Liquid preparation device for recombinant XVII type collagen cosmetic product

Abstract

The utility model relates to a liquid preparation device for recombined XVII type collagen cosmetic products, which comprises a material storage tank, a stirring tank and a filtering tank, a pneumatic conveying pipe is arranged at the bottom of the material storage tank, the stirring tank is provided with a plurality of feed ports, at least one feed port is provided with a separator, one end of the pneumatic conveying pipe is provided with an air compression unit, and the other end of the pneumatic conveying pipe is provided with an air outlet. A discharging port of the stirring tank is connected with a feeding port of the filtering tank, a microfiltration membrane is arranged in the filtering tank, a plurality of butt joints which are connected in parallel are arranged at the discharging port of the filtering tank, and raw materials in the material storage tank can be conveyed into the air compression unit pipe under the pressurization effect of the air compression unit pipe. The liquid is lifted and conveyed from a low position to a high position along the pneumatic conveying pipe, enters the stirring tank, is filtered and sterilized by the filtering tank after being stirred, and is quickly discharged by the corresponding butt joint, so that a conveying structure and a discharge pipeline structure are simplified, and the risk of particle impurities and bacteria during liquid preparation is reduced; and the liquid preparation flexibility and efficiency of collagen cosmetic products are improved.

Description

Technical Field

[0001] The utility model belongs to the technical field of collagen cosmetic production equipment, and in particular relates to a liquid preparation device for recombinant type XVII collagen cosmetic products. Background Art

[0002] Skin aging is closely related to the extracellular matrix of the dermis. Collagen is a polymer that makes up various extracellular matrices. As the main component of the connective tissue of animal bodies, collagen can keep the skin and tissues and organs together, support the toughness and elasticity of the dermis, and has unique functional characteristics such as good biocompatibility, biodegradability and biological activity. For example, recombinant small molecule collagen derived from type XVII collagen can strike a balance between small molecules and transdermal absorption and biological activity, achieving rapid transdermal penetration in a short period of time and a high cumulative transdermal penetration rate over a long period of time. Therefore, supplementing recombinant type XVII collagen in the form of cosmetics is beneficial to maintaining the moisture of the stratum corneum and the integrity of the fiber structure, promoting the metabolism of skin tissue, enhancing circulation, and achieving the purpose of enhancing the skin's elasticity, firmness, water retention and repair ability or anti-aging and wrinkle removal. Collagen cosmetic products can be made into gels, masks, essences, disposable series and other products by combining collagen with matrix raw materials, other hydrating moisturizers, skin permeants, antioxidants and other penetrating ingredients to enrich the functionality, applicability, absorbency, and feel of use of the products. The production process involves a liquid preparation device that mixes solid auxiliary materials such as collagen with other liquid raw materials in proportion. The liquid preparation devices in the prior art still have the following problems when applied to the production of collagen cosmetic products:

[0003] (1) When using a hoist and a conveying dragon as conveying equipment to lift and quantitatively convey materials such as collagen, multiple hoists need to be used in conjunction, with many transfers, which increases the risk of contaminating bacteria and impurities being mixed into the conveying process. At the same time, when multiple cosmetic products with the same collagen and different excipients are prepared in parallel, multiple conveying devices are required, resulting in high equipment costs for the preparation device, inflexible production, and affected preparation efficiency.

[0004] (2) Collagen cosmetic raw materials and auxiliary materials are mixed in a mixing tank and then discharged directly. There is a risk of solid impurity particles not being dissolved in the matrix raw materials and bacteria not being treated, which may cause excessive bacteria in the production process, harming skin health and increasing allergies.

[0005] (3) After the preparation, the collagen cosmetic premix or finished material needs to be connected to multiple cross-pipes and valves for packaging or storage, which makes the pipeline structure complicated, the storage equipment is numerous, and the access is not convenient and flexible, which affects the subsequent production efficiency. Utility Model Content

[0006] The utility model aims to solve at least one of the above-mentioned technical problems to a certain extent. The utility model provides a liquid preparation device for a recombinant type XVII collagen cosmetic product, which is conducive to simplifying the conveying structure and the discharge pipeline structure, reducing the risk of particulate impurities and bacteria during liquid preparation, and improving the flexibility and efficiency of liquid preparation.

