances in poplar under salt stress, thereby enhancing the ROS scavenging capacity of poplar and thus improving its salt tolerance.
[0013] Preferably, the poplar is 84K poplar or Populus euphratica.
[0014] The second technical solution of the present invention is:
[0015] The application of the Populus euphratica PeBCH1 gene, recombinant vector, and PeBCH1 protein in the breeding of salt-tolerant poplar varieties, wherein the nucleotide sequence of the Populus euphratica PeBCH1 gene is shown in SEQ ID NO.1, the recombinant vector contains the nucleotide sequence shown in SEQ ID NO.1, and the Populus euphratica PeBCH1 protein is encoded by the nucleotide sequence shown in SEQ ID NO.1.
[0016] This invention demonstrates through stable genetic transformation experiments that overexpression of the PeBCH1 gene in Populus euphratica can improve the salt tolerance of poplar trees. Therefore, new salt-tolerant poplar varieties can be bred by overexpressing the PeBCH1 gene in Populus euphratica, thereby improving the salt tolerance of poplar trees.
[0017] The third technical solution of the present invention is:
[0018] A recombinant vector containing a nucleotide sequence as shown in SEQ ID NO.1.
[0019] Preferably, the empty expression vector in the recombinant vector is either pBI121 or pBI121-GFP. Other binary expression vectors suitable for poplar genetic transformation may also be used. Attached Figure Description
[0020] Figure 1 The above are the CDS amplification results of Populus euphratica PeBCH1 in this embodiment of the invention; where M is DL2000 DNA marker;
[0021] Figure 2 This invention presents the phenotypic characteristics of Populus euphratica plants under 300mM NaCl treatment and the expression of PeBCH1 in different organs of Populus euphratica; where (a) is the phenotypic characteristics and (b) is the expression pattern of PeBCH1 in the roots, stems and leaves of Populus euphratica.
[0022] Figure 3 This is a flowchart of the genetic transformation process of Populus euphratica overexpressing PeBCH1 in an embodiment of the present invention; wherein, (a) is co-culture, (b) is induction of adventitious buds, (c) is induction of adventitious roots, and (d) is genetically transformed regenerated plants;
[0023] Figure 4 This is a PCR positive identification of transgenic poplar trees overexpressing PeBCH1 in the embodiments of the present invention; wherein, P represents the positive control (pBI121-PeBCH1 plasmid), D represents the negative control (ddH2O), and the numbers 2-40 represent different transgenic lines;
[0024] Figure 5This invention provides an analysis of the expression levels of PeBCH1 overexpression in various lines of the transgenic 84K poplar in the embodiments of the present invention.
[0025] Figure 6 This invention provides an analysis of the phenotype and physiological parameters of Populus euphratica PeBCH1 overexpressing lines under salt stress. (a) represents the phenotype, and (b) represents biomass, relative water content, and electrolyte leakage rate. Data are expressed as mean ± standard deviation, with at least three independent biological replicates. One-way ANOVA was used to assess statistical significance (*, p < 0.05; **, p < 0.01).
[0026] Figure 7 This invention provides an analysis of the antioxidant enzyme activity and oxidative stress indices of Populus euphratica PeBCH1 overexpression lines after salt stress; wherein, (a) represents SOD activity, (b) represents POD activity, (c) represents CAT activity, (d) represents MDA content, (e) represents H2O2 content, and (f) represents O2 content. 2- Content; data are expressed as mean ± standard deviation, with at least three independent biological replicates, and significance was assessed using one-way ANOVA (*, p < 0.05; **, p < 0.01). Detailed Implementation
[0027] The technical solution of the present invention will be further described below with reference to specific embodiments.
