Tolerance-inducing constructs and compositions and their use for treating immune disorders

Abstract

The present disclosure relates to tolerance-inducing constructs for inducing tolerance, such as by targeting the tolerance-inducing constructs to antigen-presenting cells (APCs). Additionally disclosed are polynucleotides, vectors, host cells, pharmaceutical compositions and kits comprising the tolerance-inducing constructs. Also disclosed are tolerance-inducing constructs and compositions for use in treating immune disorders, such as in the prophylactic or therapeutic treatment of autoimmune diseases, allergic diseases and transplant rejection.

Description

[Technical field]

[0001] The present disclosure relates to constructs and compositions for use in the treatment of conditions involving unwanted immune responses, such as in the prophylactic or therapeutic treatment of autoimmune diseases, allergic diseases and transplant rejection. [Background technology]

[0002] Immune responses are necessary for protection against diseases, e.g. diseases caused by pathogens such as viruses, bacteria or parasites. However, unwanted immune activation can cause processes that lead to damage or destruction of one's own tissue. Unwanted immune activation occurs, for example, in autoimmune diseases, where antibodies and / or T lymphocytes react with self-antigens, resulting in, for example, tissue damage and pathology. Unwanted immune activation also occurs in allergic reactions, which are characterized by an excessive immune response to typically harmless substances from the environment, and may result in an inflammatory response that leads to tissue destruction. Furthermore, unwanted immune activation occurs in graft rejection, e.g., rejection of transplanted organs or tissues, which is significantly mediated by alloreactive T cells present in the host, where T cells recognize donor alloantigens or xenoantigens. This leads to destruction of the transplanted organ or tissue.

[0003] Immune tolerance is the acquired lack of a specific immune response to substances or tissues capable of eliciting an immune response in a given organism.

[0004] Typically, to induce tolerance to a specific antigen, the antigen should be presented to other immune cells by antigen-presenting cells (APCs) in the absence of activation signals, which results in the death or functional inactivation of antigen-specific effector lymphocytes, or the generation of antigen-specific cells that maintain tolerance. This process generally describes tolerance to self-antigens, or self-tolerance. Immunosuppressants are useful for preventing or reducing unwanted immune responses, for example in the treatment of patients with autoimmune diseases or allogeneic transplants. Conventional strategies for producing immunosuppression of unwanted immune responses are based on broadly acting immunosuppressants. Furthermore, to maintain immunosuppression, immunosuppressant therapy is often a lifelong proposition. Unfortunately, the use of broadly acting immunosuppressants carries the risk of severe side effects, such as immune deficiency, since most of them act non-selectively, leading to increased susceptibility to infections and reduced cancer immunosurveillance. Therefore, new compounds and compositions that induce tolerance antigen-specific would be beneficial.

[0005] Antigen-presenting cells such as dendritic cells play a key role in regulating immune responses, and depending on the activation state of dendritic cells and the microenvironment (cytokines and growth factors), they either provide antigen-specific T cell signals to combat the presented antigen (putative pathogen) or silence the response to the presented antigen (putative non-pathogenic antigen) and induce peripheral tolerance. The challenge in developing tolerogenic immunotherapy is to efficiently deliver antigens to APCs / dendritic cells in a manner that does not trigger an inflammatory immune response. Summary of the Invention

[0006] The present disclosure relates to a tolerogenic construct comprising an antigen unit and first and second targeting units that interact with a surface molecule on an antigen-presenting cell, such as a dendritic cell, in a non-inflammatory or tolerogenic manner, resulting in presentation of the antigen in the absence of inflammatory activation conditions.

[0007] The inventors have surprisingly found that the constructs of the present disclosure can deliver disease-associated antigens to antigen-presenting cells (APCs) of choice in a manner optimal for induction of a selected antigen-specific tolerogenic response through binding to and signaling through selected surface receptors on APCs that internalize the construct and present the antigen in a tolerance-inducing manner, e.g., induction of regulatory T cells (Tregs) and suppression of memory and effector T cell responses.

[0008] Thus, in a first aspect, the present disclosure provides a method for producing a method for treating a cancer cell comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) A tolerance-inducing construct is provided, which comprises a multimeric protein consisting of multiple polypeptides defined in ii), for example, a dimeric protein consisting of two polypeptides defined in ii).

[0009] In another aspect, the present disclosure provides a method for producing a method for manufacturing a pharmaceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of the polypeptides defined in ii), thereby providing a tolerance-inducing construct.

[0010] Thus, in another aspect, the present disclosure provides a method for producing a method for treating a cancer cell comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a dimeric protein consisting of two polypeptides as defined in ii),

[0011] Also provided herein are multimeric proteins, such as the dimeric proteins described herein, in which multiple polypeptides are linked to one another via their respective first junction regions and via their respective second junction regions.

[0012] Also provided herein are multimeric proteins as described herein, in which multiple polypeptides, e.g., two polypeptides, are linked to each other via their respective first junction regions and via their respective second junction regions.

[0013] Also provided herein is a dimeric protein as described herein, wherein two polypeptides are linked to each other via their respective first junction regions and via their respective second junction regions.

[0014] In a further aspect, the present disclosure provides a method of preparing a pharmaceutical composition, comprising: a) providing a polynucleotide, a polypeptide or a multimeric protein, such as a dimeric protein, as described herein; b) combining the polynucleotide, polypeptide, or multimeric protein, such as a dimeric protein, with a pharma- ceutically acceptable carrier.

[0015] In a further aspect, the present disclosure provides a method of preparing a pharmaceutical composition, comprising: a) providing a polynucleotide, polypeptide or multimeric protein as described herein; b) combining the polynucleotide, polypeptide, or multimeric protein with a pharma- ceutically acceptable carrier.

[0016] In a further aspect, the present disclosure provides a method of preparing a pharmaceutical composition, comprising: a) providing a polynucleotide, polypeptide or dimeric protein as described herein; b) combining the polynucleotide, polypeptide, or dimeric protein with a pharma- ceutically acceptable carrier.

[0017] In a further aspect, the present disclosure provides a pharmaceutical composition comprising a polynucleotide described herein, a polypeptide or a multimeric protein, such as a dimeric protein, and a pharma- ceutically acceptable carrier.

[0018] Also provided herein are pharmaceutical compositions comprising a polynucleotide, polypeptide or multimeric protein described herein and a pharma- ceutically acceptable carrier.

[0019] Also provided herein is a pharmaceutical composition comprising a polynucleotide, polypeptide or dimeric protein described herein and a pharma- ceutically acceptable carrier.

[0020] In a further aspect, the disclosure provides a vector comprising a polynucleotide described herein.

[0021] In a further aspect, the present disclosure provides a host cell comprising the vector described herein.

[0022] In a further aspect, the disclosure provides a method for preparing a polypeptide or a multimeric protein, such as a dimeric protein, comprising: a) transfecting a cell with a vector described herein or a polynucleotide described herein; b) culturing the cells, whereby the cells express the polypeptide encoded by the polynucleotide; and c) obtaining and purifying the multimeric protein, such as the dimeric protein, and / or the polypeptide expressed by the cell.

[0023] In a further aspect, the disclosure provides a method for preparing a polypeptide or multimeric protein, comprising: a) transfecting a cell with a vector described herein or a polynucleotide described herein; b) culturing the cells, whereby the cells express the polypeptide encoded by the polynucleotide; and and c) obtaining and purifying the multimeric protein and / or polypeptide expressed by the cell.

[0024] In a further aspect, the present disclosure provides a method for preparing a polypeptide or a dimeric protein, comprising: a) transfecting a cell with a vector described herein or a polynucleotide described herein; b) culturing the cells, whereby the cells express the polypeptide encoded by the polynucleotide; and c) obtaining and purifying the dimeric protein and / or polypeptide expressed by the cell.

[0025] In a further aspect, the present disclosure provides a method for treating a condition involving an unwanted immune response, such as in the prophylactic or therapeutic treatment of autoimmune diseases, allergic diseases and transplant rejection, comprising administering to a subject in need thereof a polynucleotide, a polypeptide or a multimeric protein, such as a dimeric protein, as described herein, a vector as described herein, or a pharmaceutical composition as described herein.

[0026] In a further aspect, the present disclosure provides a method for treating a condition involving an unwanted immune response, such as in the prophylactic or therapeutic treatment of autoimmune diseases, allergic diseases and transplant rejection, comprising administering to a subject in need thereof a polynucleotide, a polypeptide or a multimeric protein as described herein, a vector as described herein, or a pharmaceutical composition as described herein.

[0027] In a further aspect, the present disclosure provides a method for treating a condition associated with an unwanted immune response, such as in the prophylactic or therapeutic treatment of autoimmune diseases, allergic diseases and transplant rejection, comprising administering to a subject in need thereof a polynucleotide, a polypeptide or a dimeric protein as described herein, a vector as described herein, or a pharmaceutical composition as described herein. [Brief description of the drawings]

[0028] [Figure 1] FIG. 1 shows a schematic diagram of an immunotherapy construct according to the present disclosure.

[0029] The top diagram shows an embodiment of the construct as a polypeptide, and the bottom diagram shows an embodiment of a dimeric protein formed by two polypeptides linked via their respective first and second junction regions.

[0030] A denotes the first targeting unit. B denotes a second targeting unit. C denotes an antigenic unit that contains at least one T cell epitope. D indicates the flexibility conferred to the targeting unit by the presence of the flexibility unit. AA indicates the first junction area. BA indicates the second junction region.

[0031] [Diagram 2] The figures show embodiments of the bond regions.

[0032] A denotes the three covalent bonds formed between the covalent units contained in each of the two polypeptide chains.

[0033] B shows how the flexibility unit is positioned between the binding unit and the targeting unit, as indicated by arrow D in FIG. 1, providing flexibility to the targeting unit.

[0034] [Diagram 3] The figure shows another embodiment of the bond area.

[0035] A indicates dimerization of two polypeptide chains by hydrophobic interactions between non-covalent units contained in each of the polypeptides.

[0036] B shows how the flexibility unit is positioned between the binding unit and the targeting unit, as indicated by arrow D in FIG. 1, to provide flexibility in targeting.

[0037] [Figure 4] The figure shows expression and secretion levels of MOG- and IL-10-encoding tolerance-inducing constructs of the present disclosure as detected by sandwich ELISA (capture antibody: mouse anti-MOG antibody, 0.25 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology; detection antibody: goat anti-murine IL-10 biotinylated antibody, 0.8 μg / mL, 100 μl / well, BAF417, R&D Systems) in supernatants of transfected cells.

[0038] A) shows results from Expi293F cells transiently transfected with DNA vectors VB5042, VB5050, VB5072, VB5073, VB5074, and VB5075.

[0039] B) shows results from HEK293 cells transiently transfected with the DNA vector VB5038.

[0040] All MOG and IL-10 end-encoding constructs were highly expressed and secreted. (A) Negative control is supernatant from Expi293F cells treated with the transfection reagent ExpiFectamine alone, (B) negative control is supernatant from HEK293 cells treated with the transfection reagent Lipofectamine alone.

[0041] [Diagram 5] The figure shows protein expression and secretion levels of the MOG coding construct (VB5067) with CTLA-4 as the second targeting unit detected by sandwich ELISA (capture antibody: mouse anti-MOG antibody, 0.25 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology; detection antibody: goat anti-murine CTLA-4 biotinylated antibody, 0.8 μg / mL, 100 μl / well, BAF476, R&D Systems) using supernatants from Expi293F cells transiently transfected with the DNA vector VB5067. The negative control is supernatant from Expi293F cells treated with the transfection reagent ExpiFectamine only.

[0042] [Figure 6]The figure shows protein expression and secretion levels of MOG coding construct tolerance-inducing constructs with MARCO ligand SCGB3A2 as the first targeting unit and IL-10 (VB5072 and VB5073) as the second targeting unit by sandwich ELISA (capture antibody: mouse anti-MOG antibody, 0.25 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology; detection antibody: goat anti-SCGB3A2 biotinylated antibody, 3.3 μg / mL, 100 μl / well, BAF3465, R&D Systems) using supernatants from Expi293F cells transiently transfected with DNA vectors VB5072 and VB5073. Negative control is supernatant from Expi293F cells treated with only the transfection reagent ExpiFectamine.

[0043] [Figure 7] The figure shows that MOG-encoded tolerance-inducing constructs with MARCO ligand SCGB3A2 as the first targeting unit and IL-10 (VB5072 and VB5073) as the second targeting unit were secreted as full-length fusion proteins by sandwich ELISA (capture antibody: mouse anti-mouse IL-10 antibody, 2 μg / mL, 100 μl / well, MAB417, R&D Systems, detection antibody: goat anti-mouse SCGB3A2, 3.3 μg / mL, 100 μl / well, BAF 3465, R&D Systems) using supernatants from Expi293F cells transiently transfected with DNA vectors VB5072 and VB5073. The negative control is the supernatant from Expi293F cells treated with only the transfection reagent ExpiFectamine.

[0044] [Figure 8]The figure shows binding of scFv anti-DEC205 coding constructs to the DEC205 receptor and secretion of full-length protein by direct ELISA using supernatants from HEK293 cells transiently transfected with the DNA vector VB 5038. ELISA wells were coated with recombinant DEC205 receptor (aa 216-503) and binding was detected by antibodies against MOG or murine IL-10. The OD450nm signal from negative controls, i.e. supernatants from HEK293 cells treated with the transfection reagent Lipofectamine, was subtracted before graphing.

[0045] [Figure 9] The figure shows the binding of IL-10-containing constructs to the IL-10 receptor by direct ELISA using supernatants from HEK293 cells transiently transfected with the DNA vector VB5038. ELISA wells were coated with recombinant IL-10 receptor and binding was detected by an antibody against MOG. The OD450 nm signal from the negative control, i.e., supernatants from HEK293 cells treated with the transfection reagent Lipofectamine, was subtracted before graphing.

[0046] [Figure 10] The figure shows secretion of MOG(27-63) peptide by direct ELISA (detection antibody: mouse anti-MOG antibody, 3.3 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology) using supernatants from Expi293F cells transiently transfected with the DNA vector VB5051. The negative control is supernatant from Expi293F cells treated with only the transfection reagent ExpiFectamine. [Figure 11]A. Expression and secretion levels of the pro-inflammatory control construct encoded by DNA vector VB5052 as detected by sandwich ELISA (capture antibody: mouse anti-MOG antibody, 0.25 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology; detection antibody: goat anti-human CCL 3 biotin antibody, 0.2 μg / mL, 100 μl / well, BAF270, R&D Systems) using supernatants from Expi293F cells transiently transfected with the CCL 3L1-containing vector VB5052. Detection of both the MOG and CCL3L1 portions of the fusion protein indicates full-length secretion of the fusion protein. The negative control is supernatant from Expi293F cells treated with only the transfection reagent ExpiFectamine.

[0047] B. Expression and secretion levels of the pro-inflammatory control construct encoded by DNA vector VB5002b detected by sandwich ELISA (Capture antibody: Mouse anti-human IgG (CH3 domain), 1 μg / mL, 100 μl / well, 153272, Biorad; Detection antibody: Goat anti-human CCL3 biotin antibody, 0.2 μg / mL, 100 μl / well, BAF270, R&D Systems) using supernatants from HEK293 cells transiently transfected with the CCL3L1-containing vector VB5002b. The negative control is supernatant from HEK293 cells treated with the transfection reagent Lipofectamine only.

[0048] [Figure 12] A. Western blot with full length secretion of tolerance-inducing protein encoded by VB5038 and pro-inflammatory control encoded by VB5002b. Reduced supernatant samples (10 μL loaded) from transfected Expi293F cells. Primary antibody: mouse anti-MOG (sc-73330). Secondary antibody: donkey anti-mouse, Dylight 800 (SA5-10172). Chemidoc channel Dylight 800.

[0049] B shows a Western blot of the protein encoded by VB5038 under reducing and non-reducing conditions detected with an anti-murine IL-10 antibody. A reduced supernatant sample from transfected Expi293F cells is shown on the left and a non-reduced supernatant sample is shown on the right (10 μL loaded). Primary antibody: rat anti-murine IL10 (MAB417). Secondary antibody: donkey anti-rat, Dylight 488 (SA5-1006). Chemidoc channel Dylight 488. A specific band was detected under non-reducing conditions at a size corresponding to the homodimeric protein (indicated by the black arrowhead).

[0050] C. Western blot with full-length secreted proteins encoded by VB5041, VB5042 and VB5050 detected by anti-MOG antibody (black arrowheads). Reduced supernatant samples (30 μL loaded) from transfected Expi293F cells. Primary antibody: mouse anti-MOG (sc-73330). Secondary antibody: donkey anti-mouse, Dylight 800 (SA5-10172). Chemidoc channels Dylight 650 (for protein standards) and 800.

[0051] D shows a Western blot with full-length secreted proteins encoded by VB5041, VB5042 and VB5050 detected by anti-murine IL-10 antibody (black arrows). Reduced supernatant samples (30 μL loaded) from transfected Expi293F cells. Primary antibody: rat anti-murine IL10 (MAB417). Secondary antibody: donkey anti-rat, Dylight 650 (SA5-10029). Chemidoc channel Dylight 650.

[0052] E. Western blot of proteins encoded by VB5041, VB5042 and VB5050 showing that the proteins dimerize under non-reducing conditions (black arrowheads). Non-reduced supernatant samples (30 μl loaded) from transfected Expi293F cells. Primary antibody: mouse anti-MOG (SC-73330). Secondary antibody: donkey anti-mouse, Dylight 800 (SA5-10172). Chemidoc channels Dylight 650 (for protein standards) and 800.

[0053] F. Western blot with full-length secretion of protein with VSIG-3 as the first targeting unit encoded by VB5074 and VB5075 detected by anti-MOG. VB5042 was included as a positive control. Reduced supernatant sample (25 μL loaded) from transfected Expi293F cells. Primary antibody: mouse anti-MOG (sc-73330). Secondary antibody: donkey anti-mouse, Dylight 800 (SA5-10172). Protein standards were detected in Chemidoc channel Dylight 650 (signal not shown). Chemidoc channel Dylight 800.

[0054] G. Western blot with full length secretion of protein with VSIG-3 as the first targeting unit encoded by VB5074 and VB5075 detected by anti-murine IL-10 antibody. VB5042 was included as a positive control. Reduced supernatant sample (25 μL loaded) from transfected Expi293F cells. Primary antibody: rat anti-IL 10 (MAB417). Secondary antibody: donkey anti-rat, Dylight 488 (SA5-10026). Chemidoc channels Dylight 650 (for protein standards) and 488.

[0055] [Figure 13]The figure shows dual-color IL-10 / IFNγ FluoroSpot. C57BL / 6 mice were vaccinated once (day 0) with 50 μg of the indicated DNA vectors and spleens were harvested 7 days post-vaccination. Individual mice and means ± SEM are shown (n=5 mice / group). **(p<0.01), two-tailed Mann-Whitney test. Construct ID numbers are shown on the x-axis.

[0056] A. Mouse splenocytes (SFU / 10) were tested for IL-10 and IFN-γ secretion. 6 Splenocytes) are shown using dual-color FluoroSpot for unstimulated splenocytes.

[0057] B. Mouse splenocytes (SFU / 10) were tested for IL-10 and IFN-γ secretion using dual-color FluoroSpot after restimulation with MOG(35–55) peptide for 44 h. 6 splenocytes).

[0058] C. IL-10 / IFN-γ ratios are plotted from data in (B) from MOG(35-55) restimulated splenocytes. Individual mice and means ± ranges are shown. ** (p<0.01), two-tailed Mann-Whitney test.

[0059] [Figure 14] The figure shows detection of MOG(38–49)-specific Foxp3+ cells. C57BL / 6 mice were vaccinated once (day 0) with 50 μg of the indicated DNA vector and spleens were harvested 7 days post-vaccination. Percentage of splenic CD4+Foxp3+ cells detected by H-2 Iab / MOG(38–49) tetramer. Tetramer staining was performed ex vivo and splenocytes were not restimulated with MOG(35–55) peptide. Data are generated from pools of 5 mice per group (spleens were pooled before analysis). Construct ID numbers are indicated on the x-axis.

[0060] [Figure 15]The figure shows dual-color IL-10 / IFNγ FluoroSpot. C57BL / 6 mice were vaccinated once (day 0) with 50 μg of the indicated DNA vectors and spleens were harvested 7 days post-vaccination. Individual mice and means ± SEM are shown (n=5 mice / group). **(p<0.01), two-tailed Mann-Whitney test. Construct ID numbers are shown on the x-axis.

[0061] A. Mouse splenocytes (SFU / 10) were tested for IL-10 and IFN-γ secretion. 6 Splenocytes) are shown using dual-color FluoroSpot for unstimulated splenocytes.

[0062] B. Mouse splenocytes (SFU / 10) were tested for IL-10 and IFN-γ secretion using dual-color FluoroSpot after restimulation with MOG(35–55) peptide for 44 h. 6 splenocytes).

[0063] C. IL-10 / IFN-γ ratios plotted from data in (B) from MOG(35-55) restimulated splenocytes. Individual mice and mean ± ranges are shown. ** (p<0.01), two-tailed Mann-Whitney test.

[0064] [Figure 16] The figure shows detection of MOG(38–49)-specific Foxp3+ cells. C57BL / 6 mice were vaccinated once (day 0) with 50 μg of the indicated DNA vector and spleens were harvested 7 days post-vaccination. Percentage of splenic CD4+Foxp3+ cells detected by H-2 Iab / MOG(38–49) tetramer. Tetramer staining was performed ex vivo and splenocytes were not restimulated with MOG(35–55) peptide. Data are generated from pools of 5 mice per group (spleens were pooled before analysis). Construct ID numbers are indicated on the x-axis.

[0065] [Figure 17]The figure shows dual-color IL-10 / IFNγ FluoroSpot. C57BL / 6 mice were vaccinated once (day 0) with 50 μg of the indicated DNA vectors and spleens were harvested 7 days post-vaccination. Individual mice and means ± SEM are shown (n=5 mice / group). **(p<0.01), two-tailed Mann-Whitney test. Construct ID numbers are shown on the x-axis.

[0066] A. Mouse splenocytes (SFU / 10) were tested for IL-10 and IFN-γ secretion. 6 Splenocytes) are shown using dual-color FluoroSpot for unstimulated splenocytes.

[0067] B. Mouse splenocytes (SFU / 10) were tested for IL-10 and IFN-γ secretion using dual-color FluoroSpot after restimulation with MOG(35–55) peptide for 44 h. 6 splenocytes).

[0068] C. IL-10 / IFN-γ ratios plotted from data in (B) from MOG(35-55) restimulated splenocytes. Individual mice and mean ± ranges are shown. * (p<0.05), two-tailed Mann-Whitney test.

[0069] [Figure 18] The figure shows detection of MOG(38–49)-specific Foxp3+ cells. C57BL / 6 mice were vaccinated once (day 0) with 50 μg of the indicated DNA vector and spleens were harvested 7 days post-vaccination. Frequency of splenic CD4+Foxp3+ cells detected by H-2 Iab / MOG(38–49) tetramer. Tetramer staining was performed ex vivo and splenocytes were not restimulated with MOG(35–55) peptide. Data are generated from pools of 5 mice per group (spleens were pooled before analysis). Construct ID numbers are indicated on the x-axis.

[0070] [Figure 19]The figure shows the expression and secretion levels of Met e 1-containing tolerance-inducing constructs with IL-10, VB5077 and VB5078 as the second targeting unit. Sandwich ELISA with supernatants from Expi293F cells transiently transfected with VB5077 and VB5078: capture antibody: anti-murine IL-10 antibody (MAB417, R&D Systems), detection antibody: anti-murine IL-10 biotinylated antibody (BAF417, R&D Systems). Both Met e 1-containing constructs were highly expressed and secreted. The negative control is the supernatant from Expi293F cells treated only with the transfection reagent ExpiFectamine.

[0071] [Figure 20] The figure shows a Western blot with full-length secretion of the protein encoded by Met e 1-containing DNA vectors VB5077 and VB5078 (black arrowheads). Reduced supernatant samples (35 μL loaded) from transfected Expi293F cells. Primary antibody: rat anti-IL10 (MAB417). Secondary antibody: donkey anti-rat, Dylight 650 (SA5-10029). Chemidoc channel Dylight 650. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0072] In a first aspect, the present disclosure provides a method for producing a pharmaceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) A tolerance-inducing construct is provided, which comprises a multimeric protein consisting of multiple polypeptides defined in ii), for example, a dimeric protein consisting of two polypeptides defined in ii).

[0073] In another aspect, the present disclosure provides a method for producing a method for manufacturing a pharmaceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of the polypeptides defined in ii), thereby providing a tolerance-inducing construct.

[0074] In another aspect, the present disclosure provides a method for producing a method for manufacturing a pharmaceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a dimeric protein consisting of two polypeptides as defined in ii),

[0075] Such constructs, when administered to a subject, allow the presentation of epitopes in antigenic units in a tolerance-inducing manner and are therefore suitable for use as prophylactic or therapeutic treatments for immune disorders such as autoimmune diseases, allergic diseases and graft rejection.