[0007] The technical solution adopted by the utility model to solve its technical problems is:

[0008] A liquid preparation device for a recombinant type XVII collagen cosmetic product comprises a storage tank, a stirring tank and a filtering tank, wherein a pneumatic conveying pipe is provided at the bottom of the storage tank, the stirring tank is provided with a plurality of feed ports and at least one feed port is provided with a separator, an air compression unit is provided at one end of the pneumatic conveying pipe, and the other end of the pneumatic conveying pipe is connected to the separator, the discharge port of the stirring tank is connected to the feed port of the filtering tank, a microporous filter membrane is provided in the filtering tank, and a plurality of parallel butt joints are provided at the discharge port of the filtering tank.

[0009] Preferably, a first valve is provided between the discharge port of the storage tank and the pneumatic conveying pipe, and the pneumatic conveying pipe close to the air compression unit is connected to a pressure delivery pipe connected to the top of the storage tank, and a second valve is provided on the pressure delivery pipe.

[0010] Preferably, the separator comprises a cyclone separator, and an air lock valve is provided between the discharge port of the cyclone separator and the feed port of the mixing tank.

[0011] Preferably, a three-way pipe is provided at the discharge port of the stirring tank, a feed pipe is provided between one outlet of the three-way pipe and the feed port of the filter tank, a third valve is provided on the feed pipe, a circulation pipe is provided between the other outlet of the three-way pipe and at least one feed port of the stirring tank, a fourth valve and a circulation pump are provided on the circulation pipe.

[0012] Preferably, a feed chamber and a filter chamber are provided in the filter tank, the feed port of the feed chamber is connected to the discharge port of the stirring tank, a plurality of support frames are provided in the filter chamber, the interior of the support frame is connected to the feed chamber, the microporous filter membrane is wrapped on the support frame, and the outlet of the filter chamber is connected to a plurality of docking joints.

[0013] Preferably, the filter chamber is provided with a discharge pipe passing through the feed chamber.

[0014] Preferably, the butt joint includes an outer shell and a telescopic tube, a vertically telescopic spring is provided between the telescopic tube and the outer shell, the telescopic tube can rise along the outer shell and communicate with the discharge port of the filter tank, and the telescopic tube can descend along the outer shell and cut off the discharge port of the filter tank.

[0015] Preferably, it comprises several groups of stirring tanks and filtering tanks connected in parallel on the pneumatic conveying pipe, and a fifth valve is provided between the separator of each group of stirring tanks and the pneumatic conveying pipe.

[0016] In the present invention, the recombinant type XVII collagen is a recombinant type XVII humanized collagen, which is disclosed in the patent with the authorization announcement number CN116948013B, and its amino acid sequence is shown in SEQ ID No: 35:

[0017] GVPGSVGPKGSSGSPGPQGPPGPVGLQGLRGEVGLPGVKGDKGPMGPPPGPKGDQGEK GPRGLE.

[0018] Compared with the prior art, the beneficial effects of the utility model are:

[0019] (1) The raw materials in the storage tank can be lifted and transported from a lower position to a higher position along the pneumatic conveying pipe under the pressure of the air compressor unit pipe, and then separated and degassed. Especially when multiple cosmetic products with the same collagen and different auxiliary materials are prepared in parallel, the number of transfers can be reduced compared with the existing conveying equipment with a combination of an elevator and a conveying dragon, thereby reducing the risk of contaminating bacteria and impurities being mixed in during the conveying process. The raw materials can be transported to the separator of the target mixing tank through the pneumatic conveying pipe, thereby improving the flexibility and efficiency of production.

[0020] (2) After the liquid is prepared and stirred in the mixing tank, the mixed liquid enters the filtering tank, and is filtered and sterilized by a microporous filter membrane to remove undissolved particulate impurities in the mixed liquid. This can effectively reduce the risk of excessive bacteria in the production process that damages skin health and increases allergies due to solid impurity particles that are not dissolved in the matrix raw materials and untreated bacteria.

[0021] (3) The butt joint can be connected to the corresponding downstream process equipment. The mixed liquid after filtration and sterilization can be temporarily stored in the filter tank and quickly discharged by the corresponding butt joint, eliminating the need for cross-pipeline connections and multiple storage devices, simplifying the discharge pipeline structure, making it more convenient and flexible to use, thereby improving production efficiency. BRIEF DESCRIPTION OF THE DRAWINGS

[0022] The above and / or additional aspects and advantages of the present invention will become apparent and easily understood from the description of the embodiments in conjunction with the following drawings, in which:

[0023] Figure 1 It is a schematic diagram of the structure of Embodiment 1 of the present utility model;

[0024] Figure 2 It is a structural diagram of the filter tank of Example 1 of the utility model;

[0025] Figure 3 This utility model Figure 2Schematic diagram of the opening and closing of the butt joint at A;

[0026] Figure 4 It is a structural schematic diagram of embodiment 2 of the present utility model.