[0028] Example
[0029] In this embodiment, to verify the function of the Populus euphratica PeBCH1 gene, recombinant vector, and its encoded protein under salt stress, the following steps were used in the experiment:
[0030] I. Bioinformatics Analysis of the PeBCH1 Gene and its Encoded Protein in Populus euphratica
[0031] Leaves from healthy Populus euphratica tissue culture seedlings were collected, and total RNA was extracted using the RNAprep Pure Plant Plus Kit (DP441, Tiangen Biotech (Beijing) Co., Ltd.). Reverse transcription was then performed using a reverse transcription kit (6210A, Baori Biotechnology (Beijing) Co., Ltd.) to obtain first-strand cDNA. Using the Populus euphratica cDNA as a template, the target fragment was amplified using PeBCH1-specific primers (PeBCH1-F (SEQ ID NO.3): 5'-ATGGCGTCAGGAATCACCGC-3', PeBCH1-R (SEQ ID NO.4): 5'-TCATAACCCCTTGGATGATTTGGTT-3'), yielding a CDS fragment of approximately 930 bp. The results are shown below. Figure 1As shown in the figure. Sequencing results showed that the PeBCH1 CDS is 930 bp in length, and its nucleotide sequence is shown in SEQ ID NO.1; this open reading frame starts with ATG and ends with TGA, encoding 309 amino acids, and the amino acid sequence is shown in SEQ ID NO.2. Bioinformatics analysis indicated that the PeBCH1-encoded protein belongs to the β-carotene hydroxylase-related protein family, contains related conserved domains, and has transmembrane structural features.
[0032] II. Analysis of the expression pattern of the PeBCH1 gene in Populus euphratica
[0033] One-month-old, uniformly growing Populus euphratica tissue culture seedlings were used as material. They were transplanted into Hoagland nutrient solution for pretreatment for 3 days, followed by salt stress treatment with a final concentration of 300 mM NaCl. Root, stem, and leaf samples were collected at 0 h, 12 h, 24 h, and 48 h, with three biological replicates for each treatment. RNA was extracted using an RNA kit. cDNA for RT-qPCR analysis was synthesized using PrimeScript™ RT Master Mix (RR036A, Baori Biotechnology (Beijing) Co., Ltd.). The reverse transcription program was 37℃ for 15 min and 85℃ for 5 s. The resulting cDNA was diluted 6-8 times and used as a template.
[0034] RT-qPCR was performed using the SYBR® Premix Ex Taq™ Kit (RR820A, Baori Biotechnology (Beijing) Co., Ltd.). Actin gene was used as an internal control (Peactin-F (SEQ ID NO.5): 5'-ACTACCCTCCAATCCAGACACTG -3', Peactin-R (SEQ ID NO.6): 5'-TTGCTGACCGTATGAGCAAG -3'). Preferred primers for PeBCH1 detection were PeBCH1-RT-F (SEQ ID NO.7): 5'-CGCATCTCGAGAATCAACAA -3', PeBCH1-RT-R (SEQ ID NO.8): 5'-ACCAAACATTTCAGGCCAAG -3'. Melting curves were analyzed after the reaction. Three technical replicates were performed for each sample, and 2... -ΔΔ The relative expression level was calculated using the CT method. Figure 2 The results showed that the PeBCH1 gene was induced to be expressed in roots, stems and leaves after salt stress, indicating that the gene is involved in the salt stress response of Populus euphratica.
[0035] III. Obtaining the PeBCH1 transgenic material of Populus euphratica
[0036] (1) Construction of overexpression vector
[0037] Using the correctly sequenced PeBCH1 CDS from Part 1 as a template, primers containing homologous arms or restriction enzyme sites were redesigned to amplify the target fragment (pBI121-PeBCH1-F (SEQ ID NO. 9): 5'- aacacgggggactctagaATGGCGTCAGGAATCACCGC -3', pBI121-PeBCH1-R (SEQ ID NO. 10): 5'- cttgctcaccatggtaccTAACCCCTTGGATGATTTGGTT -3'). The amplified product was then homologously recombinated with the linearized plant overexpression vector pBI121-GFP to construct the pBI121-PeBCH1-GFP overexpression vector. The recombination reaction was performed using 2×Ezmax® Universal Clone Mix (24305, Tulugang Biotechnology) at 37℃ for 15-30 min. The recombinant product was transformed into *E. coli* DH5α competent cells. After confirmation by bacterial culture PCR and sequencing, the plasmid was extracted. Then, pBI121-PeBCH1-GFP was transformed into *Agrobacterium* GV3101 competent cells. After screening on LB agar plates containing Kan and Rif antibiotics, single clones were selected for colony PCR identification to obtain positive *Agrobacterium* strains, which were then used for 84K *Populus* genetic transformation.