[0076] The tolerance-inducing constructs do not suppress the systemic immune system, as they cause downregulation of disease-specific cells of the immune system that cause the immune disease in question. Thus, treatment of the immune disease in question with the constructs of the present disclosure does not result in increased susceptibility to infection and reduced cancer immune surveillance. However, bystander suppression of immune cells specific for the relevant disease antigen is expected due to the release of short-range inhibitory cytokines through cell-to-cell contact with the induced antigen-specific regulatory cells.

[0077] The tolerance-inducing constructs of the present disclosure may be administered in the form of a pharmaceutical composition comprising the construct of the present disclosure and a pharma- ceutically acceptable carrier for use in the prophylactic or therapeutic treatment of immune diseases, such as autoimmune diseases, allergic diseases, and transplant rejection.

[0078] A "tolerance-inducing construct" is one that, when administered to a subject in a form suitable for administration and in an amount effective to induce tolerance (i.e., an effective amount), does not induce an inflammatory immune response, but rather induces tolerance to T cell epitopes contained in the antigenic unit.

[0079] As used herein, the term "tolerance" refers to a reduction in the level of, a delay in the onset or progression of, and / or a reduction in the risk of onset or progression of an inflammatory immune response to a harmless antigen, such as a self-antigen, an allergen, or an alloantigen.

[0080] A "subject" is an animal, such as a mouse, or a human, preferably a human. The subject may be a patient in need of therapeutic treatment, i.e. a human suffering from an immune disorder such as an autoimmune disease, allergy, or graft rejection, or may be a subject in need of prophylactic treatment or a subject suspected of having an immune disorder. The terms "subject" and "individual" are used interchangeably herein.

[0081] A "disease" is an abnormal medical condition typically associated with certain signs and symptoms in a subject suffering from the disease. As used herein, an "immune disease" refers to a condition, disorder or disease involving an unwanted immune response, including autoimmune disease, allergy or graft rejection, i.e., rejection of an allograft or xenograft, such as rejection by a host of cells, tissues or organs from the same (allo) or different (xeno) species that have been transplanted into the host.

[0082] The term "alloantigens / alloantigens" or "allotransplant antigens" as used herein refers to antigens derived from (shed and / or present in) cells or tissues that, when transferred from a donor to a recipient, can be recognized and bound by the antibodies of the recipient's B or T cell receptors. Alloantigens are typically the products of polymorphic genes. Alloantigens are proteins or peptides that exhibit slight structural differences when compared between donor and recipient (belonging to the same species). The presence of such donor antigens in the recipient's body can induce an inflammatory immune response in the recipient. Such alloreactive immune responses are specific to the alloantigens.

[0083] As used herein, the term "xenoantigen" refers to an antigen derived from an individual of a different species.

[0084] "Treatment" may be a prophylactic or therapeutic treatment.

[0085] A "prophylactic treatment" is a treatment administered to a subject who does not exhibit signs or symptoms of an immune disease or who exhibits only early signs or symptoms of an immune disease, such that the treatment is administered for the purpose of preventing an immune disease or at least reducing the risk of developing the same. Prophylactic treatment functions as a preventative treatment against an immune disease or as a treatment that inhibits or reduces the further development or enhancement of an immune disease and / or its associated symptoms. The terms "prophylactic treatment", "prevention" and "prevention" are used interchangeably herein.

[0086] A "therapeutic treatment" is a treatment administered to a subject who exhibits symptoms or signs of an immune disease, where the treatment is administered to the subject with the intent of reducing or eliminating those signs or symptoms, or of slowing or halting the progression of the disease.

[0087] "Part" refers to a portion / fragment of an antigen, i.e. a portion / fragment of the amino acid sequence of the antigen, or the nucleotide sequence encoding it, e.g. an epitope; preferably, the portion or fragment of the antigen is immunogenic. These terms are used interchangeably throughout.

[0088] As used herein, a "T cell epitope" refers to a portion or region of an antigen that contains a single T cell epitope, or multiple T cell epitopes, for example multiple minimal epitopes.

[0089] The term "minimal epitope" refers to a subsequence of an epitope predicted to bind MHC I or MHC II. In other words, a minimal epitope may be immunogenic, i.e., capable of eliciting an immune response. Thus, the term minimal epitope may refer to a short subsequence of an epitope predicted to bind MHC I or MHC II. Thus, a 27mer epitope may encompass several minimal epitopes, each of which may have a length shorter than 27 amino acids and each of which is immunogenic. For example, a minimal epitope may consist of the first 14 amino acids of an epitope, as long as it is predicted to bind MHC I or MHC II, or it may consist of amino acids 9-18 or amino acids 7-22 of an epitope, as long as these sequences are predicted to bind MHC I or MHC II.

[0090] A "nucleotide sequence" is a sequence made up of nucleotides. The terms "nucleotide sequence" and "nucleic acid sequence" are used interchangeably herein.

[0091] The terms "mouse" and "rat" are used interchangeably herein.

[0092] The terms "vaccination" and "administration" are used interchangeably herein.

[0093] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.

[0094] Tolerance-inducing constructs The structure of some embodiments of the construct is shown in Figures 1-3 based on a polypeptide and a dimeric protein formed by two polypeptides linked via their respective first and second junction regions. The polypeptide (Figure 1, top) comprises, in the specified order, a first targeting unit (A), a first junction region (AA), an antigen unit (C) as described herein, a second junction region (BA) and a second targeting unit (B). The bottom part of Figure 1 shows how the flexibility unit contained in the second junction region provides flexibility to the second targeting unit (arrow D).

[0095] In some embodiments, a multimeric protein, such as a polypeptide and a dimeric protein, is formed by a plurality of polypeptides linked via their respective first and second junction regions. The polypeptide comprises, in the specified order, a first targeting unit, a first junction region, an antigenic unit as described herein, a second junction region, and a second targeting unit. The flexibility unit contained in the second junction region provides flexibility to the second targeting unit.

[0096] In some embodiments, the polypeptide and multimeric protein are formed by a plurality of polypeptides linked via their respective first and second junction regions. The polypeptide comprises, in the specified order, a first targeting unit, a first junction region, an antigenic unit as described herein, a second junction region and a second targeting unit. The flexibility unit contained in the second junction region provides flexibility to the second targeting unit.

[0097] In some embodiments, the polypeptide and dimeric protein are formed by two polypeptides linked via their respective first and second junction regions. The polypeptide comprises, in the specified order, a first targeting unit, a first junction region, an antigenic unit as described herein, a second junction region and a second targeting unit. The flexibility unit contained in the second junction region provides flexibility to the second targeting unit.

[0098] In the following disclosure, the various units of the construct are considered in detail. They are comprised in the polynucleotide as a nucleic acid sequence encoding the unit, while in the polypeptide or multimeric / dimeric protein as an amino acid sequence. For ease of reading, in the following disclosure, the units of the construct are described mainly in terms of the polypeptide or multimeric / dimeric protein, i.e., based on their amino acid sequence.

[0099] joining area The polypeptide of the present disclosure comprises a first junction region and a second junction region. The first junction region and the second junction region may be any of the following regions:

[0100] The first junction region is located between a first targeting unit as described herein and an antigen unit as described herein.

[0101] In some embodiments, the second junction region is located between an antigenic unit described herein and a second targeting unit described herein.

[0102] In some embodiments, a multimeric protein, such as a dimeric protein, of the present disclosure is one in which multiple polypeptides, such as two polypeptides, are linked together via their junction regions. In other embodiments, a multimeric protein, such as a dimeric protein, of the present disclosure is one in which multiple polypeptides, such as two polypeptides, are linked together via their respective first junction regions and via their respective second junction regions.

[0103] In some embodiments, the multimeric proteins of the present disclosure are those in which multiple polypeptides are linked to each other via their junction regions, while in other embodiments, the multimeric proteins of the present disclosure are those in which multiple polypeptides are linked to each other via their respective first junction regions and via their respective second junction regions.

[0104] In some embodiments, the dimeric protein of the present disclosure is one in which two polypeptides are linked to each other via their junction regions, while in other embodiments, the dimeric protein of the present disclosure is one in which two polypeptides are linked to each other via their respective first junction regions and via their respective second junction regions.

[0105] The term "junction region" as used herein refers to the amino acid sequence between the antigen unit and the targeting unit. Any amino acid sequence that can join multiple polypeptides (in the case of embodiments related to multimeric proteins), for example, two polypeptides (in the case of embodiments related to dimeric proteins), while at the same time providing flexibility and proper protein conformation to the multimeric or dimeric protein, is a suitable junction region.

[0106] Junction regions provide flexibility to multimeric proteins, such as dimeric proteins, so that targeting units can interact with surface molecules on APCs, for example with surface molecules on the same APC, even when they are located at variable distances. Furthermore, junction regions join multiple monomeric polypeptides into multimeric proteins, such as dimeric proteins. Any amino acid sequence that meets one or more of these requirements is a suitable junction region.

[0107] Junction regions provide flexibility to multimeric proteins, so that targeting units can interact with surface molecules on APCs, for example, with surface molecules on the same APC, even if they are located at variable distances. Furthermore, junction regions join multiple monomeric polypeptides into multimeric proteins. Any amino acid sequence that meets one or more of these requirements is a suitable junction region.

[0108] The junction region provides flexibility to the dimeric protein, so that the targeting unit can interact with surface molecules on the APC, for example with surface molecules on the same APC, even if they are located at variable distances. Furthermore, the junction region joins two monomeric polypeptides into a dimeric protein. Any amino acid sequence that meets one or more of these requirements is a suitable junction region.

[0109] Preferably, the junction region comprises a flexibility unit that provides flexibility and a binding unit that joins multiple polypeptides, such as two polypeptides, to form a multimer, such as a dimer. In a preferred embodiment, the flexibility unit contained in the junction region is closest to the targeting unit, and the binding unit is closest to the antigen unit. In another embodiment, the junction region comprises a flexibility unit that provides flexibility and a binding unit that joins multiple polypeptides to form a multimeric protein.

[0110] Preferably, the junction region comprises a flexibility unit that provides flexibility and a binding unit that joins multiple polypeptides to form a multimer. In a preferred embodiment, the flexibility unit included in the junction region is closest to the targeting unit and the binding unit is closest to the antigen unit. In other embodiments, the junction region comprises a flexibility unit that provides flexibility and a binding unit that joins multiple polypeptides to form a multimeric protein. Preferably, the junction region comprises a flexibility unit that provides flexibility and a binding unit that joins two polypeptides to form a dimer. In a preferred embodiment, the flexibility unit included in the junction region is closest to the targeting unit and the binding unit is closest to the antigen unit. In other embodiments, the junction region comprises a flexibility unit that provides flexibility and a binding unit that joins two polypeptides to form a dimeric protein. In some embodiments, the binding units of the first and second junction regions are different.

[0111] In some embodiments, a binding unit in a first junction region of one polypeptide molecule can bind to a binding unit in a first junction region of another polypeptide molecule, whereby the molecules are linked via their respective first junction regions. Similarly, a binding unit in a second junction region of one polypeptide molecule can bind to a binding unit in a second junction region of another polypeptide molecule, whereby the molecules are linked via their respective second junction regions. Thus, the polypeptide molecules are linked to each other via their respective first junction regions and via their respective second junction regions to form a multimeric protein, such as a dimeric protein.

[0112] In some embodiments, a binding unit in a first junction region of one polypeptide molecule can bind to a binding unit in a first junction region of another polypeptide molecule, whereby the molecules are linked via their respective first junction regions. Similarly, a binding unit in a second junction region of one polypeptide molecule can bind to a binding unit in a second junction region of another polypeptide molecule, whereby the molecules are linked via their respective second junction regions. Thus, the polypeptide molecules are linked to each other via their respective first junction regions and via their respective second junction regions to form a multimeric protein.

[0113] Thus, in some embodiments, a binding unit in a first junction region of one polypeptide molecule can bind to a binding unit in a first junction region of another polypeptide molecule, whereby the two molecules are linked via their respective first junction regions. Similarly, a binding unit in a second junction region of one polypeptide molecule can bind to a binding unit in a second junction region of another polypeptide molecule, whereby the two molecules are linked via their respective second junction regions. Thus, two polypeptide molecules form a dimeric protein by being linked to each other via their respective first junction regions and via their respective second junction regions.

[0114] In other embodiments, the first bond area and the second bond area are the same.

[0115] Thus, in some embodiments, a binding unit contained in a first junction region of one polypeptide molecule can bind to a binding unit contained in either the first junction region or the second junction region of another polypeptide molecule, and the same applies to a binding unit contained in the second junction region.

[0116] If the first and second junction regions are the same, it is preferred that either the first and second targeting units are different but interact with the same surface molecule on an APC, or the first and second targeting units are identical.

[0117] In some embodiments, the amino acid sequence of the first and / or second junction region comprises or consists of at least one naturally occurring sequence, In some embodiments, the amino acid sequence of the first and / or second junction region comprises or consists of at least one artificial sequence.

[0118] In some embodiments, the binding units are covalent binding units, and in other embodiments, the binding units are non-covalent binding units.

[0119] In a preferred embodiment, the amino acid sequence of the junction region is a non-immunogenic sequence.

[0120] Embodiments of junction regions contained in some embodiments of dimeric proteins are shown in FIG. 2 and FIG.

[0121] The junction region shown in Figure 2 (junction region 1 or junction region 2) comprises a flexible unit (B) closest to the targeting unit and adjacent to it, a covalent unit closest to the antigen unit. The covalent unit in Figure 2 shows three covalent bonds (A) formed between two polypeptide chains. The junction region (junction region 1 or junction region 2) shown in Figure 3 comprises a flexible unit (B) closest to the targeting unit and a non-covalent unit adjacent thereto, closest to the antigen unit. The non-covalent unit in Figure 3 promotes dimerization of the two polypeptide chains, for example, by hydrophobic interactions (A).

[0122] Flexibility Unit In some embodiments, the bond regions described herein comprise flexible units.

[0123] In a preferred embodiment, the amino acid sequence of the flexible unit is a non-immunogenic sequence.

[0124] In some embodiments, the amino acid sequence of the flexible unit is a naturally occurring peptide sequence. In some embodiments, the flexible unit is derived from an immunoglobulin. In some embodiments, the flexible unit is a hinge region of an immunoglobulin, and the hinge region does not contain a cysteine ​​residue.

[0125] In some embodiments, the amino acid sequence of the flexible unit is an artificial sequence.

[0126] In some embodiments, the flexible unit comprises small non-polar (e.g., glycine, alanine or leucine) or polar (e.g., serine or threonine) amino acids. The small size of these amino acids provides flexibility and allows mobility of the connected amino acid sequence. The incorporation of serine or threonine can maintain the stability of the linker in aqueous solution by forming hydrogen bonds with water molecules, thus reducing unfavorable interactions between the linker and the antigen. In some embodiments, the flexible unit is an artificial sequence, for example a serine (S) and / or glycine (G) rich linker, i.e. a linker that includes several serine and / or several glycine residues. Preferred examples are GGGGSGGGSS (SEQ ID NO: 75), GGGSG (SEQ ID NO: 76), GGSGG (SEQ ID NO: 77), SGSSGS (SEQ ID NO: 78), GGGGS (SEQ ID NO: 79) or several variants thereof, such as GGGGSGGGGS (SEQ ID NO: 80), (GGGGS)m (SEQ ID NO: 81), (GGGS)m (SEQ ID NO: 82), (GGGSG)m (SEQ ID NO: 83) or (SGSSGS)m (SEQ ID NO: 84), where m is an integer from 1 to 5, such as 1, 2, 3, 4 or 5. In a preferred embodiment, m is 2. In another preferred embodiment, the serine and / or glycine rich linker further comprises at least one leucine (L) residue, such as at least one or at least two or at least three leucine residues, such as 1, 2, 3 or 4 leucine residues.

[0127] In some embodiments, the flexible unit comprises or consists of LGGGS (SEQ ID NO:85), GLGGS (SEQ ID NO:86), GGLGS (SEQ ID NO:87), GGGLS (SEQ ID NO:88), or GGGGL (SEQ ID NO:89). In other embodiments, the flexible unit comprises or consists of LGGSG (SEQ ID NO:90), GLGSG (SEQ ID NO:91), GGLSG (SEQ ID NO:92), GGGLG (SEQ ID NO:93), or GGGSL (SEQ ID NO:94). In yet other embodiments, the flexible unit comprises or consists of LGGSS (SEQ ID NO:95), GLGSS (SEQ ID NO:96), or GGLSS (SEQ ID NO:97).

[0128] In other embodiments, the flexible unit comprises or consists of LGLGS (SEQ ID NO:98), GLGLS (SEQ ID NO:99), GLLGS (SEQ ID NO:100), LGGLS (SEQ ID NO:101) or GLGGL (SEQ ID NO:102). In other embodiments, the flexible unit comprises or consists of LGLSG (SEQ ID NO:103), GLLSG (SEQ ID NO:104), GGLSL (SEQ ID NO:105), GGLLG (SEQ ID NO:106) or GLGSL (SEQ ID NO:107). In other embodiments, the flexible unit comprises or consists of LGLSS (SEQ ID NO:108) or GGLLS (SEQ ID NO:109).

[0129] In another embodiment, the flexible unit is a serine-glycine linker having a length of 10 amino acids and containing one or two leucine residues.

[0130] In some embodiments, the flexible unit comprises or consists of LGGGSGGGGS (SEQ ID NO:110), GLGGSGGGGS (SEQ ID NO:111), GGLGSGGGGS (SEQ ID NO:112), GGGLSGGGGS (SEQ ID NO:113), or GGGGLGGGGS (SEQ ID NO:114). In other embodiments, the flexible unit comprises or consists of LGGSGGGGSG (SEQ ID NO:115), GLGSGGGGSG (SEQ ID NO:116), GGLSGGGGSG (SEQ ID NO:117), GGGLGGGGSG (SEQ ID NO:118), or GGGSLGGGSG (SEQ ID NO:119). In other embodiments, the flexible unit comprises or consists of LGGSSGGGSS (SEQ ID NO:120), GLSSGGGSS (SEQ ID NO:121), GGLSSGGGSS (SEQ ID NO:122), GGGLSGGGSS (SEQ ID NO:123), or GGGSLGGGSS (SEQ ID NO:124).

[0131] In further embodiments, the flexible unit comprises or consists of LGGGSLGGGS (SEQ ID NO: 125), GLGGSGLGGS (SEQ ID NO: 126), GGLGSGGLGS (SEQ ID NO: 127), GGGLSGGGLS (SEQ ID NO: 128), or GGGGLGGGGL (SEQ ID NO: 129). In other embodiments, the flexible unit comprises or consists of LGGSGLGGSG (SEQ ID NO: 130), GLGSGGLGSG (SEQ ID NO: 131), GGLSGGGLSG (SEQ ID NO: 132), GGGLGGGGLG (SEQ ID NO: 133), or GGGSLGGGSL (SEQ ID NO: 134). In other embodiments, the flexible unit comprises or consists of LGGSSLGGSS (SEQ ID NO: 135), GLGSSGLGSS (SEQ ID NO: 136), or GGLSSGGLSS (SEQ ID NO: 137).

[0132] In other embodiments, the flexible unit comprises or consists of GSGGGA (SEQ ID NO: 138), GSGGGAGSGGGA (SEQ ID NO: 139), GSGGGAGSGGGAGSGGGA (SEQ ID NO: 140), GSGGGAGSGGGAGSGGGAGSGGGA (SEQ ID NO: 141), or GENLYFQSGG (SEQ ID NO: 142). In yet other embodiments, the flexible unit comprises or consists of SGGGSSGGGS (SEQ ID NO: 143), SSGGGSSGGG (SEQ ID NO: 144), GGGSGGGGSGG (SEQ ID NO: 145), GSGSGSGSGS (SEQ ID NO: 146), GGSGGGSSG (SEQ ID NO: 147, and amino acids 121-130 of SEQ ID NO: 1), GGGSSS (SEQ ID NO: 148), GGGSSGGGSSGGGSS (SEQ ID NO: 149), or GLGGLAAA (SEQ ID NO: 150).

[0133] In another embodiment, the flexible unit comprises or consists of the sequence TQKSLSLSPGKGLGGL (SEQ ID NO: 151). In another embodiment, the flexible unit comprises or consists of the sequence SLSLSPGKGLGGL (SEQ ID NO: 152). In another embodiment, the T cell epitope linker comprises or consists of AAY or GPGPG (SEQ ID NO: 153).

[0134] In other embodiments, the flexible unit comprises or consists of a GSAT linker, i.e. a linker comprising one or more glycine, serine, alanine and threonine residues, for example a linker comprising or consisting of the sequence GGSAGGSGSGSSGGSSGASGTGTAGGTGSGSGTGSG (SEQ ID NO: 154) or a SEG linker, i.e. a linker comprising one or more serine, glutamic acid and glycine residues, for example a linker comprising or consisting of the sequence GGSGGGSEGGGSEGGGSEGGGSEGGGSEGGGSGGGS (SEQ ID NO: 155) or ELKTPLGDTTHT (SEQ ID NO: 19).

[0135] In some embodiments, a flexible unit is not a target for proteases.

[0136] In some embodiments the flexible unit consists of at most 20 amino acids, such as at most 15 amino acids, such as 14 amino acids, such as 13 amino acids, such as 12 amino acids, such as 11 amino acids or 10 amino acids.

[0137] In some embodiments, the flexible unit comprises or consists of an amino acid sequence having at least 50% sequence identity, such as 60%, or such as 70%, or such as 80% or such as 90% sequence identity to amino acid sequences 1 to 12 of SEQ ID NO:1.

[0138] In a preferred embodiment, the flexible unit is the hinge exon h1 of IgG3.

[0139] In a preferred embodiment, the flexible unit comprises or consists of the amino acid sequence 1-12 of SEQ ID NO:1.

[0140] In some embodiments, the flexible unit comprises or consists of an amino acid sequence having at least 50% sequence identity, such as 60%, or such as 70%, or such as 80%, or such as 90% sequence identity to amino acid sequence 16-23 of SEQ ID NO:2.

[0141] In some embodiments, the flexible unit comprises or consists of the amino acid sequence 16-23 of SEQ ID NO:2, wherein any one of the amino acids of the flexible unit is substituted, deleted or inserted for another amino acid, provided that no more than 5 amino acids, such as no more than 4 amino acids, no more than 3 amino acids, such as no more than 2 amino acids, or no more than 1 amino acid are so substituted, deleted or inserted.

[0142] In other embodiments, the flexible unit is the lower hinge region of IgG1.

[0143] In a preferred embodiment, the flexible unit comprises or consists of the amino acid sequence 16 to 23 of SEQ ID NO:2.

[0144] Covalent Bond Unit In some embodiments, the junction regions described herein comprise covalent linking units.

[0145] In a preferred embodiment, the covalent binding unit comprises one or more cysteine ​​residues, and the polypeptides described herein are linked via one or more disulfide bonds formed between the cysteine ​​residues contained in the covalent binding unit of each of the first and second interface regions.

[0146] In some embodiments, the covalent binding unit consists of or comprises a cysteine-rich sequence.

[0147] In some embodiments, the covalent binding unit comprises at least two cysteine ​​residues, such as at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 cysteine ​​residues.

[0148] In some embodiments, the covalent binding units of the first interface region include a different number of cysteine ​​residues than the covalent binding units of the second interface region.

[0149] In some embodiments, the cysteine ​​residues of the covalent binding units of the first interface region are positioned differently from the cysteine ​​residues of the covalent binding units of the second interface region, e.g., the number of amino acid residues between the cysteine ​​residues of the covalent binding units of the first interface region is different from that of the second interface region.

[0150] In some embodiments, the number of cysteine ​​residues is based on the length of the antigenic unit: the more amino acid residues contained in the antigenic unit, the greater the number of cysteine ​​residues in the covalent binding unit.

[0151] In some embodiments, the covalent binding unit comprises the sequence EPKSCDTPPPCPRCP (SEQ ID NO:156; corresponding to amino acids 13-27 of SEQ ID NO:1).

[0152] In a preferred embodiment, the amino acid sequence of the covalent binding unit is a non-immunogenic sequence.

[0153] In some embodiments, the amino acid sequence of the covalent binding unit is an artificial sequence.

[0154] In some embodiments, the amino acid sequence of the covalent binding unit is a naturally occurring peptide sequence.

[0155] In some embodiments, the covalent bond unit consists of 2 to 100 amino acids, such as 3 to 70 amino acids, such as 4 to 50 amino acids or 5 to 30 amino acids. In further embodiments, the covalent bond unit consists of 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids. In preferred embodiments, the covalent bond unit consists of 15 amino acids, three of which are cysteine ​​residues.

[0156] In some embodiments, the covalent binding unit is derived from an immunoglobulin.