[0027] Markings in the figure: storage tank 1, material outlet 101 of the storage tank, material inlet 102 of the storage tank; stirring tank 2, material inlet 201 of the stirring tank, material outlet 202 of the stirring tank, stirrer 203;

[0028] Filter tank 3, feed port 301 of filter tank, discharge port 302 of filter tank, microporous filter membrane 303, feed chamber 304, filter chamber 305, support frame 306, backwash port 307, sewage outlet 308, discharge pipe 309, pressure relief valve 310;

[0029] Pneumatic conveying pipe 4; separator 5, discharge port 501 of cyclone separator; air compression unit 6;

[0030] Butt joint 7, outer shell 701, telescopic tube 702, spring 703, end cap 704;

[0031] The first valve 8, the pressure delivery pipeline 9, the second valve 10, the air lock valve 11; the three-way pipeline 12, the feed pipe 13, the third valve 14, the circulation pipe 15, the fourth valve 16, the circulation pump 17, the booster pump 18, the fifth valve 19, and the docking pipeline 20. DETAILED DESCRIPTION

[0032] The embodiments of the present invention are described in detail below, and examples of the embodiments are shown in the accompanying drawings, wherein the same or similar reference numerals throughout represent the same or similar elements or elements having the same or similar functions. The embodiments described below with reference to the accompanying drawings are exemplary and are intended to be used to explain the present invention, and should not be construed as limiting the present invention.

[0033] In the description of the present utility model, it should be understood that the terms "upper", "lower", "vertical", "inside", "outside" and the like indicate positions or positional relationships based on the positions or positional relationships shown in the accompanying drawings, and are only for the convenience of describing the present utility model and simplifying the description, rather than indicating or implying that the device or element referred to must have a specific orientation, be constructed and operated in a specific orientation, and therefore cannot be understood as a limitation on the present utility model. In addition, the terms "first" and "second" are used for descriptive purposes only, and cannot be understood as indicating or implying relative importance or implicitly indicating the number of technical features indicated. Therefore, the features defined as "first" and "second" may explicitly or implicitly include one or more of the features. In the description of the present utility model, "multiple" and "several" mean two or more, unless otherwise clearly and specifically defined.

[0034] In the present invention, unless otherwise clearly specified and limited, the terms "installed", "connected", "connected", "fixed" and the like should be understood in a broad sense, for example, it can be a fixed connection, a detachable connection, or an integral connection; it can be a direct connection, or an indirect connection through an intermediate medium, or it can be the internal communication of two components. For ordinary technicians in this field, the specific meanings of the above terms in the present invention can be understood according to specific circumstances.

[0035] In the present invention, the recombinant type XVII collagen is a recombinant type XVII humanized collagen, which is disclosed in the patent with the authorization announcement number CN116948013B, and its amino acid sequence is shown in SEQ ID No: 35:

[0036] GVPGSVGPKGSSGSPGPQGPPGPVGLQGLRGEVGLPGVKGDKGPMGPPPGPKGDQGEK GPRGLE.

[0037] Embodiment 1:

[0038] In view of the problems of bacteria and impurities and insufficient production efficiency caused by using a combination of an elevator and a conveying dragon as conveying equipment and directly discharging after mixing, such as Figure 1 As shown, a preferred embodiment of a liquid preparation device for a recombinant type XVII collagen cosmetic product described in the utility model is shown, the liquid preparation device comprises a storage tank 1, a stirring tank 2 and a filter tank 3, a pneumatic conveying pipe 4 is provided at the bottom of the storage tank 1, the stirring tank 2 is provided with a plurality of feed ports and at least one feed port is provided with a separator 5, an air compression unit 6 is provided at one end of the pneumatic conveying pipe 4, and the other end of the pneumatic conveying pipe 4 is connected to the separator 5, the discharge port 202 of the stirring tank is connected to the feed port 301 of the filter tank, a microporous filter membrane 303 is provided in the filter tank 3, and a plurality of parallel docking joints 7 are provided at the discharge port 302 of the filter tank.