[0038] (2) Genetic transformation
[0039] Aseptic tissue culture seedlings of Populus euphratica, approximately 30 days old, with robust growth and fully expanded leaves, were selected as genetic transformation materials. Aseptic leaves were cut into appropriately sized leaf discs, pre-cultured, and then placed in Agrobacterium GV3101 bacterial suspension containing the pBI121-PeBCH1-GFP recombinant vector for infection. The Agrobacterium suspension was cultured to OD... 600 After approximately 0.6-0.8 μL of culture time, the bacterial cells were collected by centrifugation and resuspended in a infection solution containing acetylsyringone. Excess bacterial solution was aspirated from the leaf discs after infection, and the discs were placed in a co-culture medium and cultured in the dark for 2-3 days. Subsequently, the discs were transferred to a selection and differentiation medium containing the appropriate antibiotic to induce the formation of resistant adventitious shoots. When the adventitious shoots reached approximately 1-2 cm in length, they were cut off and transferred to a rooting medium to obtain resistant regenerated plants (genetic transformation flowchart shown below). Figure 3 (As shown).
[0040] Genomic DNA was extracted from the regenerated plants, and PCR identification was performed using the DNA as a template (the detection primers were consistent with the PeBCH1-specific primers used in the first part of the gene cloning). The results are as follows. Figure 4 As shown in the figure, the positive transgenic line can amplify a PeBCH1 target band of approximately 930 bp, while the wild-type material and the negative control do not show the corresponding band.
[0041] RNA was further extracted from leaves of positive lines, and after reverse transcription, the expression level of PeBCH1 was detected by qRT-PCR. The detection primers used were the same as those used in the second part of the qRT-PCR detection. The results are as follows. Figure 5 As shown, positive lines with high expression levels and consistent growth status were screened for propagation and used to evaluate salt stress tolerance.
[0042] IV. Application of the PeBCH1 gene in Populus euphratica under salt stress
[0043] One-month-old poplar seedlings with uniform growth were selected, and the roots were washed clean of agar and placed in 1 / 2 Hoagland nutrient solution. Under normal conditions, they were cultured in a 25℃ incubator for 30 days; under hydroponic conditions, the nutrient solution was changed every 7 days. Transgenic and wild-type poplars under hydroponic conditions were subjected to salt stress treatment, using 1 / 2 Hoagland nutrient solution containing 100 mM NaCl for 14 days. Phenotypic analysis was performed on transgenic and wild-type poplars, and biomass and physiological indicators related to salt stress resistance were measured.
[0044] The relevant experimental methods are as follows:
[0045] The biomass determination method is as follows: After the salt treatment, take complete plants of each line, absorb the surface moisture, and weigh the fresh weight as the biomass index.
[0046] The relative moisture content is determined as follows: collect functional leaves and weigh their fresh weight FW, fully absorb water until saturated and weigh them saturated weight TW, then dry them to constant weight and weigh them dry weight DW. The relative moisture content (%) is calculated as (FW-DW) / (TW-DW)×100%.
[0047] The method for determining electrolyte leakage rate is as follows: Take an equal amount of leaves, rinse them with deionized water, immerse them in deionized water, measure the initial conductivity C1, and then measure the total conductivity C2 after boiling and cooling. The electrolyte leakage rate (%) is calculated as C1 / C2×100%.
[0048] SOD, POD, CAT activities, and MDA content were determined using conventional spectrophotometry. MDA was measured using the TCA / TBA method, SOD using the NBT photoreduction method, POD using the guaiacol method, and CAT using the hydrogen peroxide decomposition rate method. H2O2 and O2- content were determined using hydrogen peroxide and superoxide anion assay kits, respectively. All kits were purchased from Suzhou Mengxi Biomedical Technology Co., Ltd. At least three biological replicates were performed for all indicators.