[0157] In some embodiments, the covalent binding unit is a hinge region derived from an immunoglobulin, such as exon h4 of IgG3 or the central hinge region of IgG1. The hinge region may be from an Ig, such as from an IgG, such as from IgG2 or IgG3. In some embodiments, the hinge region is from IgM, and for example comprises or consists of a nucleotide sequence having SEQ ID NO: 157 or an amino acid sequence encoded by said nucleotide sequence.

[0158] In some embodiments, the covalent binding unit comprises or consists of an amino acid sequence having at least 40% sequence identity to amino acid sequence 13-27 of SEQ ID NO:1, e.g., at least 50%, at least 60%, at least 70%, at least 80% or at least 90% sequence identity.

[0159] In some embodiments the covalent bond unit comprises or consists of the amino acid sequence 13-27 of SEQ ID NO:1, wherein any one of the amino acids of the flexible unit is substituted, deleted or inserted for another amino acid, provided that no more than 6 amino acids are so substituted, deleted or inserted, such as no more than 5 amino acids, such as no more than 4 amino acids, such as no more than 3 amino acids, such as no more than 2 amino acids, or no more than 1 amino acid.

[0160] In a preferred embodiment, the covalent binding unit is the hinge exon h4 of IgG3.

[0161] In another preferred embodiment, the shared junction region consists of amino acid sequence 13 to 27 of SEQ ID NO:1.

[0162] In some embodiments, the covalent binding unit comprises or consists of an amino acid sequence having at least 40% sequence identity to amino acids 5-15 of SEQ ID NO:2, so long as the cysteine ​​residues are retained in their number and positions with, for example, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% sequence identity.

[0163] In some embodiments the covalent bond unit comprises or consists of the amino acid sequence 5-15 of SEQ ID NO:2, wherein any one of the amino acids of the flexible unit is substituted, deleted or inserted for another amino acid, provided that no more than 5 amino acids are so substituted, deleted or inserted, such as no more than 4 amino acids, such as no more than 3 amino acids, such as no more than 2 amino acids or no more than 1 amino acid.

[0164] In a preferred embodiment, the covalent binding unit is the central hinge region of IgG1.

[0165] In another embodiment, the covalent bond unit consists of or comprises amino acid sequence 5-15 of SEQ ID NO:2.

[0166] Non-covalent Bonding Units In some embodiments, the junction regions described herein comprise non-covalent binding units.

[0167] In some embodiments, the non-covalent binding unit contributes to multimerization, such as dimerization, through non-covalent interactions, e.g., hydrophobic interactions. In some embodiments, the non-covalent binding unit has the ability to form multimers, such as dimers, via non-covalent interactions.

[0168] In some embodiments, the non-covalent binding unit contributes to multimerization through non-covalent interactions, such as hydrophobic interactions. In some embodiments, the non-covalent binding unit has the ability to form multimers via non-covalent interactions.

[0169] The non-covalent binding units contribute to dimerization through non-covalent interactions, such as hydrophobic interactions, hi some embodiments, the non-covalent binding units have the ability to form dimers via non-covalent interactions.

[0170] In a preferred embodiment, the amino acid sequence of the non-covalent binding unit is a non-immunogenic sequence.

[0171] In some embodiments, the amino acid sequence of the non-covalent binding unit is an artificial sequence.

[0172] In some embodiments, the amino acid sequence of the non-covalent binding unit is a naturally occurring sequence.

[0173] In some embodiments, the non-covalent binding unit is or comprises an immunoglobulin domain, such as an immunoglobulin constant domain (C-domain), such as a carboxy-terminal C-domain (i.e., a CH3 domain), a CH1 domain or a CH2 domain, or a sequence that is substantially identical to a C-domain or a variant thereof. In some embodiments, the non-covalent binding unit is a carboxy-terminal C-domain derived from IgG, such as from IgG3 or IgG1, preferably from IgG1.

[0174] It is preferred that if a non-covalent binding unit in one junction region comprises a CH3 domain, it does not further comprise a CH2 domain, and vice versa.

[0175] In some embodiments, the non-covalent binding unit comprises or consists of a carboxy-terminal C domain derived from an IgG3 having an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:3.

[0176] In a preferred embodiment the non-covalent binding unit comprises or consists of a carboxy-terminal C-domain from IgG3 having an amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO:3, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, such as at least 98% or such as at least 99% sequence identity.

[0177] In a preferred embodiment, the non-covalent binding unit comprises or consists of the carboxy-terminal C-domain derived from IgG3 having the amino acid sequence of SEQ ID NO:3.

[0178] In some embodiments the non-covalent binding unit comprises or consists of a carboxy-terminal C-domain derived from an IgG3 having the amino acid sequence of SEQ ID NO: 3, wherein any one of the amino acids of the flexible unit is replaced, deleted or inserted by another amino acid, with the proviso that not more than 21 amino acids, such as not more than 20 amino acids, such as not more than 19 amino acids, such as not more than 18 amino acids, for example not more than 17 amino acids, such as not more than 16 amino acids, for example not more than 15 amino acids, such as not more than 14 amino acids, for example not more than 13 amino acids, such as not more than 12 amino acids, for example not more than 11 amino acids, such as not more than 10 amino acids, for example not more than 9 amino acids, such as not more than 8 amino acids, for example not more than 7 amino acids, such as not more than 6 amino acids, for example not more than 5 amino acids, such as not more than 4 amino acids, for example not more than 3 amino acids, such as not more than 2 amino acids, for example not more than 1 amino acid.

[0179] In some embodiments, the non-covalent binding unit comprises or consists of a CH3 domain derived from an IgG1 having an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:4.

[0180] In some preferred embodiments the non-covalent binding unit comprises or consists of a CH3 domain from an IgG1 having an amino acid sequence having at least 85% sequence identity to the amino acid sequence according to SEQ ID NO:4, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, such as at least 98% or such as at least 99% sequence identity.

[0181] In some embodiments the non-covalent binding unit comprises or consists of a CH3 domain derived from an IgG1 having the amino acid sequence of SEQ ID NO: 3, wherein any one of the amino acids of the flexible unit is replaced, deleted or inserted by another amino acid, with the proviso that not more than 21 amino acids, such as not more than 20 amino acids, such as not more than 19 amino acids, for example not more than 18 amino acids, such as not more than 17 amino acids, for example not more than 16 amino acids, such as not more than 15 amino acids, for example not more than 14 amino acids, such as not more than 13 amino acids, for example not more than 12 amino acids, such as not more than 11 amino acids, for example not more than 10 amino acids, such as not more than 9 amino acids, for example not more than 8 amino acids, such as not more than 7 amino acids, for example not more than 6 amino acids, such as not more than 5 amino acids, for example not more than 4 amino acids, such as not more than 3 amino acids, for example not more than 2 amino acids, such as not more than 1 amino acid.

[0182] In some preferred embodiments, the non-covalent binding unit is or comprises CH3 of IgG1.

[0183] In other embodiments, the non-covalent binding unit is or comprises a leucine zipper motif.

[0184] Leucine zippers are a common three-dimensional structural motif in proteins in which a leucine side chain from one alpha helix interlocks with a leucine side chain from another alpha helix to promote dimerization.

[0185] Leucine zippers are dimerization motifs of the bZIP (basic region leucine zipper) class of eukaryotic transcription factors. bZIP domains are 60-80 amino acids long and have a highly conserved DNA-binding basic region and a more diverse leucine zipper dimerization region. In some embodiments, the non-covalent binding unit is or includes a leucine zipper motif from the bZIP class of eukaryotic transcription factors.

[0186] In some embodiments, the non-covalent binding unit is or comprises a Jun / Fos based leucine zipper. In some embodiments, the non-covalent binding unit is or comprises an ATF6 based leucine zipper. In some embodiments, the non-covalent binding unit is or comprises a PAR based leucine zipper. In some embodiments, the non-covalent binding unit is or comprises a C / EBPa based leucine zipper. In some embodiments, the non-covalent binding unit is or comprises an OASIS based leucine zipper.

[0187] In a further preferred embodiment, the non-covalent binding unit is or comprises the leucine zipper motif (amino acids 308-336) from the CREB transcription factor (SEQ ID NO: 5).

[0188] In a further preferred embodiment, the non-covalent binding unit comprises or consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:5, such as at least 81%, or at least 81%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.

[0189] In a further preferred embodiment, the non-covalent unit comprises or consists of the amino acid sequence of SEQ ID NO: 5, wherein any one of the amino acids of the flexible unit is replaced, deleted or inserted by another amino acid, provided that not more than 12, such as not more than 11, such as not more than 10, such as not more than 9, for example not more than 8, such as not more than 7, for example not more than 6, such as not more than 5, for example not more than 4 amino acids, such as not more than 3 amino acids, for example not more than 2 amino acids, such as not more than 1 amino acid.

[0190] In some embodiments, the junction region comprises a flexible unit and a binding unit that is either a covalent or non-covalent unit, hi some embodiments, the junction region comprises a binding unit that includes both covalent and non-covalent units.

[0191] In other embodiments, the junction region comprises a flexible unit, a covalent unit, and a non-covalent unit. In some embodiments, the non-covalent unit is located between the antigen unit and the covalent unit. In other embodiments, the covalent unit is located between the antigen unit and the non-covalent unit.

[0192] In other embodiments, the junction region comprises a flexible unit and a non-covalent unit. In other embodiments, the junction region comprises a flexible unit and a covalent unit. In preferred embodiments, the flexible unit is closest to the targeting unit, i.e., located between the targeting unit and the covalent unit and / or between the non-covalent unit.

[0193] In some embodiments, the conjugation region further comprises a linker, hi further embodiments, the linker is located between the covalent and non-covalent binding units.

[0194] A non-covalent unit that promotes / links multimerization of three or more polypeptides In addition to linking the antigenic unit and the targeting unit, the non-covalent binding unit facilitates multimerization / conjugation of multiple polypeptides, e.g., two, three, four or more polypeptides, into a multimeric protein, e.g., a dimeric protein, a trimeric protein, or a tetrameric protein.

[0195] In some embodiments, the non-covalent unit is or comprises a trimerization unit, such as a collagen-derived trimerization unit, such as a human collagen-derived trimerization domain, such as a human collagen-derived XVIII trimerization domain (see, for example, A. Alvarez-Cienfuegos et al., Sci Rep 6, 28643 (2016)) or a human collagen XV trimerization domain. Thus, in one embodiment, the non-covalent unit is a trimerization unit that comprises or consists of a nucleic acid sequence having SEQ ID NO: 158 or an amino acid sequence encoded by said nucleic acid sequence. In another embodiment, the trimerization unit is the C-terminal domain of T4 fibritin. Thus, in some embodiments, the non-covalent unit is a trimerization unit that comprises or consists of an amino acid sequence having SEQ ID NO: 159 or a nucleic acid sequence encoding said nucleic acid sequence.

[0196] In other embodiments, the non-covalent binding unit is or comprises a tetramerization unit, such as a domain derived from p53, optionally further comprising a hinge region as described below. Thus, in some embodiments, the non-covalent binding unit is a tetramerization unit that comprises or consists of a nucleic acid sequence having SEQ ID NO: 160 or an amino acid sequence encoded by said nucleic acid sequence, optionally further comprising a hinge region as described below.

[0197] Specific embodiments of the bond region In a preferred embodiment, the junction region comprises the hinge exon h1 and hinge exon h4 of IgG3. In a further preferred embodiment, the junction region comprises or consists of an amino acid sequence having at least 40% sequence identity to the amino acid sequence of SEQ ID NO: 1, insofar as the cysteine ​​residues in the sequence are retained in their number and position, e.g. with at least 50% sequence identity, at least 60%, at least 70%, at least 80% or at least 90% sequence identity.

[0198] In a further preferred embodiment, the junction region comprises or consists of the amino acid sequence of SEQ ID NO:1, insofar as the cysteine ​​residues in the sequence are retained in their number and position, and any one of the amino acids of the flexible unit is replaced, deleted or inserted by another amino acid, provided that not more than 16 amino acids, such as not more than 15 amino acids, such as not more than 14 amino acids, for example not more than 13 amino acids, such as not more than 12 amino acids, for example not more than 11 amino acids, such as not more than 10 amino acids, for example not more than 9 amino acids, such as not more than 8 amino acids, for example not more than 7 amino acids, such as not more than 6 amino acids, for example not more than 5 amino acids, such as not more than 4 amino acids, for example not more than 3 amino acids, such as not more than 2 amino acids, for example not more than 1 amino acid, is so replaced, deleted or inserted.

[0199] In some embodiments, the junction region is hinge exon h1 and hinge exon h4 of IgG3. In some embodiments, the junction region comprises the amino acid sequence of SEQ ID NO:1.

[0200] When the above junction region is a second junction region, the junction region contains the hinge exons in the order of h4 to h1, i.e., the above sequence is "flipped" so that the flexible unit h1 is closest to the second targeting unit.

[0201] In other preferred embodiments, the junction region comprises the middle and lower hinge regions of IgG1.In even more preferred embodiments, the junction region comprises or consists of an amino acid sequence having at least 40% sequence identity to amino acids 5 to 23 of SEQ ID NO:2, insofar as the cysteine ​​residues in the sequence are retained in their number and position, e.g. with at least 50% sequence identity, at least 60%, at least 70%, at least 80% or at least 90% sequence identity.

[0202] In a further preferred embodiment, the junction region comprises or consists of the amino acid sequence 5 to 23 of SEQ ID NO:2, so long as the cysteine ​​residues in the sequence are retained in their number and position, and any one of the amino acids of the flexible unit is replaced, deleted or inserted by another amino acid, provided that not more than 11 amino acids, such as not more than 10 amino acids, for example not more than 9 amino acids, such as not more than 8 amino acids, for example not more than 7 amino acids, such as not more than 6 amino acids, for example not more than 5 amino acids, such as not more than 4 amino acids, for example not more than 3 amino acids, such as not more than 2 amino acids, for example not more than 1 amino acid, is so replaced, deleted or inserted.

[0203] In some embodiments, the junction region is the middle and lower hinge region of IgG1. In other preferred embodiments, the junction region consists of or comprises amino acid sequence 5 to 23 of SEQ ID NO:2.

[0204] When the above junction region is a first junction region, the junction region comprises the hinge regions in the order of lower hinge region to middle hinge region, i.e., the above sequence is "flipped" so that the lower hinge region, which is the flexible unit, is closest to the first targeting unit.

[0205] In some embodiments, the junction region comprises hinge exon h1 and hinge exon h4 of IgG3 and / or the middle and lower hinge regions of IgG1, and may further comprise a non-covalent junction region, such as a non-covalent junction region as described above, preferably an immunoglobulin constant domain.

[0206] Targeting Unit The tolerogenic constructs of the present disclosure include first and second targeting units that target antigen presenting cells (APCs).

[0207] The first and second targeting units are attached to first and second junction regions, respectively, as described herein.

[0208] The term "targeting unit" as used herein refers to a unit that delivers the construct of the present disclosure to an antigen-presenting cell and interacts with a surface molecule on the APC, e.g., binds to a surface receptor on the APC, without inducing maturation of the cell. The APC internalizes the construct and presents the T cell epitope contained in the antigen unit on the MHC on its surface in an anti-inflammatory, tolerogenic manner, e.g., by not upregulating costimulatory signals and / or by upregulating inhibitory surface receptors and / or by promoting secretion of inhibitory cytokines. In some embodiments, the targeting unit is a targeting unit selected from the group consisting of TGFβ receptors (including TGFβR1, TGFβR2, and TGFβR3), IL10R, such as IL-10RA and IL10-RB, IL2R, IL4R, IL6R, IL11R and IL13R, IL27R, IL35R, IL37R, GM-CSFR, FLT3, CCR7, CD11b, CD11c, CD103, CD14, CD36, CD205, CD109, VISTA, MARCO , MHCII, CD83, SIGLEC, MGL / Clec10A, ASGR (ASGR1 / ASGR2), CD80, CD86, Clec9A, Clec12A, Clec12B, DCIR2, Langerin, MR, DC-Sign, Treml4, Dectin-1, PDL1, PDL2, HVEM, CD163, and CD141.

[0209] In a preferred embodiment, the targeting unit is selected from the group consisting of hTGFβ receptors (including hTGFβR1, hTGFβR2, and hTGFβR3), hIL-10R, such as hIL-10RA and hIL-10RB, hIL-2R, hIL-4R, hIL-6R, hIL-11R, hIL-13R, hIL-27R, hIL-35R, hIL-37R, hGM-CSFR, hFLT3, hCCR7, hCD11b, hCD11c, hCD103, hCD14, hCD36, hCD205, hCD109, hVISTA, hMAR The antibody comprises, or alternatively consists of, a portion that binds to a surface molecule on a human (h)APC selected from the group consisting of CO, hMHCII, hCD83, hSIGLEC, hClec10A (hMGL), hASGR (hASGR1 / hASGR2), hCD80, hCD86, hClec9A, hClec12A, hClec12B, hDCIR2, hLangerin, hMR, hDC-Sign, hTreml4, hDectin-1, hPDL1, hPDL2, hHVEM, hCD163 and hCD141.

[0210] The moiety may be a natural ligand, an antibody or part thereof, such as an scFv, or a synthetic ligand.

[0211] In some embodiments, the moiety is an antibody or portion thereof, such as an scFv, with specificity for any of the aforementioned receptors, and upon binding to the receptor, presents T cell epitopes contained in the antigenic unit in an anti-inflammatory and tolerogenic manner.

[0212] In other embodiments, the moiety is a synthetic ligand with specificity for any of the aforementioned receptors, binding to which results in the presentation of T cell epitopes contained in the antigenic unit in an anti-inflammatory and tolerogenic manner. Protein modeling may be used to design such synthetic ligands.

[0213] In other embodiments, the moiety is a natural ligand.

[0214] In some embodiments the natural ligand is selected from the group consisting of TGFβ, such as TGFβ1, TGFβ2 or TGFβ3, IL-10, IL2, IL4, IL6, IL11, IL13, IL27, IL35, IL37, GM-CSF, FLT3L, CCL19, CCL21, ICAM-1 (intercellular adhesion molecule 1, also known as CD54), keratin, VSIG-3, SCGB3A2, CTLA-4, preferably the extracellular domain of CTLA-4, PD-1, preferably the extracellular domain of PD-1 and BTLA, preferably the extracellular domain of BTLA.

[0215] In other embodiments, the targeting unit is or comprises IL-10 or TGFβ, preferably human IL-10 or human TGFβ.

[0216] In other embodiments, the targeting unit comprises or consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence of human TGFβ.

[0217] In other embodiments the targeting unit comprises or consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence of human TGFβ, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98%, such as at least 99% or such as 100% sequence identity.

[0218] In other embodiments, the targeting unit comprises or consists of the amino acid sequence of human TGFβ, except that up to 22 amino acids, for example up to 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid have been substituted, deleted or inserted.

[0219] In other embodiments, the targeting unit comprises or consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence of human IL-10 (SEQ ID NO:66).

[0220] In other embodiments the targeting unit comprises or consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence of human IL-10, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98%, such as at least 99% or such as 100% sequence identity.

[0221] In other embodiments, the targeting unit comprises or consists of the amino acid sequence of human IL-10, except that up to 22 amino acids, for example up to 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid have been substituted, deleted or inserted.

[0222] In other embodiments, the targeting unit comprises or consists of the amino acid sequence of human IL-10 or a nucleotide sequence encoding human IL-10.

[0223] In some embodiments, the targeting unit is or comprises SCGB3A2 or VSIG-3, preferably human VSIG-3 or human SCGB3A2.

[0224] In other embodiments, the targeting unit comprises or consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence of human SCGB3A2.

[0225] In other embodiments, the targeting unit comprises or consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence of human SCGB3A2, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, for example at least 90%, such as at least 91%, for example at least 92%, such as at least 93%, for example at least 94%, such as at least 95%, for example at least 96%, for example at least 97%, for example at least 98%, for example at least 99% or such as 100% sequence identity.

[0226] In other embodiments, the targeting unit comprises or consists of the amino acid sequence of human SCGB3A2, except that up to 22 amino acids, for example up to 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid have been substituted, deleted or inserted.

[0227] In other embodiments, the targeting unit comprises or consists of the amino acid sequence of human SCGB3A2 or a nucleotide sequence encoding human SCGB3A2.

[0228] In other embodiments, the targeting unit comprises or consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence of human VSIG-3.

[0229] In other embodiments, the targeting unit comprises or consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence of human VSIG-3, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98%, such as at least 99% or such as 100% sequence identity.

[0230] In another embodiment, the targeting unit comprises or consists of the amino acid sequence of human VSIG-3, except that up to 22 amino acids, for example up to 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid have been substituted, deleted or inserted.

[0231] In other embodiments, the targeting unit comprises or consists of the amino acid sequence of human VSIG-3 or a nucleotide sequence encoding human VSIG-3.

[0232] In other embodiments, the targeting unit is or comprises an antibody or portion thereof, such as an scFv, with specificity for CD205.

[0233] Antigenic unit The antigenic unit of the tolerogenic construct of the present disclosure comprises one or more T cell epitopes of self-antigens, including but not limited to Treg epitopes or inhibitory neoantigens, allergens, alloantigens or xenoantigens.

[0234] The antigenic unit is located between the first junction region and the second junction region, as described herein.

[0235] In some embodiments, the antigenic unit comprises one or more T cell epitopes of an autoantigen, i.e. one T cell epitope of an autoantigen, or two or more T cell epitopes of an autoantigen, i.e. multiple T cell epitopes of an autoantigen. In one embodiment, the multiple T cell epitopes are of the same autoantigen, i.e. comprised in the same autoantigen. In another embodiment, the multiple T cell epitopes are of different autoantigens, i.e. comprised in different autoantigens.

[0236] In some embodiments, when an antigenic unit comprises more than one T cell epitope, the antigenic unit comprises one or more linkers separating the T cell epitopes. In some embodiments, an antigenic unit comprises multiple T cell epitopes of multiple antigens, e.g., autoantigens, allergens, alloantigens or xenoantigens, and the T cell epitopes are preferably separated by a linker. In yet other embodiments, an antigenic unit comprises multiple T cell epitopes of autoantigens, allergens, alloantigens or xenoantigens, and each T cell epitope is separated from the other antigens by a linker. An alternative way to describe the separation of each T cell epitope of an autoantigen, allergen, alloantigen or xenoantigen from the other T cell epitopes by a linker is that all but the terminal T cell epitopes, i.e., antigens at the beginning of the N-terminus of the polypeptide or at the C-terminus of the polypeptide (i.e., located at the end of the antigenic unit that is not linked to the dimerization unit), are located in a subunit, and each subunit comprises or consists of an antigen and a linker as described herein.

[0237] Thus, an antigen unit containing n antigens comprises n-1 subunits, each subunit comprising a T cell epitope of an autoantigen, an allergen, an alloantigen or a xenoantigen, and a linker, and further comprising a terminal T cell epitope. In some embodiments, n is an integer from 1 to 50, e.g., 3 to 50, or 15 to 40, or 10 to 30, or 10 to 25, or 10 to 20, or 15 to 30, or 15 to 25, or 15 to 20.

[0238] The linker in the antigen unit separates the antigens, e.g. epitopes, contained therein. As described above, all T cell epitopes of autoantigens, allergens, alloantigens or xenoantigens may be located in the subunit, separated from each other by linkers.

[0239] In some embodiments, the linker is designed to be non-immunogenic. It may be a rigid linker, meaning that it does not allow the two amino acid sequences it connects to move substantially freely relative to each other. Alternatively, it may be a flexible linker, i.e., a linker that allows the two amino acid sequences it connects to move substantially freely relative to each other.

[0240] By separating the antigens by a linker, each T cell epitope of an autoantigen, allergen, alloantigen or xenoantigen is presented in an optimal manner to the immune system.

[0241] By way of example, myelin basic protein (MBP), proteolipid protein (PLP), myelin associated glycoprotein (MAG), myelin oligodendrocyte glycoprotein (MOG) and myelin associated basic oligodendrocyte protein (MOBP) have all been investigated and proposed as autoantigens involved in multiple sclerosis (MS), and an antigenic unit may, for example, comprise one or more T cell epitopes of MBP, i.e., one T cell epitope of MBP or multiple T cell epitopes of MBP. Furthermore, an antigenic unit may, for example, comprise multiple T cell epitopes of MOG and PLP, e.g., one or more T cell epitopes of MOG and one or more T cell epitopes of PLP.

[0242] In another embodiment, the antigenic unit comprises one or more T cell epitopes of an allergen, i.e. one T cell epitope of an allergen, or two or more T cell epitopes of an allergen, i.e. multiple T cell epitopes of an allergen. In one embodiment, the multiple T cell epitopes are of the same allergen, i.e. comprised in the same allergen. In another embodiment, the multiple T cell epitopes are of different allergens, i.e. comprised in different allergens.