[0039] The working principle of the above-mentioned liquid preparation device includes: placing the collagen or other solid auxiliary materials of the cosmetic product in the lower storage tank 1 through the feed port 102 of the storage tank, and pressurizing the pneumatic conveying pipe 4 through the air compressor unit 6, so that the raw materials discharged from the discharge port 101 of the storage tank can be conveyed upward along the pneumatic conveying pipe 4 with the gas, and the gas is separated after entering the separator 5 at a high place, and the raw materials are retained to enter the feed port 201 of the mixing tank. Compared with the conveying equipment in which the elevator and the conveying dragon are combined, the raw materials can be delivered to the corresponding position at a high place without multiple elevators, which can reduce the number of transfers and thereby reduce the risk of mixing in contaminating bacteria and impurities during the transportation process; the other feed ports 201 of the mixing tank 2 can be connected to the pipeline of the liquid material, and the liquid material is pumped into the mixing tank 2, and the mixing of the raw materials and auxiliary materials is accelerated under the action of the agitator 203 of the mixing tank 2.

[0040] After the mixing is completed, the mixed liquid in the stirring tank 2 enters the feed port 301 of the filter tank from the discharge port 202 of the stirring tank, and is filtered and sterilized by the microporous filter membrane 303 to remove the undissolved particulate impurities in the mixed liquid, and is discharged more directly, which can effectively reduce the risk of excessive bacteria in the production process that damages skin health and increases allergenicity due to the solid impurity particles not being dissolved in the matrix raw materials and the bacteria not being treated; at the same time, the mixed liquid can be temporarily stored in the filter tank 3, and after the liquid is prepared, it is a premix or finished material for collagen cosmetics. The docking joint 7 can be connected to the corresponding post-process equipment, and the corresponding docking joint 7 can be opened to quickly discharge the material, eliminating the connection of cross-pipes and multiple storage devices, that is, simplifying the discharge pipeline structure, making it more convenient and flexible to use, thereby improving production efficiency.

[0041] Preferably, a first valve 8 is provided between the discharge port 101 of the storage tank and the pneumatic conveying pipe 4, and the pneumatic conveying pipe 4 near the air compression unit 6 is connected to a pressure delivery pipe 9 connected to the top of the storage tank 1, and a second valve 10 is provided on the pressure delivery pipe 9; when applied, for example: the bottom of the storage tank 1 can adopt a conical structure, and the raw materials can be temporarily stored in the storage tank 1 by closing the first valve 8 to avoid frequent adding of materials and simplify the process flow; the air compression unit 6 includes a fan, and when the raw materials need to be transported, the first valve 8 and the second valve 10 can be opened, and the wind entering the end of the pneumatic conveying pipe 4 can enter the top of the storage tank 1 side from the pressure delivery pipe 9, giving pressure to the internal of the storage tank 1, and pressing the raw materials inside the storage tank 1 out from the first valve 8, and then transported to the corresponding separator 5 along the pneumatic conveying pipe 4.

[0042] Preferably, the separator 5 includes a cyclone separator, and an air lock valve 11 is provided between the discharge port 501 of the cyclone separator and the feed port 201 of the mixing tank. The cyclone separator is relatively small in size and can achieve separation of solid and gas. The raw materials falling under the cyclone separator are locked by the air lock valve 11 and can be temporarily stored. The amount entering the mixing tank 2 is controlled by the opening and running time of the air lock valve 11, thereby improving the liquid preparation accuracy and saving the continuous mixing feeding time.

[0043] Preferably, a three-way pipe 12 is provided at the discharge port 202 of the stirring tank, a feed pipe 13 is provided between one outlet of the three-way pipe 12 and the feed port 301 of the filter tank, a third valve 14 is provided on the feed pipe 13, a circulation pipe 15 is provided between the other outlet of the three-way pipe 12 and at least one feed port of the stirring tank 2, and a fourth valve 16 and a circulation pump 17 are provided on the circulation pipe 15; for example: when used, the third valve 14 on the feed pipe 13 can be closed first, and the fourth valve 16 and the circulation pump 17 can be opened, and the raw materials in the stirring tank 2 can enter the inlet of the pouring tank from the three-way pipe 12 through the circulation pipe 15, so as to improve the circulation efficiency in the stirring tank 2 and promote the accelerated mixing of the raw and auxiliary materials of the collagen cosmetics; after stirring for a certain period of time, the fourth valve 16 and the circulation pump 17 can be closed, and the stirred mixed liquid can be discharged into the feed port 301 of the filter tank, and a booster pump 18 can also be provided on the feed pipe 13 to increase the conveying pressure, thereby performing rapid conveying and filtering.