[0049] Figure 6 The phenotypic and physiological indicators of plants under salt stress were presented, including those from... Figure 6(a) It can be seen that after salt stress, wild-type 84K poplar plants showed obvious leaf yellowing, wilting, and growth inhibition, with some leaves suffering severe chlorosis and root development being inhibited; while the PeBCH1 overexpressing poplar plants showed less leaf yellowing, better overall plant growth, and maintained strong root growth capacity. Figure 6 (b) It can be seen that, compared with the wild type, the biomass and relative water content of the PeBCH1 overexpressing line of Populus euphratica increased significantly after salt stress, indicating that it has better water retention and growth maintenance capabilities under high salinity.
[0050] Electrolyte leakage rate is used to reflect cell membrane integrity under salt stress. From... Figure 6 (b) It can be seen that after salt treatment, the electrolyte leakage rate of wild-type 84K poplar increased significantly, while the electrolyte leakage rate of the PeBCH1 overexpressing line of Populus euphratica was significantly lower than that of wild-type, indicating that PeBCH1 overexpression can alleviate cell membrane damage caused by salt stress.
[0051] To further determine the function of PeBCH1 in Populus euphratica under salt stress, this embodiment also measured antioxidant-related indicators, and the results are as follows: Figure 7 As shown. Figure 7 As shown in (a)-(c), the PeBCH1 overexpression lines exhibited significantly higher antioxidant enzyme activity compared to the wild-type under salt stress. Figure 7 (d)-(f) show that the PeBCH1 overexpression lines had significantly lower accumulation of oxidative damage-related substances under salt stress compared to wild-type lines, indicating that this gene can improve the salt tolerance of poplar by enhancing the ability to scavenge reactive oxygen species.
[0052] In summary, the Populus euphratica PeBCH1 gene of this invention has the function of improving the salt tolerance of poplar trees. Since the recombinant vector contains the Populus euphratica PeBCH1 gene, and the PeBCH1 protein is encoded by this gene, both the recombinant vector containing the Populus euphratica PeBCH1 gene and its encoded PeBCH1 protein can be used to improve the salt tolerance of poplar trees.
[0053] The sequences of the Populus euphratica PeBCH1 gene and its encoded PeBCH1 protein mentioned above are as follows:
[0054] The nucleotide sequence (SEQ ID NO.1) of the PeBCH1 gene in Populus euphratica is as follows:
[0055] ATGGCGTCAGGAATCACCGCTGCCACCGTATCCAAACCCTCCGGGTGCATCTTCACCTCTCATCTCCTTCAAAAACCAATAATAACAACCTCGCTTTCCCTTCCTTTTATTCGACACCAAAACCTTCTACACTATGGATTCAAAGTTCCAAGAAAAACAAGCTTCGCTGTTTGTTTTGTTGTTGAAGATCAAACGAAACCAATTAGTGCGCATCTCGAGAATCAACAAGAAGAAGAGCCTAAAGATGTTAACAAGAACCAGATCTTGACGCCTCGCGTGGCTGAAAGATTGGCACGAAAGCAAAGAGAAAGAGATACTTATTTGATTGCAGCTGTTATGTCTAGTTTGGGGATTACTTCCACGGCCGTCTTGGCTGTTTATTATAGGTTTTATTGGCTTGAGGGAGGGAAAGCGTCTTGGCCTGAAATGTTTGGTACATTTGCTCTTTCAGTGGGTGCTGCTGTGGGGATGGAATTTTGGGCAAGATGGGCTCATAAAGAACTTTGGCATGCTTCTTTGTGGAACATGCATGAGTCTCACCATAGACCAAGAGATGGGCCATTTGAGCTAAACGATGTATTTGCCATTATCAATGCAGTCCCGGCAATTTCCCTTGCCGCTTATGGTTTCTTTAACAAGGGCCTTGTACCTGGTCTTTGTTTCGGTGCCGGTCTTGGAATTACAGTTTTTGGCATGGCCTATATGTTTGTCCATGATGGTCTTGTTCACAAGAGATTTCCAGTAGGGCCCATTGCAGACGTCCCATATTTCACCAGGGTAGCAGCAGCTCACCAGATCCACCACTCAGACAAATTCAATGGCGTCCCATATGGGTTGTTTCTAGGGCATAAGGAAATTGAGGCAGTTGGAGGCCAGGAAGAATTGGAAAGGGAGATCAATAGGAGAACCAAATCATCCAAGGGGTTATGA
[0056] The amino acid sequence of Populus euphratica PeBCH1 protein (SEQ ID NO.2) is as follows:
[0057] MASGITAATVSKPSGCIFTSHLLQKPIITTSLSLPFIRHQNLLHYGFKVPRKTSFAVCFVVEDQTKPISAHLENQQEEEPKDVNKNQILTPRVAERLARKQRERDTYLIAAVMSSLGITSTAVLAVYYRFYWLEGGKASWPEMFGTFALSVGAA VGMEFWARWAHKELWHASLWNMHESHHRPRDGPFELNDVFAIINAVPAISLAAYGFFNKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFTRVAAAHQIHHSDKFNGVPYGLFLGHKEIEAVGGQEELEREINRRTKSSKGL
[0058] Obviously, the above embodiments are merely illustrative examples for clear explanation and are not intended to limit the implementation. Those skilled in the art will recognize that other variations or modifications can be made based on the above description. It is neither necessary nor possible to exhaustively list all possible implementations here. However, obvious variations or modifications derived therefrom are still within the scope of protection of the claims of this patent application.