[0243] By way of example, Fel d1, Fel d4 and Fel d7 are three of the most prominent cat allergens and account for the majority of human cat allergies, and an antigenic unit may, for example, comprise one or more T cell epitopes of Fel d1, i.e. one T cell epitope of Fel d1 or multiple T cell epitopes of Fel d1. Furthermore, an antigenic unit may, for example, comprise multiple T cell epitopes of Fel d4 and Fel d7, e.g. one or more T cell epitopes of Fel d4 and one or more T cell epitopes of Fel d7.

[0244] In other embodiments, the antigenic unit comprises one or more T cell epitopes of an allo / xenoantigen, i.e. one T cell epitope of an allo / xenoantigen, or two or more T cell epitopes of an allo / xenoantigen, i.e. multiple T cell epitopes of an allo / xenoantigen. In some embodiments, the multiple T cell epitopes are of the same allo / xenoantigen, i.e. comprised in the same allo / xenoantigen. In other embodiments, the multiple T cell epitopes are of different allo / xenoantigens, i.e. comprised in different allo / xenoantigens.

[0245] In some embodiments, the antigenic unit comprises one T cell epitope, while in other embodiments, the antigenic unit comprises two or more T cell epitopes, i.e., a plurality of T cell epitopes.

[0246] The tolerance-inducing constructs of the present disclosure may be individualized treatments, i.e., designed for a particular subject / single patient, hi other embodiments, the tolerance-inducing constructs of the present disclosure are for general use in a patient population or patient, i.e., off-the-shelf treatments.

[0247] Individualized tolerance-inducing constructs For individualized tolerogenic constructs, T cell epitopes are selected for inclusion in the antigenic units, and the T cell epitopes are optimized for the patient receiving treatment with the construct, which increases the therapeutic effect compared to off-the-shelf treatments that include the tolerogenic construct.

[0248] The antigenic unit of the individualized tolerogenic construct may be designed as follows, as exemplified for a patient suffering from MS: 1) The patient's HLA class I and / or HLA class II alleles are determined. 2) T cell epitopes contained in one or more autoantigens (eg, autoantigens that have been studied and proposed to be involved in MS) are identified. 3) T cell epitopes are selected based on predicted binding to the patient's HLA class I and / or class II alleles. 4) One or more tolerogenic test constructs are designed and produced, with T cell epitopes optionally located in the antigenic units of the constructs as described in this application.

[0249] T cell epitopes are selected in the above method based on their predicted ability to bind to the patient's HLA class I / II alleles, i.e., selected in silico using a predictive HLA binding algorithm. After identifying relevant epitopes, the epitopes are ranked according to their ability to bind to the patient's HLA class I / II alleles, and the epitopes predicted to bind best are selected for inclusion in the antigenic units of the test construct.

[0250] Any suitable HLA binding algorithm may be used, for example one of the following: Available software analyses of peptide-MHC binding (IEDB, NetMHCpan and NetMHCIIpan) may be downloaded or used online from the following websites: www.iedb.org / services.healthtech.dtu.dk / service.php?NetMHCpan-4.0 services.healthtech.dtu.dk / service.php?NetMHCIIpan-3.2 Ready-to-use tolerance-inducing constructs The antigenic unit of the ready-to-use tolerance-inducing construct preferably comprises one or more regions of the antigen that contain minimal T cell epitope hotspots, i.e. multiple minimal T cell epitopes (e.g. having a length of 8-15 amino acids) predicted to be presented by different HLA alleles to cover a broad range of subjects, e.g. ethnic groups or even the world population.

[0251] The inclusion of such hotspots maximizes the likelihood that the construct will induce tolerance in a broad range of subjects.

[0252] Further description of antigenic units The T cell epitopes contained in the antigenic units of the constructs of the present disclosure have a length of 7 to about 200 amino acids, and longer T cell epitopes optionally contain minimal epitope hotspots.

[0253] In some embodiments, the antigenic unit comprises a T cell epitope having a length of 7 to 150 amino acids, preferably 7 to 100 amino acids, for example, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids, such as about 10 to about 100 amino acids, or about 15 to about 100 amino acids, or about 20 to about 75 amino acids, or about 25 to about 50 amino acids.

[0254] A T cell epitope having a length of about 60 to 200 amino acids may be divided into shorter sequences and included in an antigen unit separated by a linker as described herein. For example, a T cell epitope having a length of 150 amino acids may be divided into three sequences of 50 amino acids each and included in an antigen unit with a linker separating the three sequences from each other.

[0255] In some embodiments, the length of one T cell epitope is such that the protein is not folded correctly. For example, Fel d 1, the most prominent cat allergen, is a protein formed by two heterodimers, each dimer consisting of two chains, chain 1 containing 70 amino acid residues and chain 2 containing 90 or 92 residues. Including long T cell epitopes of both chains in an antigenic unit may result in correct folding of the protein and may induce an allergic reaction if two or more IgEs on the mast cells and basophils of a subject bind to the antigenic unit of the construct.

[0256] If a longer T cell epitope is included in the antigenic unit, protein folding may be tested in vitro, for example by ELISA using an antibody against the protein (e.g., a cat allergen) to determine whether the antibody binds to the T cell epitope.

[0257] In some embodiments, the T cell epitope has a length suitable for presentation by MHC (major histocompatibility complex). There are two major classes of MHC molecules, MHC class I and MHC II. The terms MHC class I and MHC class II are used interchangeably herein with HLA class I and HLA class II. HLA (human leukocyte antigen) is the major histocompatibility complex in humans. Thus, in a preferred embodiment, the antigen unit comprises a T cell epitope having a length suitable for specific presentation on MHC class I or MHC class II. In some embodiments, the T cell epitope has a length of 7-11 amino acids for MHC class I presentation. In other embodiments, the T cell epitope sequence has a length of 9-60 amino acids, such as 9-30 amino acids, such as 15-60 amino acids, such as 15-30 amino acids, for MHC class II presentation. In a preferred embodiment, the T cell epitope has a length of 15 amino acids for MHC class II presentation.

[0258] The number of T cell epitopes in an antigenic unit may vary and will depend on other elements included in the antigenic unit, such as the length and number of T cell epitope linkers described in this application.

[0259] In some embodiments, the antigenic unit contains up to 3500 amino acids, for example, 60 to 3500 amino acids, for example, about 80 or about 100 or about 150 amino acids to about 3000 amino acids, for example, about 200 to about 2500 amino acids, for example, about 300 to about 2000 amino acids or about 400 to about 1500 amino acids or about 500 to about 1000 amino acids.

[0260] In some embodiments, an antigenic unit comprises 1 to 10 T cell epitopes, such as 1, 2, 3, 4, 5, 6, 7, 8, or 9 or 10 T cell epitopes, or 11 to 20 T cell epitopes, such as 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 T cell epitopes, or 21 to 30 T cell epitopes, such as 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 108, 1 3, 24, 25, 26, 27, 28, 29 or 30 T cell epitopes, or 31 to 40 T cell epitopes, for example, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 T cell epitopes, or 41 to 50 T cell epitopes, for example, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 T cell epitopes. In other embodiments, the antigenic unit comprises 1 to 3 T cell epitopes, such as 1, 2, 3 or 1 to 5 T cell epitopes, such as 1, 2, 3, 4, 5 or 3 to 6 T cell epitopes, such as 3, 4, 5, 6 or 5 to 15 T cell epitopes, such as 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 T cell epitopes, or 7 to 17 T cell epitopes, such as 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or 17 T cell epitopes, or 9 to 19 T cell epitopes, such as 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19 T cell epitopes.

[0261] In some embodiments, the T cell epitopes are randomly arranged in the antigenic unit. In other embodiments, one or more of the following methods for arranging them in the antigenic unit may be used:

[0262] In some embodiments, the T cell epitopes are arranged in order from more antigenic to less antigenic in the direction from the multimerization / dimerization unit to the termini of the antigenic unit (see FIG. 1). Alternatively, particularly where hydrophilicity / hydrophobicity varies widely between T cell epitopes, the most hydrophobic T cell epitopes may be located substantially in the center of the antigenic unit and the most hydrophilic T cell epitopes are located closest to the termini of the multimerization / dimerization unit or antigenic unit.

[0263] In some embodiments, the T cell epitopes are arranged in order from more antigenic to less antigenic in the direction from the multimerization unit to the termini of the antigenic unit. Alternatively, particularly where hydrophilicity / hydrophobicity varies widely between T cell epitopes, the most hydrophobic T cell epitopes may be located substantially in the center of the antigenic unit and the most hydrophilic T cell epitopes are located closest to the termini of the multimerization unit or antigenic unit.

[0264] In some embodiments, the T cell epitopes are arranged in order from more antigenic to less antigenic in the direction from the dimerization unit to the termini of the antigenic unit (see FIG. 1). Alternatively, particularly where hydrophilicity / hydrophobicity varies widely between T cell epitopes, the most hydrophobic T cell epitopes may be located substantially in the center of the antigenic unit and the most hydrophilic T cell epitopes are located closest to the termini of the dimerization unit or antigenic unit.

[0265] Since true central positioning of an antigenic unit is only possible if the antigenic unit contains an odd number of T cell epitopes, the term "substantially" in this context refers to an antigenic unit that contains an even number of T cell epitopes, with the most hydrophobic T cell epitope being positioned as close to the center as possible.

[0266] As an example, an antigenic unit may contain five T cell epitopes, arranged as follows: 1-2-3 * -4-5;1,2,3 * , 4 and 5 are different T cell epitopes, and - is a T cell epitope linker; * indicates the most hydrophobic T cell epitope located in the center of the antigenic unit.

[0267] In another example, the antigenic unit contains six T cell epitopes, which are arranged as follows: 1-2-3 * - 4-5-6, or arranged as follows: 1-2-4-3 * -5-6;1,2,3 * , 4, 5 and 6 are T cell epitopes, and - is a T cell epitope linker; * indicates the most hydrophobic T cell epitope located essentially in the center of the antigenic unit.

[0268] Alternatively, the T cell epitopes may alternate between hydrophilic and hydrophobic T cell epitopes. Optionally, the GC-rich T cell epitopes are arranged to avoid GC clusters. In a preferred embodiment, the GC-rich T cell epitopes are arranged such that there is at least one non-GC-rich T cell epitope between them. In some embodiments, the GC-rich sequences encoding the T cell epitopes are arranged such that there is at least one non-GC-rich T cell sequence between them. A GC-rich sequence is a sequence with a GC content of 60% or more, such as 65% or more, such as 70% or more, such as 75% or more, such as 80% or more.

[0269] When an antigenic unit contains multiple T cell epitopes, the epitopes are preferably separated by T cell epitope linkers. This ensures that each T cell epitope is presented to the immune system in an optimal manner. When an antigenic unit contains n T cell epitopes, it preferably contains n-1 T cell epitope linkers that separate each T cell epitope from one or two other T cell epitopes.

[0270] The T cell epitope linker is designed to be non-immunogenic and is preferably also a flexible linker that allows the T cell epitopes to be presented to the immune system in an optimal manner, even when the antigenic unit contains multiple T cell epitopes.

[0271] Preferably, the T cell epitope linker is a peptide consisting of 4 to 20 amino acids, for example, 5 to 20 amino acids or 5 to 15 amino acids, or 8 to 20 amino acids or 8 to 15 amino acids, for example, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids, 10 to 15 amino acids, or 8 to 12 amino acids, for example, 8, 9, 10, 11, or 12 amino acids. In a specific embodiment, the T cell epitope linker consists of 10 amino acids.

[0272] All T cell epitope linkers contained in an antigen unit are preferably identical.However, if one or more of the T cell epitopes contain a sequence similar to that of the linker, it may be advantageous to replace adjacent T cell epitope linkers with linkers of different sequences.In addition, if it is predicted that the T cell epitope / linker junction constitutes an epitope by itself, it is preferable to use T cell epitope linkers of different sequences.

[0273] Preferably, the T cell epitope linker is a serine (S) and / or glycine (G) rich linker, i.e. a linker containing several serine and / or several glycine residues. Preferred examples are GGGGSGGGSS (SEQ ID NO: 75), GGGSG (SEQ ID NO: 76), GGGGS (SEQ ID NO: 77), SGSSGS (SEQ ID NO: 78), GGSGG (SEQ ID NO: 79), or several variants thereof, such as GGGGSGGGGS (SEQ ID NO: 80), (GGGGS)m (SEQ ID NO: 81), (GGGS)m (SEQ ID NO: 82), (GGSGG)m (SEQ ID NO: 161), (GGGSG)m (SEQ ID NO: 83) or (SGSSGS)m (SEQ ID NO: 84), where m is an integer from 1 to 5, for example 1, 2, 3, 4 or 5. In a preferred embodiment, m is 2. In other preferred embodiments, the serine and / or glycine rich linker further comprises at least one leucine (L) residue, such as at least one or at least two or at least three leucine residues, such as 1, 2, 3 or 4 leucine residues.

[0274] In some embodiments, the T cell epitope linker comprises or consists of LGGGS (SEQ ID NO: 85), GLGGS (SEQ ID NO: 86), GGLGS (SEQ ID NO: 87), GGGLS (SEQ ID NO: 88), or GGGGL (SEQ ID NO: 89). In other embodiments, the T cell epitope linker comprises or consists of LGGSG (SEQ ID NO: 90), GLGSG (SEQ ID NO: 91), GGLSG (SEQ ID NO: 92), GGGLG (SEQ ID NO: 93), or GGGSL (SEQ ID NO: 94). In yet other embodiments, the T cell epitope linker comprises or consists of LGGSS (SEQ ID NO: 95), GLGSS (SEQ ID NO: 96), or GGLSS (SEQ ID NO: 97).

[0275] In other embodiments, the T cell epitope linker comprises or consists of LGLGS (SEQ ID NO: 98), GLGLS (SEQ ID NO: 99), GLLGS (SEQ ID NO: 100), LGGLS (SEQ ID NO: 101), GLGGL (SEQ ID NO: 102) or (GLGGL)m (SEQ ID NO: 162). In other embodiments, the T cell epitope linker comprises or consists of LGLSG (SEQ ID NO: 103), GLLSG (SEQ ID NO: 104), GGLSL (SEQ ID NO: 105), GGLLG (SEQ ID NO: 106) or GLGSL (SEQ ID NO: 107). In other embodiments, the T cell epitope linker comprises or consists of LGLSS (SEQ ID NO: 108) or GGLLS (SEQ ID NO: 109).

[0276] In another embodiment, the T cell epitope linker is a serine-glycine linker having a length of 10 amino acids and containing one or two leucine residues.

[0277] In some embodiments, the T cell epitope linker comprises or consists of LGGGSGGGGS (SEQ ID NO: 110), GLGGSGGGGS (SEQ ID NO: 111), GGLGSGGGGS (SEQ ID NO: 112), GGGLSGGGGS (SEQ ID NO: 113), or GGGGLGGGGS (SEQ ID NO: 114). In other embodiments, the T cell epitope linker comprises or consists of LGGSGGGGSG (SEQ ID NO: 115), GLGSGGGGSG (SEQ ID NO: 116), GGLSGGGGSG (SEQ ID NO: 117), GGGLGGGGSG (SEQ ID NO: 118), or GGGSLGGGSG (SEQ ID NO: 119). In other embodiments, the T cell epitope linker comprises or consists of LGGSSGGGSS (SEQ ID NO: 120), GLGSSGGGSS (SEQ ID NO: 121), GGLSSGGGSS (SEQ ID NO: 122), GGGLSGGGSS (SEQ ID NO: 123), or GGGSLGGGSS (SEQ ID NO: 124).

[0278] In further embodiments, the T cell epitope linker comprises or consists of LGGGSLGGGS (SEQ ID NO: 125), GLGGSGLGGS (SEQ ID NO: 126), GGLGSGGLGS (SEQ ID NO: 127), GGGLSGGGLS (SEQ ID NO: 128), or GGGGLGGGGL (SEQ ID NO: 129). In other embodiments, the T cell epitope linker comprises or consists of LGGSGLGGGSG (SEQ ID NO: 130), GLGSGGLGGSG (SEQ ID NO: 131), GGLSGGGLSG (SEQ ID NO: 132), GGGLGGGGLG (SEQ ID NO: 133), or GGGSLGGGSL (SEQ ID NO: 134). In other embodiments, the T cell epitope linker comprises or consists of LGGSSLGGSS (SEQ ID NO: 135), GLGSSGLGSS (SEQ ID NO: 136), GGLSSGGLSS (SEQ ID NO: 137).

[0279] In other embodiments, the T cell epitope linker comprises or consists of GSGGGA (SEQ ID NO:138), GSGGGAGSGGGA (SEQ ID NO:139), GSGGGAGSGGGAGSGGGA (SEQ ID NO:140), GSGGGAGSGGGAGSGGGAGSGGGA (SEQ ID NO:141) or GENLYFQSGG (SEQ ID NO:142). In yet other embodiments, it comprises or consists of SGGGSSGGGS (SEQ ID NO:143), GGGGSGGGGS (SEQ ID NO:80), SSGGGSSGGG (SEQ ID NO:144), GGSGGGGSGG (SEQ ID NO:145), GSGSGSGSGS (SEQ ID NO:146), GGGSGGGGSSG (SEQ ID NO:147), GGGSSS (SEQ ID NO:148), GGGSSGGGSSGGGSS (SEQ ID NO:149) (SEQ ID NO) or GLGGLAAA (SEQ ID NO:150).

[0280] In other embodiments, the T cell epitope linker is a rigid linker. Such a rigid linker may be useful to efficiently separate (larger) antigens and prevent them from interfering with each other. In one embodiment, the subunit linker comprises or consists of KPEPKPAPAPKP (SEQ ID NO: 163), AEAAAKEAAAKA (SEQ ID NO: 164), (EAAAK)mGS (SEQ ID NO: 165), EAAK)mGS (SEQ ID NO: 39), PSRLEEELRRRLTEP (SEQ ID NO: 166) or SACYCELS (SEQ ID NO: 167).

[0281] In another embodiment, the T cell epitope linker comprises or consists of the sequence TQKSLSLSPGKGLGGL (SEQ ID NO: 151). In another embodiment, the T cell epitope linker comprises or consists of the sequence SLSLSPGKGLGGL (SEQ ID NO: 168). In another embodiment, the T cell epitope linker comprises or consists of AAY or GPGPG (SEQ ID NO: 153).

[0282] In other embodiments, the T cell epitope linker is a GSAT linker, i.e., a linker comprising one or more glycine, serine, alanine, and threonine residues, for example, a linker comprising or consisting of the sequence GGSAGGSGSGSSGGSSGASGTGTAGGTGSGSGTGSG (SEQ ID NO: 154) or a SEG linker, i.e., a linker comprising one or more serine, glutamic acid, and glycine residues, for example, a linker comprising or consisting of the sequence GGSGGGSEGGGSEGGGSEGGGSEGGGSEGGGSGGGS (SEQ ID NO: 155) or ELKTPLGDTTHT (SEQ ID NO: 19).

[0283] In other embodiments, the T cell epitope linker is a cleavable linker, e.g., a linker that includes one or more recognition sites for endopeptidases, such as furin, caspases, cathepsins, etc. Cleavable linkers may be introduced to release free functional protein domains (e.g., encoded by larger antigens), which may overcome steric hindrance between such domains, such as reduced biological activity, altered biodistribution, or other disadvantages due to interference of such domains.

[0284] Examples of T cell epitope linkers are disclosed in paragraphs

[0098] to

[0099] and the listed sequences (in particular SEQ ID NOs: 37 to 65 and SEQ ID NOs: 67 to 76) of WO 2020 / 176797(A1), which is incorporated herein by reference, and in paragraphs

[0135] to

[0139] of U.S. Patent Application Publication No. 2019 / 0022202(A1), which is incorporated herein by reference.

[0285] Allergens The tolerance-inducing constructs described herein are useful for inducing tolerance to a range of different protein allergens, including, for example, protein allergens that are subject to post-translational modifications, which may be encoded by nucleic acid sequences contained in the polynucleotides of the constructs of the present disclosure.

[0286] In some embodiments, the allergen is a food allergen. In some embodiments, the allergen is a crustacean allergen. In some embodiments, the allergen is tropomyosin, and in other embodiments, the allergen is arginine kinase, myosin light chain, sarcoplasmic reticulum calcium binding protein, troponin C, or triosephosphate isomerase, or actin. In some embodiments, the allergen is Pan b 1. In some embodiments, the antigenic unit is Pan b 1 T cell epitope (251-270).

[0287] In some embodiments the allergen is a cow's milk allergen, hi some embodiments the cow's milk allergen is Bos d 4, Bos d 5, Bos d 6, Bos d 7, Bos d 8, Bos d 9, Bos d 10, Bos d 11, or Bos d 12.

[0288] In some embodiments, the allergen is an egg allergen, hi some embodiments, the egg allergen is ovomucoid, and in other embodiments, the egg allergen is ovalbumin, ovotransferrin, conalbumin, Gal 3 3, egg lyaozyme, or ovomucin.

[0289] One T cell epitope known in the art and that has been studied in relation to egg allergy is OVA(257-264), which has the amino acid sequence SIINFEKL (SEQ ID NO: 168).

[0290] In some embodiments, the antigenic unit of the construct according to the present disclosure comprises the T cell epitope OVA(257-264). A pharmaceutical composition comprising said T epitope may be used for the treatment of egg allergy.

[0291] In some embodiments, the allergen is a fish allergen. In some embodiments, the fish allergen is parvalbumin. In other embodiments, the fish allergen is enolase, aldolase, or vitellogenin. In some embodiments, the allergen is a fruit allergen. In some embodiments, the fruit allergen is pathogenesis-associated protein 10, profilin, nsLTP, thaumatin-like protein, gibberellin regulatory protein, isoflavone reductase-related protein, class 1 chitinase, beta 1,3 glucanase, germin-like protein, alkaline serine protease, pathogenesis-associated protein 1, actinidin, phytocyctatin, quiwellin, major latex protein, cucin, or 2S albumin. In some embodiments, the allergen is a vegetable allergen. In some embodiments, the vegetable allergen is pathgenesis-related protein 10, profilin, nsLTP type 1, nsLTP type 2 protein, osmotin-like protein, isoflavone reductase-like protein, β-fructofuranosidase, PR protein TSI-1, cyclophilin, or FAD-containing oxidase.

[0292] In some embodiments, the allergen is a wheat allergen. In some embodiments, the wheat allergen is Tri a 12, Tri a 14, Tri a 15, Tri a 18, Tri a 19, Tri a 20, Tri a 21, Tri a 25, Tri a 26, Tri a 27, Tri a 28, Tri a 29, Tri a 30, Tri a 31, Tri a 32, Tri a 33, Tri a 34, Tri a 35, Tri a 36, ​​Tri a 37, or Tri a 38. In some embodiments, the allergen is a soybean allergen. In some embodiments, the soybean allergen is Gly m 1, Gly m 2, Gly m 3, Gly m 4, Gly m 5, Gly m 6, Gly m 7, or Gly m 8. In other embodiments, the soybean allergen is Gly m agglutinin, Gly m Bd28K, Gly m 30 kD, Gly m CPI, or Gly m TI. In some embodiments, the allergen is a peanut allergen. In some embodiments, the peanut allergen is Ara h 1, Ara h 2, Ara h 3, Ara h 5, Ara h 6, Ara h 7, Ara h 8, Ara h 9, Ara h 10, Ara h 11, Ara h 12, Ara h 13, Ara h 14, Ara h 15, Ara h 16, or Ara h 17. In some embodiments, the allergen is a nut or seed allergen. In some embodiments, the allergen is 11S globulin, 7S globulin, 2S globulin, PR10, PR-14 nsLTP, oleosin, or profilin.

[0293] In other embodiments, the food allergens are buckwheat, celery, color additives, garlic, gluten, oats, legumes, corn, mustard, poultry, meat, rice, and sesame.

[0294] In some embodiments, the allergen is a bee venom allergen. In some embodiments, the bee venom allergen is phospholipase A2, hyaluronidase, acid phosphatase, melittin, allergen C / DPP, CRP / lcarapin, or vitellogenin. In some embodiments, the allergen is a vespid allergen. In some embodiments, the vespid allergen is phospholipase A1, hyaluronidase, protease, antigen 5, DPP IV, or vitellogenin.

[0295] In some embodiments, the allergen is a latex allergen, hi some embodiments, the latex allergen is Hev b 1, Hev b 2, Hev b 3, Hev b 4, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10, Hev b 11, Hev b 12, Hev b 13, Hev b 14, or Hev b 15.

[0296] In some embodiments, the allergen is a storage mite allergen. In some embodiments, the allergen is a dust mite allergen. In some embodiments, the allergen is a storage dust allergen. In some embodiments, the dust mite allergen is Der p 1, Der p 2, Der p 3, Der p 4, Der p 5, Der p 7, Der p 8, Der p 10, Der p 11, Der p 21, or Der p 23. In some embodiments, the antigenic unit is Der p 1 T cell epitope (111-139). In some embodiments, the dust mite allergen is Der f 1, Der f 2, Der f 3, Der f 7, Der f 8, or Der f 10. In some embodiments, the dust mite allergen is Blot t 1, Blot t 2, Blot t 3, Blot t 4, Blot t 5, Blot t 8, Blot t 10, Blot t 12, or Blot t 21.