[0044] Preferably, Figure 2 As shown, the filter tank 3 is provided with a feed chamber 304 and a filter chamber 305, the feed port of the feed chamber 304 is the feed port 301 of the filter tank, which is connected to the discharge port 202 of the stirring tank, and the filter chamber 305 is provided with a plurality of support frames 306, the interior of the support frame 306 is connected to the feed chamber 304, the microporous filter membrane 303 is wrapped on the support frame 306, the outlet of the filter chamber 305 is the discharge port 302 of the filter tank, and is connected to a plurality of docking joints 7; for example, the support frame 306 can adopt a grid structure, and the mixed liquid to be filtered and sterilized that enters the feed chamber 304 from the feed port can enter the plurality of support frames 306 respectively through the feed chamber 304. The microporous filter membrane 303 can filter and sterilize small particles and bacteria, and the clean mixed liquid passing through the microporous filter membrane 303 can be discharged from the outlet of the filter chamber 305 to each docking joint 7; the shell of the filter tank 3 can be a detachable structure, which is convenient for replacing the microporous filter membrane 303 after disassembly to maintain the filtering and sterilization ability. A backwashing port 307 connected to the filter chamber 305 can be provided to backwash the microporous filter membrane 303 to increase the service life. A sewage outlet 308 can be provided on the side of the filter chamber 305 to discharge dirt accumulated for a long time or discharged by backwashing; a pressure relief valve 310 can be provided on the top of the filter chamber 305 to exhaust air and prevent explosion by pressure relief when the pressure is too high.

[0045] Preferably, the filter chamber 305 is provided with a discharge pipe 309 passing through the feed chamber 304. This discharge structure is more convenient than the side discharge, and the docking joint 7 can be connected to the bottom of the filter tank 3, which is more convenient for quick connection of the docking joint 7.

[0046] Preferably, the butt joint 7 comprises an outer shell 701 and a telescopic tube 702, a vertically telescopic spring 703 is provided between the telescopic tube 702 and the outer shell 701, the telescopic tube 702 can rise along the outer shell 701 and communicate with the discharge port 302 of the filter tank, and the telescopic tube 702 can descend along the outer shell 701 and cut off the discharge port 302 of the filter tank; for example: Figure 3 As shown, the outer shell 701 can be provided with a spring 703 between the end cap 704 and the telescopic tube 702 inside the outer shell 701 through the end cap 704, and a docking pipe 20 is provided below the docking joint 7 to limit the descending stroke of the telescopic tube 702, as shown in FIG. Figure 3 As shown in (a), when the docking pipe 20 sinks, the pressure of the spring 703 drives the telescopic tube 702 to descend, and when the telescopic tube 702 docks with the docking pipe 20, the inner hole of the telescopic tube 702 is misaligned with the discharge port 302 of the filter tank, forming a cutoff; Figure 3 As shown in (b), when the docking pipe 20 rises, the telescopic tube 702 squeezes the spring 703, the telescopic tube 702 rises and makes the inner hole of the telescopic tube 702 communicate with the discharge port 302 of the filter tank to discharge the material; the lifting drive of the docking pipe 20 can adopt a lifting mechanism such as a cylinder, which is more convenient for the quick connection and disconnection of the docking pipe 20 and the docking joint 7 than the valve structure, and is convenient for selecting the corresponding docking joint 7 according to needs, thereby improving the flexibility of use and production efficiency.

[0047] Embodiment 2:

[0048] like Figure 4 As shown, it is another preferred embodiment of the dispensing device for a recombinant type XVII collagen cosmetic product described in the utility model. The difference between it and Example 1 is that it includes several groups of stirring tanks 2 and filtering tanks 3 connected in parallel on the pneumatic conveying pipe 4, and a fifth valve 19 is provided between the separator 5 of each group of stirring tanks 2 and the pneumatic conveying pipe 4; for example, a three-way valve can be selected as the fifth valve 19 between the separator 5 and the pneumatic conveying pipe 4 of two groups of stirring tanks 2. The purpose of this design is: when dispensing multiple cosmetic products with the same collagen and different auxiliary materials in parallel, the corresponding material feeding control is performed by controlling the reversal of the three-way valve to transport to the separator 5 of the target stirring tank 2. Compared with the combination of the elevator and the conveying dragon, it does not require multiple conveying equipment, which is conducive to simplifying the conveying structure and pipeline structure, improving the utilization rate of the storage tank 1, and effectively reducing the number of transfers, thereby reducing the risk of mixed contamination of bacteria and impurities during transportation, reducing the processing load of the filtering tank 3, and improving the flexibility and efficiency of production. Similarly, when the number of groups increases, other multi-way valves can also be selected.