Claims
1. An application of the PeBCH1 gene, recombinant vector, and PeBCH1 protein in the salt tolerance of poplar trees, characterized in that, The nucleotide sequence of the Populus euphratica PeBCH1 gene is shown in SEQ ID NO.1, the recombinant vector contains the nucleotide sequence shown in SEQ ID NO.1, and the Populus euphratica PeBCH1 protein is encoded by the nucleotide sequence shown in SEQ ID NO.
1.
2. The application of the Populus euphratica PeBCH1 gene, recombinant vector, and PeBCH1 protein in the salt tolerance of poplar trees according to claim 1, characterized in that, The amino acid sequence of the Populus euphratica PeBCH1 protein is shown in SEQ ID NO.
2.
3. The application of the Populus euphratica PeBCH1 gene, recombinant vector, and PeBCH1 protein in the salt tolerance of poplar trees according to claim 1, characterized in that, Overexpression of the PeBCH1 gene in Populus euphratica can improve the salt tolerance of the poplar.
4. The application of the Populus euphratica PeBCH1 gene, recombinant vector, and PeBCH1 protein in the salt tolerance of poplar trees according to claim 3, characterized in that, Overexpression of the PeBCH1 gene in Populus euphratica can increase the relative water content and biomass of poplar under salt stress, and reduce leaf yellowing and root growth inhibition.
5. The application of the Populus euphratica PeBCH1 gene, recombinant vector, and PeBCH1 protein in the salt tolerance of poplar trees according to claim 3, characterized in that, Overexpression of the PeBCH1 gene in Populus euphratica can reduce cell membrane damage in poplar trees under salt stress.
6. The application of the Populus euphratica PeBCH1 gene, recombinant vector, and PeBCH1 protein in the salt tolerance of poplar trees according to claim 3, characterized in that, Overexpression of the PeBCH1 gene in Populus euphratica can enhance the reactive oxygen species scavenging capacity of poplar trees under salt stress.
7. The application of the Populus euphratica PeBCH1 gene, recombinant vector, and PeBCH1 protein in the salt tolerance of poplar trees according to any one of claims 1-6, characterized in that, The poplar tree in question is either 84K poplar or Populus euphratica.
8. The application of the PeBCH1 gene, recombinant vector, and PeBCH1 protein of Populus euphratica in the breeding of salt-tolerant poplar varieties, characterized in that, The nucleotide sequence of the Populus euphratica PeBCH1 gene is shown in SEQ ID NO.1, the recombinant vector contains the nucleotide sequence shown in SEQ ID NO.1, and the Populus euphratica PeBCH1 protein is encoded by the nucleotide sequence shown in SEQ ID NO.
1.
9. A recombinant vector, characterized in that, The recombinant vector contains a nucleotide sequence as shown in SEQ ID NO.
1.
10. The recombinant vector according to claim 9, characterized in that, The empty expression vector in the recombinant vector is either pBI121 or pBI121-GFP.