[0297] In some embodiments, the allergen is a cockroach allergen. In some embodiments, the cockroach allergen is Bla g 1, Bla g 2, Bla g 3, Bla g 4, Bla g 5, Bla g 6, Bla g 7, Bla g 8, or Bla g 11. In some embodiments, the cockroach allergen is Per a 1, Per a 2, Per a 3, Per a 6, Per a 7, Per a 9, or Per a 10.

[0298] In some embodiments, the allergen is a mold allergen. In some embodiments, the mold allergen is an Aspergillus fumigatus allergen. In some embodiments, the Aspergillus fumigatus allergen is Asp f 1, Asp f 2, Asp f 3, Asp f 4, Asp f 5, Asp f 6, Asp f 7, Asp f 8, Asp f 9, Asp f 10, Asp f 11, Asp f 12, Asp f 13, Asp f 14, Asp f 15, Asp f 16, Asp f 17, Asp f 18, Asp f 22, Asp f 23, Asp f 27, Asp f 28, Asp f 29, or Asp f 34.

[0299] In some embodiments, the allergen is a fungal allergen. In some embodiments, the fungal allergen is a Malassezia allergen. In some embodiments, the Malassezia allergen is Mala f 1, Mala f 2, Mala f 3, Mala f 4, Mala f 5, Mala f 6, Mala f 7, Mala f 8, Mala f 9, Mala f 10, Mala f 11, Mala f 12, or Mala f 13, or MGL_1204.

[0300] In some embodiments, the allergen is a furry animal allergen. In some embodiments, the allergen is a dog allergen. In some embodiments, the dog allergen is Can f 1, Can f 2, Can f 3, Can f 4, Can f 5, or Can f 6. In some embodiments, the allergen is a horse allergen. In some embodiments, the horse allergen is Ecu c 1, Ecu c 2, Ecu c 3, or Ecu c 4. In some embodiments, the allergen is a cat allergen. In some embodiments, the cat allergen is Fel d 1, Fel d 2, Fel d 3, Fel d 4, Fel d 5, Fel d 6, Fel d 7, or Fel d 8. In some embodiments, the allergen is a laboratory animal allergen. In some embodiments, the allergen is lipocalin, urinary prealbumin, secretoglobulin, or serum albumin.

[0301] In some embodiments, the allergen is a pollen allergen. In some embodiments, the allergen is a grass pollen allergen. In some embodiments, the grass pollen allergen is Timothy grass, Orchard grass, Kentucky bluegrass, Perennial rye, American silvergrass, Johnson grass, or Corn grass allergen. In some embodiments, the grass pollen allergen is Phl p 1, Phl p 2, Phl p 3, Phl p 4, Phl p 5, Phl p 6, Phl p 7, Phl p 11, Phl p 12, or Phl p 13.

[0302] In some embodiments, the allergen is a tree pollen allergen, hi some embodiments, the tree pollen allergen is an alder, birch, hornbeam, hazel, European hazel, chestnut, European beech, white oak, ash, privet, olive, lilac, cypress, or cedar pollen allergen. In some embodiments, the tree pollen allergen is Aln g 1 or Aln g 4, Bet v 1, Bet v 2, Bet v 3, Bet v 4, Bet v 6 or Bet v 7, Car b 1, Cor a 1, Cor a 2, Cor a 6, Cor a 8, Cor a 9, Cor a 10, Cor a 11, Cor a 12, Cor a 13, Cor a 14, Ost c 1, Cas 1, Cas 15, Cas 18, or Cas 19, Fag s 1, Que a 1, Fra e 1, Lig v 1, Ole e 1, Ole e 2, Ole e 3, Ole e 4, Ole e 5, Ole e 6, Ole e 7, Ole e 8, Ole e 9, Ole e 10, Ole e 11, or Ole e 12, Syr v 1, Cha o 1, Cha o 2, Cry j 1, Cry j 2, Cup s 1, Cup s 3, Jun a 1, Jun a 2, Jun a 3, Jun o 4, Jun v 1, Jun v 3, Pla a 1, Pla a 2, or Pla a 3, or Pla or 1, Pla or 2, or Pla or 3. In some embodiments the antigenic unit is Bet v 1 T cell epitope (139-152).

[0303] In some embodiments, the allergen is a weed pollen allergen. In some embodiments, the weed allergen is a ragweed, artemisia, sunflower, feverfew, pellitory, plantain lanceolata, annual mercury, pigweed, Russian thistle, or amaranth pollen allergen. In some embodiments, the ragweed pollen allergen is Amb a 1, Amb a 4, Amb a 6, Amb a 8, Amb a 9, Amb a 10, or Amb a 11. In some embodiments, the artemisia pollen allergen is Art v 1, Art v 3, Art v 4, Art v 5, or Art v 6. In some embodiments, the sunflower pollen allergen is Hel a 1 or Hel a 2. In some embodiments, the pellitory pollen allergen is Par j 1, Par j 2, Par j 3, or Par j 4. In some embodiments, the Plantago lanceolata pollen allergen is Pla l 1. In some embodiments, the annual mercury pollen allergen is Mer a 1. In some embodiments, the Chenopodium album pollen allergen is Che a 1, Che a 2, or Che a 3. In some embodiments, the Russian thistle pollen allergen is Sal k 1, Sal k 4, or Sal k 5. In some embodiments, the amaranth pollen allergen is Ama r 2.

[0304] In yet other embodiments, the allergen is selected from environmental allergens such as insects, cockroaches, house dust mites, or molds.

[0305] In some embodiments, the allergic disease is allergic rhinitis, asthma, atopic dermatitis, allergic gastrointestinal disease, contact dermatitis, drug allergy, or a combination thereof.

[0306] Allergies to drugs affect more than 7% of the general population. The constructs of the present disclosure induce tolerance to immunogenic epitopes present in such drugs, thereby allowing affected patients to continue and benefit from drug treatment.

[0307] Thus, in some embodiments, the allergen is included in the drug with unwanted immunogenicity. In some embodiments, the allergen is factor VIII. In some embodiments, the allergen is insulin. In some embodiments, the allergen is one or more monoclonal antibodies used in therapy.

[0308] autoantigen In other embodiments, the tolerogenic constructs contain T cell epitopes contained in autoallergens involved in autoimmune disease, allowing antigen-specific downregulation of the part of the immune system responsible for autoimmune disease, without inhibiting the immune system in general.

[0309] In some embodiments, the autoimmune disease is multiple sclerosis (MS). In some embodiments, the autoantigen is myelin oligodendrocyte glycoprotein (MOG). In other embodiments, the autoantigen is MAG, MOBP, CNPase, S100 beta, or transaldolase. In some embodiments, the autoantigen is myelin basic protein (MBP). In some embodiments, the autoantigen is myelin proteolipid protein (PLP).

[0310] In the examples, we provide constructs for multiple sclerosis that contain either short (35-55 amino acids) or longer (27-63 amino acids) T cell epitopes derived from myelin oligodendrocyte glycoprotein (MOG). MOG is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system. MOG(35-55) can induce autoantibody production and relapsing-remitting neurological disease, causing widespread plaque-like demyelination. Autoantibody responses against MOG(35-55) have been observed in MS patients, and MOG(35-55)-induced experimental autoimmune encephalomyelitis (EAE) has been observed in C57 / BL6 mice and Lewis rats.

[0311] Other MS-associated T-cell epitopes known and studied in the art include the following: [Table 1] * T cell epitope-induced EAE was observed. In a preferred embodiment, the antigenic unit of the construct of the present disclosure comprises one or more T cell epitopes selected from the group consisting of MOG(35-55), MOG(27-63), PLP(139-151), PLP(131-159), PLP(178-191), PLP(170-199), MBP(84-104) and MBP(76-112). Pharmaceutical compositions comprising such constructs may be used in the treatment of MS.

[0312] In some embodiments, the autoimmune disease is type 1 diabetes. In some embodiments, the autoantigen is glutamic acid decarboxylase 65-kilodalton isoform (GAD65), which is an autoantigen involved in type 1 diabetes. In some other embodiments, the autoantigen is insulin, IA-2, or ZnT8. In yet some other embodiments, the autoantigen is IGRP, ChgA, IAPP, peripherin, tetraspanin-7, GRP78, urocortin-3, or insulin gene enhancer protein isl-1.

[0313] In some embodiments, the autoimmune disease is celiac disease. In some embodiments, the autoantigen is α-gliadin, γ-gliadin, ω-gliadin, low molecular weight glutenin, high molecular weight glutenin, hordein, secalin, or avenin b. In some embodiments, the antigenic unit comprises the T cell epitope α-gliadin(76-95).

[0314] In some embodiments, the autoimmune disease is rheumatoid arthritis. In some embodiments, the autoantigen is collagen. In some embodiments, the autoantigen is heat shock protein 60 (HSP60). In some embodiments, the autoantigen is Band 3. In some embodiments, the autoantigen is small nuclear ribonucleoprotein D1 (SmD1). In some embodiments, the autoantigen is acetylcholine receptor (AChR). In some embodiments, the autoantigen is myelin protein 0 (P0).

[0315] In some embodiments, the autoimmune disease is chronic inflammatory demyelinating polyradiculoneuropathy (CIDP) and the autoantigen is neurofascin 155. In other embodiments, the autoimmune disease is Hashimoto's thyroiditis (HT) and the autoantigen is thyroid peroxidase and / or thyroglobulin. In other embodiments, the autoimmune disease is pemphigus foliaceus and the autoantigen is desmosome-associated glycoprotein. In other embodiments, the autoimmune disease is pemphigus vulgaris and the autoantigen is desmoglein 3. In other embodiments, the autoimmune disease is thyroid eye disease (TED) and the autoantigen is calcium-binding protein (calsequestrin). In other embodiments, the autoimmune disease is Graves' disease and the autoantibody is thyroid-stimulating hormone receptor. In another embodiment, the autoimmune disease is primary biliary cirrhosis (PBC) and the autoantibody is antimitochondrial antibody (AMA), antinuclear antibody (ANA), rim-like / membrane (RL / M) and / or polynuclear dot (MND). In another embodiment, the autoimmune disease is myasthenia gravis and the autoantigen is acetylcholine receptor. In another embodiment, the autoimmune disease is insulin-resistant diabetes and the autoantigen is insulin receptor. In another embodiment, the autoimmune disease is immune-mediated hemolytic anemia and the autoantigen is red blood cells. In another embodiment, the autoimmune disease is rheumatoid arthritis and the autoantigen is citrullinated, homocitrullinated proteins and the Fc portion of IgG. In other embodiments, the autoimmune disease is psoriasis and the autoantigens are cathelicidin (LL-37), a disintegrin-like and metalloprotease domain-containing thrombospondin type 1 motif-like 5 (ADAMTSL5), phospholipase A2 group IVD (PLA2G4D), heterogeneous nuclear ribonucleoprotein A1 (hnRNP-A1), and keratin 17.

[0316] Signal peptide In some embodiments, the construct of the present disclosure is a polynucleotide further comprising a nucleotide sequence encoding a signal peptide. The signal peptide is located either at the N-terminus of the targeting unit or at the C-terminus of the targeting unit, depending on the orientation of the targeting unit in the polypeptide (Figure 1). The signal peptide is designed to allow the secretion of the polypeptide encoded by the nucleic acid contained in the polynucleotide in a cell transfected with the polynucleotide.

[0317] Any suitable signal peptide may be used. An example of a suitable peptide is the human Ig VH signal peptide or a signal peptide that is naturally present at the N-terminus of any of the targeting units described herein, such as the human signal peptide of human IL-10 or the human signal peptide of human TGFβ.

[0318] Thus, in some embodiments, the polynucleotide comprises a nucleotide sequence encoding a human IL-10 signal peptide, preferably a nucleotide sequence encoding a human IL-10 targeting unit, hi other embodiments, the polynucleotide comprises a nucleotide sequence encoding a human Ig VH signal peptide, preferably a nucleotide sequence encoding an scFv, such as human anti-DEC205.

[0319] In some embodiments the polynucleotide comprises a nucleotide sequence encoding a signal peptide comprising an amino acid sequence having at least 85%, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98%, or such as at least 99% sequence identity to the amino acid sequence of SEQ ID NO:6.

[0320] In a preferred embodiment, the polynucleotide comprises a nucleotide sequence encoding a signal peptide comprising the amino acid sequence of SEQ ID NO:6.

[0321] In another embodiment the polynucleotide comprises a nucleotide sequence encoding a signal peptide consisting of an amino acid sequence which has at least 80%, preferably at least 85%, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98% or such as at least 99% relative to the amino acid sequence of SEQ ID NO:6.

[0322] In another preferred embodiment, the polynucleotide comprises a nucleotide sequence encoding a signal peptide having the amino acid sequence of SEQ ID NO:6.

[0323] In some embodiments the signal peptide comprises or consists of the amino acid sequence of SEQ ID NO:6, wherein any one of the amino acids of the signal peptide is substituted, deleted or inserted for another amino acid, provided that no more than 5 amino acids, such as no more than 4 amino acids, such as no more than 3 amino acids, such as no more than 2 amino acids or no more than 1 amino acid are so substituted, deleted or inserted.

[0324] Sequence identity Sequence identity may be determined as follows: a high level of sequence identity indicates the likelihood that the second sequence is derived from the first sequence. Amino acid sequence identity requires identical amino acid sequences between two aligned sequences. Thus, a candidate sequence sharing 70% amino acid identity with a reference sequence requires that after alignment, 70% of the amino acids in the candidate sequence are identical to the corresponding amino acids in the reference sequence. Identity may be determined by computer analysis, such as, but not limited to, the ClustalW computer alignment program (Higgins D., Thompson J., Gibson T., Thompson JD, Higgins DG, Gibson TJ, 1994. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 22: 4673-4680) and the default parameters proposed therein. This program is used with its default settings to align the mature (biologically active) portions of the query and reference polypeptides. The number of perfectly conserved residues is counted and divided by the length of the reference polypeptide. In doing so, any tag or fusion protein sequences that form part of the query sequence are disregarded in the alignment and subsequent sequence identity determination.

[0325] The ClustalW algorithm may similarly be used to align nucleotide sequences. Sequence identity may be calculated in a similar manner as shown for amino acid sequences.

[0326] Another preferred mathematical algorithm used for comparing sequences is the algorithm of Myers and Miller, CABIOS (1989). Such an algorithm is incorporated in the ALIGN program (version 2.0), which is part of the FASTA sequence alignment software package (Pearson WR, Methods Mol Biol, 2000, 132:185-219). Align calculates sequence identity based on a global alignment. Align0 does not penalize gaps at the ends of the sequences. When using the ALIGN and Align0 programs to compare amino acid sequences, the BLOSUM50 substitution matrix is ​​preferably used, with gap opening / extension penalties of -12 / -2.

[0327] Amino acid sequence variants may be prepared by introducing appropriate changes into the nucleotide sequence encoding the tolerance-inducing construct or by peptide synthesis. Such modifications include, for example, deletion from and / or insertion into and / or substitution of residues within the amino acid sequence. The terms substituted / substitution, deleted / deletion and inserted / insertion used herein with respect to amino acid sequences and sequence identity are well known and clear to those skilled in the art. Any combination of deletion, insertion and substitution can be made to arrive at the final construct, so long as the final construct has the desired characteristics. For example, deletion, insertion or substitution of an amino acid residue may produce a silent change, resulting in a functionally equivalent peptide / polypeptide.

[0328] Deliberate amino acid substitutions may be made based on similarities in the polarity, charge, solubility, hydrophobicity, hydrophilicity, and / or amphipathic nature of the residues, so long as the secondary binding activity of the agent is maintained. For example, negatively charged amino acids include aspartic acid and glutamic acid; positively charged amino acids include lysine and arginine; and amino acids with uncharged polar head groups with similar hydrophilicity values ​​include leucine, isoleucine, valine, glycine, alanine, asparagine, glutamine, serine, threonine, phenylalanine, and tyrosine.

[0329] Included herein are conservative substitutions, i.e., homogeneous substitutions such as basic for basic, acidic for acidic, polar for polar, and non-conservative substitutions, i.e., substitutions of one class of residue for another class of residue, or involving the inclusion of unnatural amino acids such as ornithine, diaminobutyric acid ornithine, norleucine, ornithine, pyriylalanine, thienylalanine, naphthylalanine, and phenylglycine. Conservative substitutions that can be made, for example, are within the groups of basic amino acids (arginine, lysine, and histidine), acidic amino acids (glutamic acid and aspartic acid), aliphatic amino acids (alanine, valine, leucine, isoleucine), polar amino acids (glutamine, asparagine, serine, threonine), aromatic amino acids (phenylalanine, tryptophan, tyrosine), hydroxyl amino acids (serine, threonine), large amino acids (phenylalanine, tryptophan), and small amino acids (glycine, alanine).

[0330] Substitutions may also be made with non-natural amino acids, with the replacement residue being alpha * and alpha-disubstituted * Amino acids, N-alkyl amino acids * , lactic acid * , halide derivatives of natural amino acids, e.g. trifluorotyrosine * , p-CI-phenylalanine * , p-Br-phenylalanine * , pI-phenylalanine *, L-allylglycine * , β-alanine * , La-aminobutyric acid * , Ly-aminobutyric acid * , La-aminoisobutyric acid * , Le-aminocaproic acid * , 7-aminoheptanoic acid * , L-methionine sulfone * , L-norleucine * , L-Norvaline * , p-nitro-L-phenylalanine * , L-hydroxyproline * , L-thioproline * , methyl derivatives of phenylalanine (Phe), such as 4-methyl-Phe * , Pentamethyl-Phe * , L-Phe(4-amino)#, L-Tyr(methyl) * , L-Phe(4-isopropyl) * , L-Tic (l,2,3,4 tetrahydroisoquinoline-3-carboxylic acid) * , L-diaminopropionic acid * and L-Phe(4-benzyl) * Examples include:

[0331] In the above paragraph, * indicates the hydrophobicity of the substituted residue, # indicates the hydrophilicity of the substituted residue, * indicates the amphipathic nature of the substituted residue. The variant amino acid sequence may include suitable spacer groups that may be inserted between any two amino acid residues of the sequence, including alkyl groups such as methyl, ethyl or propyl groups, in addition to amino acid spacers such as glycine or β-alanine residues. A further variation involves the presence of one or more amino acid residues in peptoid form.

[0332] Polynucleotides The tolerance-inducing constructs of the present disclosure may be in the form of a polynucleotide.

[0333] A further aspect of the disclosure is a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide comprising, in a specified order: a. a first targeting unit, b. a first joining region; C. antigenic unit; d. a second bonding area; and e. a second targeting unit; and the antigen unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen.

[0334] The polynucleotide may be DNA or RNA, including genomic DNA, cDNA and mRNA, either double-stranded or single-stranded, hi a preferred embodiment, the construct is a DNA plasmid, i.e. the polynucleotide is DNA.

[0335] A polynucleotide is preferably optimized for use in the species to which it is administered. Thus, for administration to humans, the polynucleotide sequence is preferably human codon optimized.

[0336] Polypeptides and multimeric / dimeric proteins The tolerance-inducing constructs of the present disclosure may be in the form of a polypeptide encoded by the polynucleotides described above.

[0337] A further aspect of the present disclosure is a method for producing a method for manufacturing a semiconductor device comprising the steps of: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; wherein the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen.

[0338] The polypeptides may be expressed in vitro for the production of a tolerance-inducing construct, e.g., for the production of a pharmaceutical composition comprising the construct, or the polypeptides may be expressed in vivo as a result of administration of a polynucleotide to a subject, as described above. Due to the presence of the multimerization / dimerization units, a multimeric / dimeric protein is formed when the polypeptides are expressed, i.e., by linking multiple polypeptides via their respective multimerization / dimerization units.

[0339] Multimeric Proteins A further aspect of the present disclosure is a multimeric protein consisting of a plurality of polypeptides, each of which comprises, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; wherein the antigen unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen; The multiple polypeptides are linked to one another via their respective first junction regions and via their respective second junction regions.

[0340] Multimeric proteins may be prepared by expression of the polypeptides in vitro.

[0341] Thus, a further aspect of the present disclosure is a method for preparing a multimeric protein consisting of a plurality of polypeptides, each of the polypeptides being, in a specified order, a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; wherein the antigen unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen; The plurality of polypeptides are linked to one another via their respective first junction regions and via their respective second junction regions, and the method comprises: a. transfecting a cell with a polynucleotide comprising a nucleotide sequence encoding a polypeptide; b. Culturing the cells; c. harvesting the multimeric protein from the cells; d. isolating and purifying a fraction of the multimeric protein, wherein a plurality of polypeptides are linked to one another via their respective first junction regions and via their respective second junction regions.

[0342] Isolation and optional purification of the multimeric protein in step d. can be carried out by methods known in the art, including precipitation, differential solubilization and chromatography.

[0343] The multimeric proteins of the present disclosure may be used as active ingredients in protein vaccines for the prophylactic or therapeutic treatment of autoimmune diseases, allergic diseases and transplant rejection.

[0344] The multimeric / dimeric protein may be a homomultimer or a heteromultimer, for example, if the protein is a dimeric protein, the dimeric protein may be a homodimer, i.e. a dimeric protein in which the two polypeptide chains are identical and thus contain identical units and therefore antigenic sequences, or the dimeric protein may be a heterodimer comprising two polypeptide chains, where polypeptide chain 1 contains a different antigenic sequence in its antigenic unit than polypeptide chain 2. The latter may be relevant when the number of antigens to be included in an antigenic unit exceeds the upper size limit of the antigenic unit. Preferably, the dimeric protein is a homodimeric protein.

[0345] Dimeric Proteins A further aspect of the disclosure is a dimeric protein consisting of two polypeptides, each of which comprises, in the specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; wherein the antigen unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen; The two polypeptides are linked to each other via their respective first junction regions and via their respective second junction regions.

[0346] The dimeric protein may be prepared by expression of the polypeptide in vitro.

[0347] Thus, a further aspect of the present disclosure is a method for preparing a dimeric protein consisting of two polypeptides, each of which is, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; wherein the antigen unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen; The two polypeptides are linked to each other via their respective first junction regions and via their respective second junction regions, and the method comprises: a. transfecting a cell with a polynucleotide comprising a nucleotide sequence encoding a polypeptide; b. Culturing the cells; c. harvesting the dimeric protein from the cells; d. isolating and purifying a fraction of the dimeric protein, wherein the two polypeptides are linked to each other via their respective first junction regions and via their respective second junction regions.

[0348] Isolation and purification of the dimeric protein in step d) can be carried out by methods known in the art, including precipitation, differential solubilization and chromatography.

[0349] The dimeric protein of the present disclosure may be used as an active ingredient in protein vaccines for the prophylactic or therapeutic treatment of autoimmune diseases, allergic diseases and transplant rejection.

[0350] vector The polynucleotide sequence of the tolerance-inducing construct may be a DNA polynucleotide contained in a vector, i.e. an expression vector, such as a DNA plasmid or a viral vector, preferably a DNA plasmid, suitable for transfecting a host cell and expressing the polypeptide or multimeric / dimeric protein encoded by the polynucleotide. In another embodiment, the vector is suitable for transfecting a host cell and expressing an mRNA encoding the polypeptide or multimeric / dimeric protein.

[0351] The vector of the present invention may be any molecule suitable for carrying foreign nucleic acid sequences, such as DNA or RNA, into cells where they can be expressed, ie an expression vector.

[0352] In one embodiment, the vector is a DNA vector, such as a DNA plasmid, or a DNA viral vector, such as a DNA viral vector selected from the group consisting of adenovirus, vaccinia virus, adeno-associated virus, cytomegalovirus, and Sendai virus.

[0353] In another embodiment, the vector is an RNA vector, such as an RNA plasmid, or an RNA viral vector, such as a retroviral vector, for example a retroviral vector selected from the group consisting of an alphavirus, a lentivirus, a Moloney murine leukemia virus, and a rhabdovirus.

[0354] In a preferred embodiment, the vector is a DNA vector, more preferably a DNA plasmid.

[0355] Preferably, the vector allows easy exchange of the various units mentioned above, especially the antigen unit in the case of individualized tolerogenic constructs.

[0356] Thus, the disclosure provides a vector comprising a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being expressed in a specified order as follows: a. a first targeting unit, a first junction region; b. an antigenic unit that contains at least one T cell epitope; c. a second bonding region; and d. a second targeting unit, wherein the antigen unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen.

[0357] In some embodiments, the vector may be pALD-CV77, or any other vector that does not contain bacterial nucleotide sequences known to elicit an immune response in an undesirable manner when introduced into a subject. The antigen unit may be replaced with a convenient restriction enzyme restricted antigen unit cassette, for example, an SfiI restriction enzyme cassette whose 5' site incorporates a nucleotide sequence encoding a GLGGL (SEQ ID NO: 102) and / or GLSGL (SEQ ID NO: 40) unit linker and whose 3' site is included after a stop codon in the vector.