[0049] The series of detailed descriptions listed above are only specific descriptions of feasible embodiments of the utility model. They are not intended to limit the protection scope of the utility model. All equivalent embodiments or changes that do not deviate from the technical spirit of the utility model should be included in the protection scope of the utility model.

Claims

1. A liquid preparation device for a recombinant type XVII collagen cosmetic product, characterized in that: The invention comprises a storage tank (1), a stirring tank (2) and a filtering tank (3), wherein a pneumatic conveying pipe (4) is provided at the bottom of the storage tank (1), the stirring tank (2) is provided with a plurality of feed ports and at least one feed port is provided with a separator (5), an air compression unit (6) is provided at one end of the pneumatic conveying pipe (4), and the other end of the pneumatic conveying pipe (4) is connected to the separator (5), the discharge port (202) of the stirring tank is connected to the feed port (301) of the filtering tank, a microporous filter membrane (303) is provided in the filtering tank, and the discharge port (302) of the filtering tank is provided with a plurality of parallel butt joints (7).

2. The liquid preparation device for recombinant type XVII collagen cosmetic products according to claim 1, characterized in that: A first valve (8) is provided between the discharge port (101) of the storage tank and the pneumatic conveying pipe (4), and the pneumatic conveying pipe (4) near the air compression unit (6) is connected to a pressure conveying pipe (9) connected to the top of the storage tank (1), and a second valve (10) is provided on the pressure conveying pipe (9).

3. The liquid preparation device for recombinant type XVII collagen cosmetic products according to claim 1, characterized in that: The separator (5) comprises a cyclone separator, and an air lock valve (11) is provided between the discharge port (501) of the cyclone separator and the feed port (201) of the stirring tank.

4. The liquid preparation device for recombinant type XVII collagen cosmetic products according to claim 1, characterized in that: A three-way pipe (12) is provided at the material outlet (202) of the stirring tank, a material delivery pipe (13) is provided between one outlet of the three-way pipe (12) and the material inlet (301) of the filter tank, a third valve (14) is provided on the material delivery pipe (13), a circulation pipe (15) is provided between the other outlet of the three-way pipe (12) and at least one material inlet of the stirring tank (2), a fourth valve (16) and a circulation pump (17) are provided on the circulation pipe (15).

5. The liquid preparation device for recombinant type XVII collagen cosmetic products according to claim 1, characterized in that: The filter tank (3) is provided with a feed chamber (304) and a filter chamber (305), the feed port of the feed chamber (304) is connected to the discharge port (202) of the stirring tank, the filter chamber (305) is provided with a plurality of support frames (306), the interior of the support frames (306) is connected to the feed chamber (304), the microporous filter membrane (303) is wrapped on the support frames (306), and the outlet of the filter chamber (305) is connected to a plurality of docking joints (7).

6. The liquid preparation device for recombinant type XVII collagen cosmetic products according to claim 5, characterized in that: The filter chamber (305) is provided with a discharge pipe (309) passing through the feed chamber (304).

7. The liquid preparation device for recombinant type XVII collagen cosmetic products according to claim 1, characterized in that: The butt joint (7) comprises an outer shell (701) and a telescopic tube (702); a vertically telescopic spring (703) is provided between the telescopic tube (702) and the outer shell (701); the telescopic tube (702) can rise along the outer shell (701) and communicate with the discharge port (302) of the filter tank; and the telescopic tube (702) can descend along the outer shell (701) and cut off the discharge port (302) of the filter tank.

8. The liquid preparation device for recombinant type XVII collagen cosmetic products according to any one of claims 1 to 7, characterized in that: The invention comprises a plurality of groups of stirring tanks (2) and filtering tanks (3) connected in parallel on a pneumatic conveying pipe (4), wherein a fifth valve (19) is provided between a separator (5) of each group of stirring tanks (2) and the pneumatic conveying pipe (4).

Images