[0358] In a preferred embodiment, the vector is a DNA plasmid and the polynucleotide is DNA.

[0359] DNA Plasmids Plasmids are small extra-chromosomal DNA molecules within a cell that are physically separated from chromosomal DNA and can replicate independently. Plasmids are found primarily as small circular double-stranded DNA molecules in bacteria. However, plasmids occasionally exist in archaea and eukaryotes. Artificial plasmids are widely used as vectors in molecular cloning, serving for the delivery of recombinant DNA sequences within a host organism and to ensure their high expression. Plasmids contain several important features, including features for the selection of cells containing the plasmid, such as genes for antibiotic resistance, an origin of replication, a multiple cloning site (MCS), and a promoter for driving the expression of the inserted gene of interest.

[0360] Generally, a promoter is a sequence that can attract initiation factors and polymerase to the promoter so that the gene is transcribed. A promoter is located upstream of the DNA, near the transcription start site of the gene. A promoter can be about 100-1000 base pairs long. The nature of the promoter usually depends on the gene and transcript and the type or class of RNA polymerase that is recruited to the site. When the RNA polymerase reads the DNA of the plasmid, an RNA molecule is transcribed. After processing, when the ribosome translates the mRNA into a protein, the mRNA can be translated many times, thus resulting in many copies of the protein encoded by the gene of interest. Generally, the ribosome facilitates the decoding by inducing the binding of complementary tRNA anticodon sequences to the mRNA codons. The tRNA carries the specific amino acids that are chained together into a polypeptide as the mRNA passes through the ribosome and is "read" by the ribosome. Translation proceeds in three stages: initiation, elongation, and termination. Following the translation process, the polypeptide is either folded into an active protein and performs its function in the cell, or is exported from the cell and, optionally after a significant number of post-translational modifications, performs its function elsewhere.

[0361] If the protein is to be transported outside the cell, the signal peptide targets the protein to the endoplasmic reticulum, where it is cleaved and the protein is transported to the cell periphery after translation is terminated.

[0362] The DNA plasmids of the present invention are not limited to any particular plasmid, and one of skill in the art will understand that any plasmid having a suitable backbone can be selected and engineered by methods known in the art to contain the elements and units of the present disclosure.

[0363] host cell In some embodiments, the disclosure provides a host cell comprising the vector described herein.

[0364] In some embodiments, the present disclosure provides: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) providing a host cell comprising a vector containing the polynucleotide.

[0365] Suitable host cells include prokaryotic cells, yeast cells, insect cells or higher eukaryotic cells. In a preferred embodiment, the host cell is a human cell, preferably a cell of a human individual suffering from an immune disorder and in need of prophylactic or therapeutic treatment with the constructs of the present disclosure.

[0366] Polycistronic Vectors In some embodiments, the vector is a polycistronic vector allowing expression of a polypeptide of the present disclosure and, in addition, expression of one or more immunoinhibitory compounds as separate molecules.

[0367] A further aspect of the present disclosure is (A) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being in a specified order, a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide, the antigenic unit comprising one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; (B) one or more nucleic acid sequences encoding one or more immunoinhibitory compounds, The vector allows for the co-expression of the polypeptide and one or more immunosuppressive compounds as separate molecules.

[0368] The one or more immunoinhibitory compounds help to create or promote an environment that favors the presentation of epitopes in an antigenic unit in a tolerance-inducing manner or, for example, by favoring the induction of or helping to maintain cells that maintain tolerance.

[0369] The polycistronic vector of the present disclosure may be any suitable vector, for example, a DNA plasmid or a viral vector, for example, a retroviral vector. In a preferred embodiment, the vector is a polycistronic DNA plasmid. The polycistronic vector of the present disclosure is illustrated by considering a DNA plasmid (i.e., the polycistronic DNA plasmid of the present disclosure), but it is understood that the discussion also applies to other vectors, for example, viral vectors.

[0370] Polycistronic plasmids are known in the art, thus one of skill in the art can design and construct a polycistronic plasmid of the present disclosure.

[0371] In a preferred embodiment, the polycistronic plasmid of the present disclosure contains one or more coexpression elements, i.e., nucleic acid sequences that allow for the coexpression of a polypeptide from the plasmid and one or more immunoinhibitory compounds as separate molecules.

[0372] In some embodiments of the present disclosure, the polycistronic plasmid contains co-expression elements that cause the polypeptide and one or more immunoinhibitory compounds to be transcribed on a single transcript but independently translated into the polypeptide and one or more immunoinhibitory compounds. Thus, the presence of the co-expression elements results in the final production of separate translation products.

[0373] In some embodiments, such a co-expression element is an IRES element (internal ribosome entry site). In other embodiments, such a co-expression element is a 2A self-cleaving peptide (2A peptide). Both co-expression elements are known in the art.

[0374] When two or more immunoinhibitory compounds are expressed from a polycistronic plasmid of the present disclosure, an IRES element and / or 2A peptide must be present in the plasmid, e.g., upstream of each nucleic acid sequence encoding an immunoinhibitory compound.

[0375] In other embodiments, the polycistronic plasmid contains coexpression elements that cause the polypeptide and one or more immunoinhibitory compounds to be transcribed as separate transcripts, resulting in separate transcription products and thus separate proteins.

[0376] In some embodiments, such a co-expression element is a bidirectional promoter.

[0377] In other embodiments, such co-expression elements are different promoters, i.e., the polycistronic plasmid contains a promoter for each of the nucleotide sequences encoding either a polypeptide or one or more immunoinhibitory compounds, both of which are known in the art.

[0378] The above co-expression elements can be combined in any manner, i.e. a polycistronic plasmid of the present disclosure may contain one or several of such same or different co-expression elements.

[0379] immunoinhibitory compounds The polycistronic plasmids of the present disclosure contain one or more nucleic acid sequences encoding one or more immunoinhibitory compounds.

[0380] In some embodiments of the present disclosure, the immunoinhibitory compound is a compound known to induce, increase or maintain immune tolerance.

[0381] In some embodiments of the present disclosure, the immunoinhibitory compound is an extracellular portion of an inhibitory checkpoint molecule. In some embodiments, the inhibitory checkpoint molecule is selected from the group consisting of CLTA-4 (SEQ ID NO: 72), PD-1 (SEQ ID NO: 74), BTLA, and TIM-3. In some embodiments, the inhibitory checkpoint molecule is CLTA-4 (SEQ ID NO: 72). In some embodiments, the inhibitory checkpoint molecule is PD-1 (SEQ ID NO: 74). In some embodiments, the inhibitory checkpoint molecule is BTLA. In some embodiments, the inhibitory checkpoint molecule is TIM-3. In some embodiments of the present disclosure, the immunoinhibitory compound is a cytokine selected from the group consisting of IL-10 (SEQ ID NO: 66), TGFβ1 (SEQ ID NO: 60), TGFβ2 (SEQ ID NO: 62), TGFβ3 (SEQ ID NO: 64), IL-27, IL-2, IL-37, and IL-35. In some embodiments, the cytokine is IL-10 (SEQ ID NO: 66). In some embodiments, the cytokine is TGFβ1 (SEQ ID NO: 60). In some embodiments, the cytokine is TGFβ2 (SEQ ID NO: 62). In some embodiments, the cytokine is TGFβ3 (SEQ ID NO: 64). In some embodiments, the cytokine is IL-27. In some embodiments, the cytokine is IL-2. In some embodiments, the cytokine is IL-37. In some embodiments, the cytokine is IL-35.

[0382] In some embodiments of the present disclosure, the DNA plasmid comprises a nucleic acid sequence encoding 2, 3, 4, 5, 6, 7 or 8 immunoinhibitory compounds. In preferred embodiments, the DNA plasmid comprises a nucleic acid sequence encoding 2-6 immunoinhibitory compounds, e.g., 2 or 3 or 4 or 5 or 6 different immunoinhibitory compounds. The immunoinhibitory compounds may be the same or different, preferably different.

[0383] In a preferred embodiment, the different immunoinhibitory compounds generate or promote a tolerance-inducing environment at many different levels. By way of example, a plasmid of the present disclosure may contain nucleic acid sequences encoding three different immunoinhibitory compounds, a first that induces tolerance, a second that increases tolerance, and a third that maintains tolerance.

[0384] Pharmaceutical Compositions The constructs of the present disclosure may be administered to a subject as a pharmaceutical composition comprising the construct, e.g., in the form of a polynucleotide or a multimeric protein, such as a dimeric protein, and a pharma- ceutically acceptable carrier.

[0385] The constructs of the present disclosure may be administered to a subject as a pharmaceutical composition comprising the construct, for example in the form of a polynucleotide or multimeric protein, and a pharma- ceutically acceptable carrier.

[0386] The constructs of the present disclosure may be administered to a subject as a pharmaceutical composition comprising the construct, for example in the form of a polynucleotide or dimeric protein, and a pharma- ceutically acceptable carrier.

[0387] A further aspect of the present disclosure is a composition comprising a pharmaceutical composition comprising: i) a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polypeptide, the antigenic unit comprising one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of multiple polypeptides defined in ii), for example, a dimeric protein consisting of two polypeptides defined in ii).

[0388] A further aspect of the present disclosure is a composition comprising a pharmaceutical composition comprising: i) a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polypeptide, the antigenic unit comprising one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of multiple polypeptides as defined in ii).

[0389] A further aspect of the present disclosure is a composition comprising a pharmaceutical composition comprising: i) a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polypeptide, the antigenic unit comprising one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a dimeric protein consisting of two polypeptides defined in ii) above. Suitable pharma- ceutically acceptable carriers include, but are not limited to, saline, buffered saline, such as PBS, dextrose, water, glycerol, ethanol, sterile isotonic aqueous buffer, and combinations thereof.

[0390] In some embodiments, the pharma- ceutically acceptable carrier or diluent is an aqueous buffer solution, in other embodiments, the aqueous buffer solution is Tyrode's buffer, such as Tyrode's buffer containing 140 mM NaCl, 6 mM KCl, 3 mM CaCl2, 2 mM MgCl2, 10 mM 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (Hepes) pH 7.4, and 10 mM glucose.

[0391] Suitable adjuvants may include, but are not limited to, dexamethasone, the B subunit of the enterotoxin cholera toxin (CTB), TLR2 ligands, helminth-derived excretory / secretory (ES) products, rapamycin, or vitamin D3 analogs and aryl hydrocarbon receptor ligands.

[0392] In some particular embodiments, the composition may comprise a pharma- ceutically acceptable amphiphilic block copolymer comprising blocks of poly(ethylene oxide) and poly(propylene oxide).

[0393] As used herein, an "amphiphilic block copolymer" is a linear or branched copolymer that comprises or consists of blocks of poly(ethylene oxide) ("PEO") and blocks of poly(propylene oxide) ("PPO"). Typical examples of useful PEO-PPO amphiphilic block copolymers have the general structures PEO-PPO-PEO (poloxamer), PPO PEO PPO, (PEO PPO-)4ED (poloxamine), and (PPO PEO-)4ED (reverse poloxamine), where "ED" is an ethylenediaminyl group.

[0394] "Poloxamer" refers to a linear amphiphilic block copolymer composed of one block of poly(ethylene oxide) bonded to one block of poly(propylene oxide) bonded to one block of PEO, i.e., a structure of the formula EOa-POb-EOa, where EO is ethylene oxide, PO is propylene oxide, a is an integer between 2 and 130, and b is an integer between 15 and 67. Poloxamers are usually named by using a three-digit identifier, where the first two digits are multiplied by 100 to give the approximate molecular weight of the PPO content, and the last digit is multiplied by 10 to indicate the approximate percentage of PEO content. For example, "Poloxamer 188" refers to a polymer containing a PPO block of about 1800 molecular weight (corresponding to b being about 31 PPO) and about 80% (w / w) PEO (corresponding to a being about 82). However, values ​​are known to vary to some extent, and commercial products such as research grade Lutrol® F68 and clinical grade Kolliphor® P188, both of which are Poloxamer 188 according to the manufacturer's datasheet, show a large variation in molecular weight (7,680-9,510), with the values ​​of a and b provided for these particular products being approximately 79 and 28, respectively. This reflects the heterogeneous nature of the block copolymers, and means that the values ​​of a and b are averages found in the final formulation.

[0395] "Poloxamines" or "sequential poloxamines" (sold under the name Tetronic®) are X-shaped block copolymers having four PEO-PPO arms connected to a central ethylenediamine moiety via bonds between the free OH groups in the PEO-PPO arms and the primary amine groups in the ethylenediamine moiety. Reverse poloxamines are similarly X-shaped block copolymers having four PPO-PEO arms connected to a central ethylenediamine moiety via bonds between the free OH groups in the PPO-PEO arms and the primary amine groups in the ethylenediamine moiety.

[0396] Preferred amphiphilic block copolymers are poloxamers or poloxamines. Poloxamers 407 and 188 are preferred, especially poloxamer 188. Preferred poloxamines are sequential poloxamines of formula (PEO-PPO)4-ED. Particularly preferred poloxamines are those available commercially under the registered trademarks Tetronic® 904, 704, and 304, respectively. The characteristics of these poloxamines are as follows: Tetronic® 904 has a total average molecular weight of 6700, a total average weight of PPO units of 4020, and a PEO percentage of about 40%. Tetronic® 704 has a total average molecular weight of 5500, a total average weight of PPO units of 3300, and a PEO percentage of about 40%. Tetronic® 304 has a total average molecular weight of 1650, a total average weight of PPO units of 990, and a PEO percentage of about 40%.

[0397] In some embodiments, the composition comprises the amphiphilic block copolymer in an amount between 0.2% w / v and 20% w / v, e.g., between 0.2% w / v and 18% w / v, between 0.2% w / v and 16% w / v, between 0.2% w / v and 14% w / v, between 0.2% w / v and 12% w / v, between 0.2% w / v and 10% w / v, between 0.2% w / v and 8% w / v, between 0.2% w / v and 6% w / v, between 0.2% w / v and 4% w / v, between 0.4% w / v and 18% w / v, between 0.6% w / v and 18% w / v, between 0.8% w / v and 18% w / v, between 1% w / v and 18% w / v, between 2% w / v and 18% w / v, between 1% w / v and 5% w / v, or between 2% w / v and 4% w / v. Particularly preferred is an amount in the range of 0.5% w / v to 5% w / v. In other embodiments, the composition comprises the amphiphilic block copolymer in an amount of 2% w / v to 5% w / v, for example about 3% w / v. For pharmaceutical compositions comprising a polynucleotide, the composition may further comprise a molecule that facilitates transfection of cells.

[0398] The pharmaceutical compositions may be formulated in any manner suitable for administration to a subject, e.g., a patient suffering from or suspected of suffering from an autoimmune disease, an allergic disease, or transplant rejection, for example, for intradermal or intramuscular injection.

[0399] In some embodiments, pharmaceutical compositions comprising a polynucleotide described herein, e.g., contained in a vector, such as a polycistronic vector, may be administered in any manner suitable for administration to a subject, such as by intradermal, intramuscular, or subcutaneous injection, or by mucosal or epithelial application, such as intranasal or oral administration.

[0400] In a preferred embodiment, the pharmaceutical composition comprises a polynucleotide as described herein, for example contained in a vector, such as a polycistronic vector, and is administered by intramuscular or intradermal injection.

[0401] The pharmaceutical composition of the present disclosure typically comprises a range of 0.1 μg to 10 mg, such as about 0.2 μg, 0.3 μg, 0.4 μg, 0.5 μg, 0.75 μg, 1 μg, 5 μg, 10 μg, 25 μg, 50 μg, 75 μg or more; for example, 0.1 to 10 mg, such as about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9 or 1 mg, or for example, 2, 3, 4, 5, 6, 7, 8, 9 or 10 mg of polynucleotide. The pharmaceutical composition of the present disclosure typically comprises a range of 5 μg to 5 mg of polypeptide / dimeric protein.

[0402] The amount of polynucleotide / polypeptide / multimeric or dimeric protein may vary depending on whether the pharmaceutical composition is administered for prophylactic or therapeutic treatment, the severity of the immune disease in an individual suffering from an immune disease, and parameters such as age, weight, sex, medical history and pre-existing conditions.

[0403] Methods for preparing pharmaceutical compositions Suitable methods for preparing a pharmaceutical composition or vaccine according to the present disclosure are disclosed in WO 2004 / 076489(A1), WO 2011 / 161244(A1), WO 2013 / 092875(A1) and WO 2017 / 118695(A1), which are incorporated herein by reference.

[0404] In one aspect, the present disclosure relates to a method for preparing a pharmaceutical composition comprising a multimeric protein, such as a dimeric protein, or a polypeptide as defined above, by producing a polypeptide in vitro. The in vitro synthesis of polypeptides and proteins may be performed by any suitable method known to the person skilled in the art, for example by peptide synthesis or by expression of the polypeptide in various expression systems followed by purification.

[0405] Thus, a further aspect of the present disclosure is a method for preparing a pharmaceutical composition comprising a multimeric protein, such as a dimeric protein consisting of multiple polypeptides; or a polypeptide, comprising: a) transfecting a cell with a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being expressed in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; wherein the antigen unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen; b) culturing the cells; and c) collecting and purifying the multimeric protein, such as a dimeric protein, or the expressed polypeptide from the cell; d) mixing the multimeric protein, such as dimeric protein or polypeptide obtained from step c) with a pharma- ceutically acceptable carrier.

[0406] Thus, a further aspect of the present disclosure is a method for preparing a pharmaceutical composition comprising a multimeric protein or a polypeptide, the method comprising the steps of: a) transfecting a cell with a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being expressed in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; wherein the antigen unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen; b) culturing the cells; and c) collecting and purifying the expressed multimeric protein or polypeptide from the cells; d) mixing the multimeric protein or polypeptide obtained from step c) with a pharma- ceutically acceptable carrier.

[0407] Thus, a further aspect of the present disclosure is a method for preparing a pharmaceutical composition comprising a dimeric protein consisting of two polypeptides; or a polypeptide, comprising: a) transfecting a cell with a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being expressed in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; wherein the antigen unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen, or a xenoantigen; b) culturing the cells; and c) collecting and purifying the expressed dimeric protein or polypeptide from the cells; d) mixing the dimeric protein or polypeptide obtained from step c) with a pharma- ceutically acceptable carrier.

[0408] In some embodiments, the polynucleotide is contained in a vector as described herein.

[0409] In a preferred embodiment, the multimeric protein, such as dimeric protein or polypeptide obtained from step c) is dissolved in said pharma- ceutically acceptable carrier.

[0410] In a preferred embodiment, the multimeric protein or polypeptide obtained from step c) is dissolved in said pharma- ceutically acceptable carrier. In a preferred embodiment, the dimeric protein or polypeptide obtained from step c) is dissolved in said pharma- ceutically acceptable carrier. Purification may be performed according to any suitable method, such as chromatography, centrifugation, or differential solubility.

[0411] In another aspect, the disclosure provides a method for preparing a pharmaceutical composition comprising a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being comprised of, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; The antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen, and the method comprises: a) preparing a polynucleotide; b) optionally, cloning the polynucleotide into an expression vector; c) mixing the polynucleotide obtained from step a) or the vector obtained from step b) with a pharma- ceutically acceptable carrier.

[0412] The polynucleotides may be prepared by any suitable method known to those skilled in the art, for example, the polynucleotides may be prepared by chemical synthesis using an oligonucleotide synthesizer.

[0413] The expression vector can be any of the vectors described herein.

[0414] In particular, nucleotide sequences encoding the targeting unit and / or the dimerization unit may be synthesized individually and then ligated into a vector backbone to produce the final polynucleotide by ligating a nucleic acid sequence encoding the antigen unit into the vector.

[0415] In one aspect, the present disclosure relates to the use of the constructs, polynucleotides, polypeptides or multimeric proteins, such as dimeric proteins, described herein as a pharmaceutical.

[0416] In one aspect, the present disclosure relates to the use of a construct, polynucleotide, polypeptide or multimeric protein described herein as a medicament.

[0417] In one aspect, the present disclosure relates to the use of the constructs, polynucleotides, polypeptides or dimeric proteins described herein as a medicament.

[0418] Pharmaceuticals In one aspect, the present disclosure relates to the use of the constructs, polynucleotides, polypeptides, multimeric proteins or dimeric proteins described herein as a pharmaceutical.

[0419] Administration The constructs or pharmaceutical compositions of the present disclosure may be used to treat autoimmune diseases, allergic diseases or transplant rejection, and the treatment may be either prophylactic or therapeutic.

[0420] The constructs / pharmaceutical compositions are administered to induce tolerance in the individual receiving such pharmaceutical composition. Tolerance is induced either by a single administration, and preferably by multiple administrations spaced at appropriate time intervals.

[0421] In a further aspect, the disclosure provides a method for treating a subject having or in need of prevention of an immune disorder selected from the group consisting of an autoimmune disorder, an allergic disorder, and a transplant rejection, comprising administering to a subject a therapeutically acceptable carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of polypeptides defined in ii), for example a dimeric protein consisting of two polypeptides defined in ii), and administering to a subject a pharmaceutical composition comprising the same.

[0422] In a further aspect, the disclosure provides a method for treating a subject having or in need of prevention of an immune disorder selected from the group consisting of an autoimmune disorder, an allergic disorder, and a transplant rejection, comprising administering to a subject a therapeutically acceptable carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of the polypeptides defined in ii) above, comprising administering to a subject a pharmaceutical composition comprising the same.

[0423] In a further aspect, the disclosure provides a method for treating a subject having or in need of prevention of an immune disorder selected from the group consisting of an autoimmune disorder, an allergic disorder, and a transplant rejection, comprising administering to a subject a therapeutically acceptable carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a dimeric protein consisting of two polypeptides defined in ii) above, comprising administering to a subject a pharmaceutical composition comprising the dimeric protein.

[0424] In yet another aspect, the present disclosure provides a pharmaceutical composition for use in the prophylactic or therapeutic treatment of an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, comprising a pharma- ceutical composition comprising a pharma- ceutical carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of multiple polypeptides encoded by the nucleotides defined in i), for example a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i).

[0425] In yet another aspect, the present disclosure provides a pharmaceutical composition for use in the prophylactic or therapeutic treatment of an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, comprising a pharma- ceutical composition comprising a pharma- ceutical carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a multimeric protein consisting of multiple polypeptides encoded by the nucleotides defined in i).

[0426] In yet another aspect, the present disclosure provides a pharmaceutical composition for use in the prophylactic or therapeutic treatment of an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, comprising a pharma- ceutical composition comprising a pharma- ceutical carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i).

[0427] The first and second targeting units, the first and second joining regions, and the antigenic units are described in detail herein above.

[0428] In yet another aspect, the disclosure provides a pharmaceutical composition for use in the prophylactic or therapeutic treatment of a subject suffering from or suspected of suffering from an immune disorder selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, comprising a pharma- ceutical composition comprising a pharma- ceutical carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i), for example a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i), The pharmaceutical composition is administered to the subject.

[0429] In yet another aspect, the disclosure provides a pharmaceutical composition for use in the prophylactic or therapeutic treatment of a subject suffering from or suspected of suffering from an immune disorder selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, comprising a pharma- ceutical composition comprising a pharma- ceutical carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i), The pharmaceutical composition is administered to the subject.

[0430] In yet another aspect, the disclosure provides a pharmaceutical composition for use in the prophylactic or therapeutic treatment of a subject suffering from or suspected of suffering from an immune disorder selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, comprising a pharma- ceutical composition comprising a pharma- ceutical carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i), The pharmaceutical composition is administered to the subject.

[0431] The first and second targeting units, the first and second joining regions, and the antigenic units are described in detail herein above.

[0432] In yet another aspect, the present disclosure relates to a use of a pharmaceutical composition for the prophylactic or therapeutic treatment of an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, comprising a pharma- ceutical composition comprising: a pharma- ceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of multiple polypeptides encoded by the nucleotides defined in i), for example a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i).

[0433] In yet another aspect, the present disclosure relates to a use of a pharmaceutical composition for the prophylactic or therapeutic treatment of an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, comprising a pharma- ceutical composition comprising: a pharma- ceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a multimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i).

[0434] In yet another aspect, the present disclosure relates to a use of a pharmaceutical composition for the prophylactic or therapeutic treatment of an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, comprising a pharma- ceutical composition comprising: a pharma- ceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i).

[0435] The first and second targeting units, the first and second joining regions, and the antigenic units are described in detail herein above.

[0436] In yet another aspect, the disclosure provides a use of a pharmaceutical composition for the manufacture of a medicament for the prophylactic or therapeutic treatment of a subject suffering from or suspected of suffering from an immune disorder selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, the pharmaceutical composition comprising a pharmaceutically acceptable carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of multiple polypeptides encoded by the nucleotides defined in i), for example a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i).

[0437] In yet another aspect, the disclosure provides a use of a pharmaceutical composition for the manufacture of a medicament for the prophylactic or therapeutic treatment of a subject suffering from or suspected of suffering from an immune disorder selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, the pharmaceutical composition comprising a pharmaceutically acceptable carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a multimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i).

[0438] In yet another aspect, the disclosure provides a use of a pharmaceutical composition for the manufacture of a medicament for the prophylactic or therapeutic treatment of a subject suffering from or suspected of suffering from an immune disorder selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, the pharmaceutical composition comprising a pharmaceutically acceptable carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i).

[0439] The first and second targeting units, the first and second joining regions, and the antigenic units are described in detail herein above.

[0440] In yet another aspect, the present disclosure provides a use of a pharmaceutical composition for the prophylactic or therapeutic treatment of a subject having an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, the pharmaceutical composition comprising a pharma- ceutical composition comprising: a pharma- ceutical composition comprising: a pharma- ceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein, for example a dimeric protein, consisting of a plurality of polypeptides encoded by the nucleotides defined in i).

[0441] In yet another aspect, the present disclosure provides a use of a pharmaceutical composition for the prophylactic or therapeutic treatment of a subject having an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, the pharmaceutical composition comprising a pharma- ceutical composition comprising: a pharma- ceutical composition comprising: a pharma- ceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a multimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i).

[0442] In yet another aspect, the present disclosure provides a use of a pharmaceutical composition for the prophylactic or therapeutic treatment of a subject having an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, the pharmaceutical composition comprising a pharma- ceutical composition comprising: a pharma- ceutical composition comprising: a pharma- ceutical composition comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i).

[0443] The first and second targeting units, the first and second joining regions, and the antigenic units are described in detail herein above.

[0444] Further disclosed herein: A pharma- ceutically acceptable carrier; i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i), for example, a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i), 1. Use for the manufacture of a medicament for the prophylactic or therapeutic treatment of a subject having an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, wherein the medicament is administered to the subject.

[0445] Additionally disclosed herein are: A pharma- ceutically acceptable carrier; i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i), 13. Use for the prophylactic or therapeutic treatment of a subject having an immune disease selected from the group consisting of an autoimmune disease, an allergic disease and a transplant rejection, wherein the pharmaceutical agent is administered to the subject.

[0446] Additionally disclosed herein are: A pharma- ceutically acceptable carrier; i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i), 13. Use for the prophylactic or therapeutic treatment of a subject having an immune disease selected from the group consisting of an autoimmune disease, an allergic disease and a transplant rejection, wherein the pharmaceutical agent is administered to the subject.

[0447] The first and second targeting units, the first and second joining regions, and the antigenic units are described in detail herein above.

[0448] Additionally disclosed herein are: A pharma- ceutically acceptable carrier; i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i), for example a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i), A pharmaceutical composition when used in the prophylactic or therapeutic treatment of an immune disease selected from the group consisting of an autoimmune disease, an allergic disease and a transplant rejection.

[0449] Additionally disclosed herein are: A pharma- ceutically acceptable carrier; i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i), A pharmaceutical composition when used in the prophylactic or therapeutic treatment of an immune disease selected from the group consisting of an autoimmune disease, an allergic disease and a transplant rejection.

[0450] Additionally disclosed herein are: A pharma- ceutically acceptable carrier; i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a dimeric protein consisting of a plurality of polypeptides encoded by the nucleotides defined in i), A pharmaceutical composition when used in the prophylactic or therapeutic treatment of an immune disease selected from the group consisting of an autoimmune disease, an allergic disease and a transplant rejection.

[0451] The first and second targeting units, the first and second joining regions, and the antigenic units are described in detail herein above.

[0452] Additionally disclosed herein are: A pharma- ceutically acceptable carrier; i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) a multimeric protein consisting of multiple polypeptides encoded by the nucleotides defined in i), for example a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i), for example a dimeric protein consisting of two polypeptides encoded by the nucleotides defined in i), for use in the prophylactic or therapeutic treatment of a subject having an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a graft rejection, by administering to the subject a pharmaceutical composition comprising the multimeric protein consisting of multiple polypeptides encoded by the nucleotides defined in i).

[0453] Also disclosed herein is a pharmaceutical composition comprising a pharma- ceutically acceptable carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a multimeric protein consisting of multiple polypeptides encoded by the nucleotides defined in i), thereby providing a pharmaceutical composition for the prophylactic or therapeutic treatment of a subject having an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, the pharmaceutical composition comprising the multimeric protein and a multimeric protein consisting of multiple polypeptides encoded by the nucleotides defined in i).

[0454] Also disclosed herein is a pharmaceutical composition comprising a pharma- ceutically acceptable carrier and i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or and iii) a dimeric protein consisting of multiple polypeptides encoded by the nucleotides defined in i), thereby preventing or treating an immune disease selected from the group consisting of an autoimmune disease, an allergic disease, and a transplant rejection, by administering to the subject a pharmaceutical composition comprising the dimeric protein.

[0455] The first and second targeting units, the first and second joining regions, and the antigenic units are described in detail herein above.

[0456] Indicators of successful treatment are known in the art and include increased levels of antigen-specific regulatory T cells, decreased levels of antigen-specific effector T cells (and increased levels of regulatory T cells), decreased levels of effector T cells, decreased levels of T cell activation in an ELISPOT when stimulated with an antigen unit / T cell epitope in the antigen unit, decreased levels of basophil activation in a basophil activation test (BAT). A radioallergosorbent test (RAST) can also be used to compare allergen-specific IgE antibody levels in blood samples from a subject before and after administration of a tolerance-inducing construct, with lower allergen-specific IgE antibody levels indicating successful tolerance induction. EXAMPLES

[0457] Example 1: Design, production, and in vitro characterization of a tolerance-inducing construct according to the invention for use in the treatment of multiple sclerosis.

[0458] Myelin oligodendrocyte glycoprotein (MOG) is a protein expressed in the central nervous system. The immunodominant 35-55 epitope of MOG, MOG(35-55), is a major target for both cellular and humoral immune responses during multiple sclerosis. MOG(35-55)-induced experimental autoimmune encephalomyelitis (EAE) is the most commonly used animal model of multiple sclerosis (Hunterman, H. et al. 2022).

[0459] DNA vector design All gene sequences described were ordered from GenScript (Genscript Biotech BV, Netherlands) cloned into the expression vector pALD-CV77. DNA vectors were designed containing nucleotide sequences encoding the following units / portions: 1. Signal peptide twenty one st Targeting Unit 3.1 stJunction region: hinge region 1 derived from human IgG3 (amino acids 1-12 of SEQ ID NO: 1), hinge region 4 derived from human IgG3 (amino acids 13-27 of SEQ ID NO: 1), glycine-leucine linker (SEQ ID NO: 102). 4. Antigenic unit: MOG(27-63) (sequence number 12). 5.2 nd joining area 6.2 nd Targeting Unit The differences between the vectors containing the insertion of hinge region 1 from human IgG3 in the targeting unit and the second dimerization unit are listed in Table 1.

[0460] [Table 2] * Antigen unit: Murine myelin oligodendrocyte glycoprotein (MOG) 27-63 sequence (SEQ ID NO: 13) obtained from Krienke et al. (Science 371, 145-153, 2021). U.S. Patent Application Publication No. 2020061166(A1).

[0461] ** Antigen unit: MOG(35-55) (SEQ ID NO: 14) *** Extracellular domain Plasmid DNA vectors VB5038, VB5041, VB5042, VB5043, VB5050, VB5066, VB5067, VB5072, VB5073, VB5074 and VB5075 are vectors according to the present disclosure and encode tolerance-inducing constructs comprising the targeting unit, dimerization unit and antigen unit as set forth in Table 1.

[0462] The vectors used as controls are listed in Table 2.

[0463] [Table 3] *The MOG(27–63) sequence was obtained from Krienke et al. 2021. U.S. Patent Application Publication No. 2020061166(A1).

[0464] DNA vectors VB5052 (SEQ ID NO: 33) and VB5002b (SEQ ID NO: 34) encode fusion proteins containing a human CCL3L1 targeting unit known to target APCs in a pro-inflammatory manner, i.e., antigen-specific constructs containing such targeting units are expected to induce an inflammatory immune response in subjects to which they are administered, and the compounds induce IFN-γ production (see, e.g., WO2011161244 (A1)).

[0465] The DNA vectors VB5051 (SEQ ID NO: 35) and VB5001b (SEQ ID NO: 36) encode only the antigenic unit MOG(27-63), i.e., a single protein / peptide.

[0466] The murine MOG(27~63) antigenic unit contains the T cell epitope MOG(35~55).

[0467] In vitro characterization of protein expression and secretion of MOG-containing constructs. The goal of this experiment was to characterize protein expression and secretion in the supernatants of mammalian cells transiently transfected with MOG-containing DNA vectors.

[0468] Expi293F cells were obtained from Thermo Fisher Sci. and transiently transfected with MOG(27-63)-containing DNA vectors (VB5042, VB5050, VB5067, VB5072, VB4073, VB5074, and VB5075). Briefly, Expi293F cells (1.7 × 10 6Cells / mL, 1 mL) were seeded into 96-well culture plates. Cells were transfected with 0.64 μg / mL of plasmid DNA using ExpiFectamine 293 reagent (Thermo Fisher Sci.) and plates were incubated on an orbital shaker (3 mm diameter, 900 rpm) in a humidified CO2 cell incubator (8% CO2, 37 °C). Supernatants were harvested 72 h after transfection.

[0469] HEK293 cells were obtained from ATCC and transiently transfected with MOG(27–63)-containing DNA vector VB5038. Briefly, 2 × 10 5 Cells / well were plated in 24-well tissue culture plates containing 10% FBS growth medium and transfected with 1 μg of each DNA vector using Lipofectamine® 2000 reagent under conditions suggested by the manufacturer (Thermo Fischer Scientific). Transfected cells were maintained at 37° C., 5% CO2 for 5 days and cell supernatants were collected.

[0470] Secreted proteins encoded by MOG-containing vectors were characterized by sandwich ELISA of supernatants from transiently transfected Expi293F or HEK293 cells using antibodies against MOG and one of the targeting units, and the results are shown in Figures 4-6.

[0471] Figures 4A and 4B show that all IL-10-encoding tolerance-inducing constructs were expressed and secreted in vitro in an ELISA using mouse anti-MOG antibody (0.25 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology) as the capture antibody and goat anti-murine IL-10 biotinylated antibody (0.8 μg / mL, 100 μl / well, BAF417, R&D Systems) as the detection antibody.

[0472] FIG. 5 shows that a tolerogenic construct encoding CTLA-4 was expressed and secreted in vitro in an ELISA using mouse anti-MOG antibody (0.25 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology) as the capture antibody and goat anti-mouse CTLA-4 biotinylated antibody (0.8 μg / mL, 100 μl / well, BAF476, R&D Systems) as the detection antibody.

[0473] FIG. 6 shows that a tolerance-inducing construct encoding SCGB3A2 was expressed and secreted in vitro in an ELISA using mouse anti-MOG antibody (0.25 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology) as the capture antibody and goat anti-mouse SCGB3A2 (3.3 μg / mL, 100 μl / well, BAF3465, R&D Systems) as the detection antibody.

[0474] The secretion of full-length tolerogenic constructs with SCGB3A2 and IL-10 as the first and second targeting units, respectively, was verified by sandwich ELISA of the supernatants using an antibody against murine IL-10 (capture antibody: rat anti-murine IL-10 antibody, 2 μg / mL, 100 μl / well, MAB417, R&D Systems) and an antibody against murine SCGB3A2 (detection antibody: goat anti-mouse SCGB3A2, 3.3 μg / mL, 100 μl / well, BAF3465, R&D Systems). The results are shown in FIG. 7, which shows that the vaccines with IL-10 and SCGB3A2 as targeting units encoded by DNA vectors VB5073 and VB5072, respectively, with or without an extra copy of hinge region 1 from human IgG3 in the second dimerization unit, were expressed and secreted as full-length fusion proteins.

[0475] In vitro characterization of the binding of tolerance-inducing constructs to the DEC205 receptor The aim of this experiment was to characterize the functional binding of the scFv anti-DEC205 targeting unit to the recombinant DEC205 receptor. Functional binding of the targeting unit was assessed in an ELISA on supernatants from HEK293 cells transiently transfected with the DNA vector VB5038 encoding the scFv anti-DEC205 as the first targeting unit by coating an ELISA plate with the recombinant DEC205 receptor and using an antibody against the antigen unit or the second targeting unit as the detection antibody.

[0476] HEK293 cells were obtained from ATCC and transiently transfected with VB5038. Briefly, 2 × 10 5 Cells / well were plated in 24-well tissue culture plates containing 10% FBS growth medium and transfected with 1 μg of each DNA vector using Lipofectamine® 2000 reagent under conditions suggested by the manufacturer (Invitrogen, Thermo Fischer Scientific). Transfected cells were maintained at 37° C., 5% CO2 for 5 days and cell supernatants were collected. Secreted proteins encoded by VB5038 were assessed in supernatants from transiently transfected cells by direct ELISA. ELISA plates were coated with 100 μl / well of 5 μg / mL recombinant DEC205 receptor (aa 216-503, OPCD 05072, Aviva Systems Biology) and blocked before adding supernatants. Binding of vaccine proteins to the recombinant receptors was detected by antibodies against MOG (mouse anti-MOG antibody, 1 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology) or murine IL-10 (goat anti-murine IL-10 biotinylated antibody, 1 μg / mL, 100 μl / well, BAF417, R&D Systems).

[0477] The results shown in Figure 8 confirm binding of scFv anti-DEC205 containing VB5038 to the DEC205 receptor and secretion of the full-length fusion protein. In vitro characterization of binding of tolerance-inducing constructs to the IL-10 receptor The purpose of this experiment was to characterize the functional binding of the IL-10 targeting unit to the recombinant IL-10 receptor. The functional binding of the targeting unit was evaluated in an ELISA on supernatants from HEK293 cells transiently transfected with a DNA vaccine encoding IL-10 as the second targeting unit by coating an ELISA plate with recombinant IL-10 receptor (IL-10R) and using an antibody against the antigen unit of the detection antibody.

[0478] HEK293 cells were obtained from ATCC and transiently transfected with VB5038. Briefly, 2 × 10 5 Cells / well were plated in 24-well tissue culture plates containing 10% FBS growth medium and transfected with 1 μg of each DNA vector using Lipofectamine® 2000 reagent under conditions suggested by the manufacturer (Invitrogen, Thermo Fischer Scientific). Transfected cells were maintained at 37° C., 5% CO2 for 5 days and cell supernatants were collected. Secreted proteins encoded by VB5038 were evaluated in supernatants from transiently transfected cells by direct ELISA. ELISA plates were coated with 100 μl / well of 2.5 μg / mL recombinant IL-10 receptor and blocked before adding the supernatant. Binding of vaccine proteins to the recombinant receptor was detected by an antibody against MOG (100 μl / well, 1 μg / mL mouse anti-MOG antibody, sc-73330, Santa Cruz Biotechnology).

[0479] The results shown in FIG. 9 demonstrate that the tolerogenic construct protein having IL-10 as the second targeting unit is capable of binding to the IL-10 receptor.

[0480] In vitro characterization of protein expression and secretion following transient transfection of mammalian cells with the MOG(27-63) peptide encoded in vector VB5051 The purpose of this experiment was to evaluate protein expression and secretion of MOG(27-63) antigen-only control encoded by vector VB5051 in transiently transfected mammalian cells in vitro. Briefly, Expi293F cells (2 × 10 6 Cells / mL, 1 mL) were seeded into 96-well culture plates. Cells were transfected with 0.64 μg / mL of plasmid DNA using ExpiFectamine 293 reagent (Thermo Fisher Sci.) and plates were incubated on an orbital shaker (3 mm diameter, 900 rpm) in a humidified CO2 cell incubator (8% CO2, 37 °C). Supernatants were harvested 72 h after transfection.

[0481] Secretion of MOG(27-63) peptide was characterized by direct ELISA, coating with supernatant, and detection using an antibody against MOG (capture antibody, 100 μl / well, 3.3 μg / mL mouse anti-MOG antibody, sc-73330, Santa Cruz Biotechnology). Figure 10 shows that MOG(27-63) peptide is expressed from VB5051 and secreted from mammalian cells transfected with the vector.

[0482] In vitro characterization of protein expression and secretion following transient transfection of mammalian cells with pro-inflammatory control constructs encoded by DNA vectors VB5052 and VB5002b DNA vectors VB5052 (SEQ ID NO: 33) and VB5002b (SEQ ID NO: 34) encode fusion proteins comprising a human CCL3L1 targeting unit known to target APCs in a pro-inflammatory manner, i.e., antigen-specific vaccines comprising such a targeting unit are expected to induce an inflammatory immune response in subjects to which they are administered, and this compound induces IFN-γ production (see, e.g., WO2011161244 (A1)).

[0483] The aim of these experiments was to characterize the protein expression and secretion of proteins encoded by DNA vectors VB5052 and VB5002b in transiently transfected mammalian cells.

[0484] Expi293F cells were obtained from Thermo Fisher Sci. and transiently transfected with DNA vector VB5052. Briefly, Expi293F cells (1.7 × 10 6 Cells / mL, 1 mL) were seeded into 96-well culture plates. Cells were transfected with 0.64 μg / mL of plasmid DNA using ExpiFectamine 293 reagent (Thermo Fisher Sci.) and plates were incubated on an orbital shaker (3 mm diameter, 900 rpm) in a humidified CO2 cell incubator (8% CO2, 37 °C). Supernatants were harvested 72 h after transfection.

[0485] HEK293 cells were obtained from ATCC and transiently transfected with DNA vector VB5002b. Briefly, 2 × 10 5Cells / well were seeded into 24-well tissue culture plates containing 10% FBS growth medium and transfected with 1 μg of each DNA vector using Lipofectamine® 2000 reagent under conditions suggested by the manufacturer (Thermo Fischer Scientific). Transfected cells were incubated at 37° C. with 5% CO2. Supernatants were harvested 5 days after transfection.

[0486] The secreted protein encoded by DNA vector VB5052 was evaluated in supernatants from transiently transfected cells by sandwich ELISA using antibodies against MOG (mouse anti-MOG, 0.25 μg / mL, 100 μl / well, sc-73330, Santa Cruz Biotechnology) and human CCL3L1 (goat anti-human CCL3 0.2 μg / mL, 100 μl / well, BAF270, R&D Systems). The results are shown in FIG. 11A and show that the pro-inflammatory control vaccine encoded by vector VB5052 was highly expressed and secreted as a full-length fusion protein.

[0487] Secreted protein encoded by DNA vector VB5002b was assessed in supernatants from transiently transfected cells by sandwich ELISA using antibodies against human IgG3 (CH3) (mouse anti-human IgG (CH3 domain), 1 μg / mL, 100 μl / well, 153272, Biorad) and human CCL3L1 (goat anti-human CCL3 0.2 μg / mL, 100 μl / well, BAF270, R&D Systems). The results are shown in FIG. 11B and show that the immunogenic control vaccine encoded by vector VB5002b was expressed and secreted as a protein.

[0488] Characterization of proteins expressed from DNA vectors VB5038, VB5041, VB5042, VB5050, VB5074 and VB5075 by Western blot. To further characterize the proteins encoded by DNA vectors VB5038, VB5041, VB5042, VB5050, VB5074, VB5075 and VB5002b, Western blot analysis was performed on supernatants from transfected Expi293F cells.

[0489] Expi293F cells were obtained from Thermo Fisher Sci. and were transiently transfected with DNA vectors VB5038 and VB5002b. Briefly, Expi293F cells (3×106 cells / mL, 1.6 mL) were seeded into 6-well culture plates. Cells were transfected with 1 μg / mL plasmid DNA using ExpiFectamine 293 reagent (Thermo Fisher Sci.) and plates were incubated on an orbital shaker (19 mm diameter, 125 rpm) in a humidified CO2 cell incubator (8% CO2, 37°C). After 18 hours of incubation, ExpiFectamine 293 transfection enhancer (Thermo Fisher Sci.) was added to each well. Plates were further incubated for 78 hours, after which the supernatants were harvested. Samples were prepared by mixing 105 μl of supernatant from transfected Expi293F cells with 37.5 μl of 4× Laemmli sample buffer (Bio-Rad) containing 7.5 μl DTT (Thermo Fisher Sci.) or 7.5 μl ultrapure water for reducing and non-reducing conditions, respectively. Samples (reduced or non-reduced) were heated at 70°C for 10 min before being loaded onto 4%-20% Criterion TGX Stain-Free precast gels (Bio-Rad) (loading sample volumes are given in figure legends). SDS-PAGE was run in 1× Tris / glycine / SDS running buffer (Bio-Rad) containing Precision Plus Protein All Blue pre-stained protein standards (Bio-Rad). Proteins were transferred from the gel onto EtOH-activated low-fluorescence (LF) 0.45 μm PVDF membranes (Bio-Rad) using the Tran-Blot Turbo semi-dry transfer system (Bio-Rad). The PVDF membranes were blocked in EveryBlot buffer (Bio-Rad) for 5 min and probed with mouse anti-MOG (sc-73330, Santa Cruz Biotechnology) and rat anti-murine IL-10 antibodies (MAB417, R&D systems) to detect MOG and IL-10, respectively.The membrane was incubated with fluorescent dye-conjugated secondary antibody at room temperature for 1 hour, then washed and dried. Images were taken by using ChemiDoc™ MP imaging system (settings Dylight 488 and 800, Auto Optimal). The results are shown in Figure 12A and Figure 12B.

[0490] Expi293F cells were obtained from Thermo Fisher Sci. and transiently transfected with DNA vectors VB5041, VB5042, VB5050, VB5074 and VB5075. Briefly, Expi293F cells (2 or 1.7 × 10 6Cells / mL, 1 mL) were seeded into 96-well culture plates. Cells were transfected with 0.64 μg / mL of plasmid DNA using ExpiFectamine 293 reagent (Thermo Fisher Sci.) and plates were incubated on an orbital shaker (3 mm diameter, 900 rpm) in a humidified CO2 cell incubator (8% CO2, 37 °C). After incubating the plates for 72 h, the supernatant was harvested. Samples were prepared by mixing 14 μl of supernatant from transfected Expi293F cells with 5 μl of 4× Laemmli sample buffer (Bio-Rad) containing 1 μl of DTT (Cayman Chemical) or 1 μl of ultrapure water for reducing and non-reducing conditions, respectively (scaling up the total sample volume at the given ratios). Samples (reduced or non-reduced) were heated at 70 °C for 10 min and then loaded onto 4%–20% Criterion TGX Stain-Free precast gels (Bio-Rad) (additional sample volumes noted in figure legends). SDS-PAGE was performed in 1× Tris / glycine / SDS running buffer (Bio-Rad) containing Precision Plus Protein All Blue prestained protein standards (Bio-Rad). Proteins were transferred from the gel onto EtOH-activated low fluorescence (LF) 0.45 μm PVDF membranes (Bio-Rad) by using a Tran-Blot Turbo semi-dry transfer system (Bio-Rad). PVDF membranes were blocked for 5 min in EveryBlot buffer (Bio-Rad) and probed with mouse anti-MOG (sc-73330, Santa Cruz Biotechnology) or rat anti-murine IL-10 (MAB417, R&D Systems) to detect MOG or IL-10, respectively. The membrane was incubated with a fluorescent dye-conjugated species-specific secondary antibody for 1 hour at room temperature, then washed and dried. For IL10 detection in the Dylight-488 channel, the membrane was reprobed with Dylight-488 secondary antibody. The membrane was reactivated in ethanol and TBST. The membrane was blocked and incubated with Dylight 488-conjugated secondary antibody for 1 hour at room temperature, then washed and dried.Images were taken by using a ChemiDoc™ MP Imaging System, and the results are shown in Figures 12C, 12D, 12E, 12F, and 12G.

[0491] Western blot analysis (Figures 12A and 12C) using anti-MOG antibodies of vaccines (VB5038, VB5041, VB5042, and VB5050) encoding scFv anti-DEC205 as the first targeting unit, MOG(27-63) as the antigen unit, and IL-10 as the second targeting unit shows that these vaccines were secreted as full-length fusion proteins. Detection with anti-murine IL-10 antibodies (Figures 12B and 12D) showed a single band at the same molecule as the previously described anti-murine MOG antibody, demonstrating that both antibodies detected the same protein band, thus confirming that MOG and IL-10 are part of the same fusion protein. Non-reduced samples in Figures 12B and 12E show dimerization of these proteins.

[0492] Western blot analysis with anti-murine MOG of vaccines encoding VSIG-3 as the first targeting unit, MOG(27-63) as the antigenic unit, and IL-10 (VB5074 and VB5075) as the second targeting unit (Figure 12F) shows that these vaccines were secreted as full-length fusion proteins. The proteins migrated at a slower rate than expected based on their calculated molecular weights, which can be explained by known post-translational glycosylation (Figure 12F). Detection with anti-murine IL-10 in supernatants from cells transfected with VB5074 and VB5075 (Figure 12G) showed that both antibodies detected the same protein bands, thus confirming that MOG and IL-10 are part of the same fusion protein.

[0493] Example 2: Evaluation of the tolerance-inducing ability of VB5067.

[0494] The tolerance-inducing capacity of VB5067 (listed in Table 1) was evaluated in spleens from mice vaccinated once with 50 μg of VB5067 and determined by calculating the induced IL-10 / IFN-γ ratio. IL-10 (an anti-inflammatory cytokine known to exert immunosuppressive functions) and IFN-γ (a marker for inducing an inflammatory immune response) signals were determined in a two-color FluoroSpot assay after restimulation of splenocytes harvested from mice vaccinated with MOG(35-55) peptide. The IL-10 / IFN-γ ratio indicates the extent to which the immune response induced by the DNA vector is biased towards a tolerogenic response. The tolerogenic profile was further evaluated by the frequency of MOG(38-49)-specific Foxp 3+ T cells induced in response to vaccination and detected ex vivo. Foxp3 acts as a master regulator of immunosuppressive pathways in the development and function of regulatory T cells (Tregs), and represents Treg cells that act to suppress and control MOG-specific inflammatory immune responses, thereby maintaining self-tolerance. The results obtained were compared with the responses induced by the pro-inflammatory control vaccine VB5052 or / and the tolerance-inducing capacity of VB5051 vaccination (both listed in Table 2).

[0495] Mouse vaccination and Fluorospot The following study design was applied: Female 6-week-old C57BL / 6 mice were obtained from Janvier Labs (France). All animals were housed in the animal facility at the Radium Hospital (Oslo, Norway). All animal protocols were approved by the Norwegian Food Safety Authority (Oslo, Norway). Five mice / group were used for testing VB5067 (listed in Table 1), VB5052 and VB5051 (listed in Table 2). VB5052 was included as a pro-inflammatory version of the MOG(27-63)-encoded vaccine. VB5052 contains a human CCL3L1 targeting unit that is known to target APCs in a pro-inflammatory manner, i.e., vaccines containing such targeting units will induce an inflammatory immune response in subjects to whom they are administered, and it is anticipated that this compound will induce IFN-γ production. A DNA vector encoding only the MOG(27–63) peptide, VB5051, was included as a comparison to VB5067.

[0496] A dose of 50 μg of DNA vector VB5067 or control vector VB5051 or VB5052 dissolved in sterile PBS was administered to each tibialis anterior muscle by intramuscular needle injection (2×25 μl, 1000 μg / mL), followed by electroporation using the AgilePulse in vivo electroporation system (BTX, USA). Seven days after vaccination, spleens were harvested and ground with a cell strainer to obtain a single cell suspension. Red blood cells were lysed using ammonium chloride-potassium (ACK) lysis buffer. After washing, splenocytes were counted using a NucleoCounter NC-202 (ChemoMetec, Denmark), resuspended to a final concentration of 6×106 cells / mL, and plated at 6×105 cells / well in 96-well IFN-γ / IL-10 dual-color FluoroSpot plates. Splenocytes were then restimulated with 16.67 μg / mL of MOG(35-55) peptide for 44 h and then tested for IFN-γ and IL-10 cytokine production in a two-color FluoroSpot assay according to the manufacturer's protocol (Mabtech AB, Sweden). Spot-forming cells were measured with an IRIS Fluorospot and ELISpot plate reader (Mabtech AB) and analyzed using Apex software (Mabtech AB). Results are presented as the average number of triplicate IL-10+ or ​​IFN-γ+ spots / 106 splenocytes.

[0497] As can be seen in Figure 13A, production of IL-10 was detected in non-restimulated splenocytes harvested from mice vaccinated with all three constructs; VB5067, VB5051 and VB5052, but only low background levels of IFN-γ were observed. As shown in Figure 13B, upon MOG(35-55) restimulation of splenocytes, elevated levels of IFN-γ were detected after vaccination with VB5052, which were significantly increased above the levels induced by VB5067 and VB5051. To avoid excessive inflammation and ensure the eventual resolution of inflammation, production of pro-inflammatory cytokines such as IFN-γ is required to suppress IL-10 production. 1It is important to note that IL-10 is regulated by a negative feedback mechanism, including the production of anti-inflammatory cytokines such as IL-10 and IFN-γ. Thus, the increased levels of IL-10 observed in response to VB5052 may be explained by such a feedback mechanism controlling the induced inflammatory response. As shown in Figure 13C, a significantly higher IL-10 / IFN-γ ratio was detected in VB5067 compared to VB5052, indicating a higher immunosuppressive ability of VB5067 compared to VB5052.

[0498] Flow cytometric analysis of MOG(38–49)-specific T cells in spleens from mice vaccinated with tetramer (H-2IAb / GWYRSPFSRVVH). The generation of MOG-specific Foxp3+ cells (i.e., representing T cells that act to suppress and control MOG-specific inflammatory immune responses, thereby maintaining self-tolerance) was identified in mice by MOG-specific tetramer staining and flow cytometry (CD4+MOG(38-49)-tet+Foxp3+ cells).

[0499] Briefly, 2 × 10 pooled from each group 6Splenocytes were transferred to 96-well V-bottom plates. Tetramers and antibodies were diluted in PBS with 5% FBS before use and protected from light. All steps that required cell washing were performed with PBS with 5% FBS unless otherwise stated. First, cells were stained with ProT2® MHC class II tetramer specific for (MOG 38-49) (1 μg / mL, H-2 IAb-GWYRSPFSRVVH-ProT2® tetramer PE, 2958, Proimmune) and plates were incubated for 2 hours in a humidified CO2 cell incubator (5% CO2, 37°C). Without washing the cells, Fc receptors were blocked for 5 min on ice to precvent non-specific binding of flow cytometry antibodies to Fc receptors (0.25 μg / mL, TruStain FcX™ PLUS (anti-mouse CD16 / 32) antibody, 156604, Biolegend). Without washing the cells, the cells were stained for 30 min on ice with a surface antibody cocktail containing anti-mouse CD8 PE-Cy7 (0.25 μg / mL, clone: ​​53-6.7, 100721, BD Biosciences), anti-mouse CD4 eFluor450 (0.25 μg / mL, clone: ​​GK1.5, 48-0041-82, Thermofischer / eBioscience), anti-mouse CD25 PerCP-Cy5.5 (0.25 μg / mL, clone: ​​PC61, 102030, Biolegend). The cells were washed twice with PBS. Cells were then stained with fixable viability dye (150 μl per well, 1:8000 dilution in PBS, Fixable Viability Stain 780, 565388, BD biosciences) for 10 min on ice. Cells were washed twice with PBS only, fixed and permeabilized using Foxp3 / Transcription Factor Staining Buffer Set (200 μl per well, 00-5523-00, Thermofischer / eBioscience) according to the manufacturer's instructions.The cells were washed and stained with an intracellular antibody cocktail containing anti-mouse FOXP3 eFluor 660 (0.25 μg / mL, clone: ​​FJK-16s, 50-5773-82, Thermofischer / eBioscience), anti-mouse Ki-67 Alexa Fluor 488 (0.25 μg / mL, clone: ​​11F6, 151204, Biolegend) for 30 min on ice. The cells were washed, resuspended in 150 μl PBS with 5% FBS and analyzed on a BD FACSymphony™ A3 Cell Analyzer. The following controls were used as a guide to gating the desired populations using FlowJo™ v10.8 software (BD Life Sciences): unstained control (=cells did not receive any antibody) and fluorescence minus one (FMO) control (=sample stained with all fluorophore-labeled antibodies, minus one to accurately distinguish positive from negative signals).

[0500] As shown in FIG. 14, a higher percentage of MOG(38-49)-specific Foxp3+ cells was detected in response to VB5067 compared to VB5051.

[0501] Thus, Example 2 shows that vaccination with VB5067, encoding a construct with scFv-anti-DEC205 and CTLA-4 as targeting units and MOG(27-63) as antigen unit, results in a higher anti-inflammatory to pro-inflammatory cytokine ratio (IL-10 / IFN-γ) and a lack of pro-inflammatory IFN-γ production compared to the pro-inflammatory vaccine VB5052. Furthermore, the scFv anti-DEC205 and CTLA-4 targeting protein induces a higher percentage of MOG(38-49)-specific Foxp3+ cells compared to VB5051. Taken together, these results show that vaccination with the scFv anti-DEC205 and CTLA-4 bispecific construct shows a lack of pro-inflammatory cytokine production (IFN-γ) in contrast to VB5052 and induces a greater antigen-specific tolerogenic response compared to VB5051.

[0502] 1 Sugimoto MA, Sousa LP, Pinho V, Perretti M, Teixeira MM.Resolution of Inflammation:What Controls Its Onset? Front Immunol.2016 Apr 26;7:160.doi:10.3389 / fimmu.2016.00160.

[0503] Example 3: Evaluation of the tolerance-inducing ability of VB5042.

[0504] As described in Example 2, the tolerance-inducing potential of VB5042 (listed in Table 1) was determined and compared with responses induced by the pro-inflammatory control vaccine of VB5052 (listed in Table 2) and with the tolerance-inducing potential of VB5051 (listed in Table 2).

[0505] As can be seen in Figure 15A, production of IL-10 was detected in non-restimulated splenocytes harvested from mice vaccinated with all three constructs; VB5042, VB5051 and VB5052, but only low background levels of IFN-γ were observed. As shown in Figure 15B, upon MOG(35-55) restimulation of splenocytes, elevated levels of IFN-γ were detected after vaccination with VB5052, which were significantly increased beyond those induced by VB5042 and VB5051. The increased levels of IL-10 observed in response to VB5052 may be explained by a potential feedback mechanism to control the inflammatory response, as described in Example 2. Splenocytes from mice vaccinated with either VB5042 or VB5051 showed similar levels of IL-10 and IFN-γ both with (Figure 15A) and without (Figure 15B) MOG(35-55) peptide restimulation. As shown in FIG. 15C, a significantly higher IL-10 / IFN-γ ratio was detected in VB5042 compared to VB5052, indicating a higher immunosuppressive ability of VB5042 compared to VB5052.

[0506] As shown in FIG. 16, a higher percentage of MOG(38-49)-specific Foxp3+ cells was detected in response to VB5042 compared to VB5051.

[0507] Thus, Example 3 shows that vaccination with VB5042 encoding a construct with scFv anti-DEC205 and IL-10 as targeting units and MOG(27-63) as antigen unit results in a higher non-inflammatory to inflammatory cytokine ratio (IL-10 / IFN-γ) and a lack of inflammatory IFN-γ compared to the pro-inflammatory vaccine version VB5052. Furthermore, the scFv anti-DEC205 and IL-10 targeting protein induced a higher frequency of MOG(38-49)-specific Foxp3+ cells compared to VB5051. Taken together, these results show that vaccination with the scFv anti-DEC205 and IL-10 bispecific construct shows a lack of pro-inflammatory cytokine production (IFN-γ) in contrast to VB5052 and induces a greater antigen-specific tolerogenic response compared to VB5051.

[0508] Example 4: Evaluation of the tolerance-inducing ability of VB5073.

[0509] As described in Example 2, the tolerance-inducing potential of VB5073 (listed in Table 1) was determined and compared with the responses induced by the pro-inflammatory control vaccine VB5052 (listed in Table 2) and the tolerance-inducing potential of VB5051 (listed in Table 2).

[0510] As can be seen in Figure 17A, production of IL-10 was detected in non-restimulated splenocytes harvested from mice vaccinated with all three constructs; VB5073, VB5051 and VB5052, but only low background levels of IFN-γ were observed. As shown in Figure 17B, upon MOG(35-55) restimulation of splenocytes, high levels of IFN-γ were detected after vaccination with VB5052, which were significantly increased beyond those induced by VB5073 and VB5051. The increased levels of IL-10 observed in response to VB5052 may be explained by a potential feedback mechanism to control the inflammatory response, as described in Example 2. Splenocytes from mice vaccinated with either VB5073 or VB5051 showed similar levels of IL-10 and IFN-γ both with (Figure 17B) and without (Figure 17A) MOG(35-55) peptide restimulation. As shown in FIG. 17C, a significantly higher IL-10 / IFN-γ ratio was detected in VB5073 compared to VB5052, indicating a higher immunosuppressive ability of VB5073 compared to VB5052.

[0511] As shown in FIG. 18, a higher percentage of MOG(38-49)-specific Foxp3+ cells was detected in response to VB5073 compared to VB5051.

[0512] Thus, Example 4 shows that vaccination with VB5073, encoding a construct with SCGB3A2 and IL-10 as targeting units and MOG(38-49) as antigen unit, results in a higher non-inflammatory to inflammatory cytokine ratio (IL-10 / IFN-γ), shows a lack of inflammatory IFN-γ production compared to the pro-inflammatory construct VB5052, and induces a higher frequency of MOG(38-49)-specific Foxp3+ cells compared to VB5051. Taken together, these results show that vaccination with the SCGB3A2 and IL-10 bispecific construct shows a lack of pro-inflammatory cytokine production (IFN-γ), in contrast to VB5052, and induces a greater antigen-specific tolerogenic response compared to VB5051.

[0513] Example 5: Design, production and in vitro characterization of a tolerogenic construct according to the invention carrying six T cell epitopes for use in the treatment of shellfish allergy.

[0514] Tropomyosin is a major allergen in crustaceans. Six major T cell epitopes were identified for tropomyosin from the species Metapenaeus ensis (Met e 1) in a Balb / c mouse model of Met e 1 hypersensitivity. Oral immunotherapy with peptides of the six T cell epitopes effectively reduced the allergic response to shrimp tropomyosin (Wai, CYY et al. 2015).

[0515] DNA vector design DNA vectors VB5077 and VB5078 were designed and produced containing nucleic acid sequences encoding the elements / units listed below in Table 3. All gene sequences listed were ordered from GenScript (Genscript Biotech BV, Netherlands) cloned into the expression vector pALD-CV77.

[0516] [Table 4] The vectors according to the present disclosure, DNA vectors VB5077 (SEQ ID NO: 37) and VB5078 (SEQ ID NO: 38), encode constructs containing the targeting unit, dimerization unit and antigen unit described in the table above.

[0517] The Met e 1(241-260), (210-230), (136-155), (76-95), (46-65), (16-35) antigenic unit (SEQ ID NO: 22) contains the GGGGSGGGGS (SEQ ID NO: 80) linker between the T cell epitopes.

[0518] In vitro characterization of protein expression and secretion of Met e 1-containing tolerance-inducing constructs The aim of this experiment was to characterize the expression and secretion of proteins encoded by the Met e 1-containing DNA vectors VB5077 and VB5078 following transient transfection of mammalian cells.

[0519] Expi293F cells were obtained from Thermo Fisher Sci. and transiently transfected with DNA vectors VB5077 and VB5078. Briefly, Expi293F cells (1.7 × 10 6 Cells / mL, 1 mL) were seeded into 96-well culture plates. Cells were transfected with 0.64 μg / mL of plasmid DNA using ExpiFectamine 293 reagent (Thermo Fisher Sci.) and plates were incubated on an orbital shaker (3 mm diameter, 900 rpm) in a humidified CO2 cell incubator (8% CO2, 37 °C). Plates were incubated for 72 h, after which the supernatants were harvested.

[0520] Secreted proteins encoded by Met e 1-containing vectors were assessed in supernatants from transiently transfected cells by sandwich ELISA using antibodies against murine IL-10 (capture antibody: mouse anti-murine IL-10 antibody, 2 μg / mL, 100 μl / well, MAB417, R&D Systems; detection antibody: goat anti-murine IL-10 biotinylated antibody, 0.8 μg / mL, 100 μl / well, BAF417, R&D Systems). The results are shown in FIG. 19 and show that both Met e 1-containing constructs were expressed and secreted at high levels. Characterization of intact proteins expressed from VB5077 and VB5078 Western blot analysis was performed on supernatant samples from transfected Expi293F cells to further characterize the proteins encoded by VB5077 and VB5078.

[0521] Samples were prepared by mixing 14 μl of supernatant from transfected Expi293F cells with 5 μl of 4× Laemmli sample buffer (Bio-Rad) containing 1 μl DTT (Cayman Chemical) or 1 μl ultrapure water for reducing and non-reducing conditions, respectively (scaling up total sample volume at given ratios). Samples (reduced or non-reduced) were heated at 70°C for 10 min before loading onto 4%-20% Criterion TGX Stain-Free precast gels (Bio-Rad) (loading sample volumes are given in figure legends). SDS-PAGE was run in 1× Tris / glycine / SDS running buffer (Bio-Rad) containing Precision Plus Protein All Blue pre-stained protein standards (Bio-Rad). Proteins were transferred from the gel onto EtOH-activated low fluorescence (LF) 0.45 μm PVDF membranes (Bio-Rad) by using a Tran-Blot Turbo semi-dry transfer system (Bio-Rad). The PVDF membranes were blocked in EveryBlot buffer (Bio-Rad) for 5 min and probed with rat anti-murine IL-10 (MAB417, R&D Systems) to detect IL-10. The membranes were incubated with fluorescent dye-conjugated species-specific secondary antibodies for 1 h at room temperature, then washed and dried. Images were taken by using a ChemiDoc™ MP imaging system.

[0522] The results are shown in Figure 20.

[0523] Western blot analysis using anti-murine IL-10 antibody indicates that the six Met e 1 T cell epitope-containing constructs were secreted as full-length fusion proteins.

[0524] array SEQ ID NO:1 Amino acid sequences of hinge exon h1 (amino acids 1-12) from IgG3 and hinge exon h4 (amino acids 13-27) from human IgG3 E 1 LKTPLGDTTHT 12 E13 PKSCDTPPPCPRCP 27 SEQ ID NO:2 Amino acid sequence of the hinge region of human IgG1: upper hinge region (amino acids 1-4), middle hinge region (amino acids 5-15) and lower hinge region (amino acids 16-23).

[0525] E 1 P.K.S. 4 C 5 DKTHTCPPCP 15 A 16 PELLGGP 23 SEQ ID NO:3 Amino acid sequence of the CH3 domain of human IgG3 GQPREPQVYTLPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK SEQ ID NO:4 Amino acid sequence of the CH3 domain of human IgG1 GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO:5 Amino acid sequence of the CREB bZIP motif VKCLENRVAVLENQNKTLIEELKALKDLY SEQ ID NO:6 Mouse immunoglobulin heavy chain signal sequence (Ig VH signal sequence) MNFGLRLIFLVLTLKGVQC SEQ ID NO:7 Mouse single chain variable fragment (scFv) anti-DEC205 DIQMTQSPSFLSTSLGNSITITCHASQNIKGWLAWYQQKSGNAPQLLIYKASSLQSGVPSRFSGSGSGTDYIFTISNLQPEDIATYYCQHYQSFPWTFGGGTKLELKGGGGSGGGGSGGGGSE VKLLESGGGLVQPGGSLRLSCAASGTFNDFYMNWIRQPPGQAPEWLGVIRNKGNGYTTEVNTSVKGRFTISRDNTQNILYLQMNSLRAEDTAIYYCARGGPYYYSGDDAPYWGQGVMVTVSS SEQ ID NO:8 The hinge region forms human IgG1. Upper hinge region hIgG1(1-5), middle hinge region hIgG1(6-20). GLQGLEPKSCDKTHTCPPCP SEQ ID NO:9 Murine IL-10 SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS SEQ ID NO:10 Mature murine TGFβ1 ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS SEQ ID NO:11 Murine CTLA-4 extracellular domain EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD SEQ ID NO:15 Murine MARCO ligand SCGB3A2 signal sequence MKLVSIFLLVTIGICGYSATA SEQ ID NO:16 Murine MARCO ligand SCGB3A2 LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLEALSHLV SEQ ID NO:17 Murine VISTA ligand VSIG-3 signal sequence MTRRRSAPASWLLVSLLGVATS SEQ ID NO:18 Murine VISTA ligand VSIG-3 extracellular domain LEVSESPGSVQVARGQTAVLPCAFSTSAALLNLNVIWMVIPLSNANQPEQVILYQGGQMFDGALRFHGRVGFTGTMPATNVSIFINNTQLSSDTGTYQCLVNNLPDRGGR NIGVTGLTVLVPPSAPQCQIQGSQDLGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGSTCLLDLQVISPQPRSV SEQ ID NO:19 Hinge h1 hIgG3 ELKTPLGDTTHT SEQ ID NO:20 Human CCL3L1 signal sequence MQVSTAALAVLLCTMALCNQVLS SEQ ID NO:21 Human CCL3L1 APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA SEQ ID NO:23 Amino acid sequence of VB5050. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), mouse single chain variable fragment "scFv" anti-DEC205 (20-265), hinge h1 hIgG3 (266-277), hinge h4 hIgG3 (278-292), linker (293-297), MOG amino acids 27-63 (298-334), upper hinge region hIgG1 (335-339), middle hinge region hIgG1 (340-354), murine IL-10 (355-514).

[0526] [Table 5] SEQ ID NO:24 Amino acid sequence of VB5038. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), mouse single chain variable fragment "scFv" anti-DEC205 (20-265), hinge h1 hIgG3 (266-277), hinge h4 hIgG3 (278-292), linker (293-297), MOG amino acids 27-63 (298-334), upper hinge region hIgG1 (335-339), middle hinge region hIgG1 (340-354), murine IL-10 (355-514). A portion of the MOG (27-63) sequence was obtained from the paper by Krienke et al. 2021.

[0527] [Table 6] SEQ ID NO:25 Amino acid sequence of VB5042. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), mouse single chain variable fragment "scFv" anti-DEC205 (20-265), hinge h1 hIgG3 (266-277), hinge h4 hIgG3 (278-292), linker (293-297), MOG amino acids 27-63 (298-334), upper hinge region hIgG1 (335-339), middle hinge region hIgG1 (340-354), hinge h1 hIgG3 (355-366), murine IL-10 (367-526).

[0528] [Table 7] SEQ ID NO:26 Amino acid sequence of VB5066. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), mouse single chain variable fragment "scFv" anti-DEC205 (20-265), hinge h1 hIgG3 (266-277), hinge h4 hIgG3 (278-292), linker (293-297), MOG amino acids 27-63 (298-334), upper hinge region hIgG1 (335-339), middle hinge region hIgG1 (340-354), mouse TGFβ1 mature sequence (355-466).

[0529] [Table 8] SEQ ID NO:27 Amino acid sequence of VB5043. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), mouse single chain variable fragment "scFv" anti-DEC205 (20-265), hinge h1 hIgG3 (266-277), hinge h4 hIgG3 (278-292), linker (293-297), MOG amino acids 27-63 (298-334), upper hinge region hIgG1 (335-339), middle hinge region hIgG1 (340-354), hinge h1 hIgG3 (355-366), mouse TGFβ1 mature sequence (355-478).

[0530] [Table 9] SEQ ID NO:28 Amino acid sequence of VB5067. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), mouse single chain variable fragment "scFv" anti-DEC205 (20-265), hinge h1 hIgG3 (266-277), hinge h4 hIgG3 (278-292), linker (293-297), MOG amino acids 27-63 (298-334), upper hinge region hIgG1 (335-339), middle hinge region hIgG1 (340-354), mouse CTLA-4 (355-480).

[0531] [Table 10] SEQ ID NO:29 Amino acid sequence of VB5072. Murine MARCO ligand SCGB3A2 signal sequence (1-21), murine MARCO ligand SCGB3A2 (22-91), hinge h1 hIgG3 (92-103), hinge h4 hIgG3 (104-118), linker (119-123), MOG amino acids 27-63 (124-160), upper hinge region hIgG1 (161-165), middle hinge region hIgG1 (166-180), murine IL-10 (181-340). [Table 11] SEQ ID NO:30 Amino acid sequence of VB5073. Murine MARCO ligand SCGB3A2 signal sequence (1-21), murine MARCO ligand SCGB3A2 (22-91), hinge h1 hIgG3 (92-103), hinge h4 hIgG3 (104-118), linker (119-123), MOG amino acids 27-63 (124-160), upper hinge region hIgG1 (161-165), middle hinge region hIgG1 166-180), hinge h1 hIgG3 (181-192), murine IL-10 (193-352) [Table 12] SEQ ID NO:31 Amino acid sequence of VB5074. Murine VISTA ligand VSIG-3 signal sequence (1-22), murine VISTA ligand VSIG-3 extracellular domain (23-240), hinge h1 hIgG3 (241-252), hinge h4 hIgG3 (253-267), linker (268-272), MOG amino acids 27-63 (273-309), upper hinge region hIgG1 (310-314), middle hinge region hIgG1 (315-329), murine IL-10 (330-489).

[0532] [Table 13] SEQ ID NO:32 Amino acid sequence of VB5075. Murine VISTA ligand VSIG-3 signal sequence (1-22), murine VISTA ligand VSIG-3 extracellular domain (23-240), hinge h1 hIgG3 (241-252), hinge h4 hIgG3 (253-267), linker (268-272), MOG amino acids 27-63 (273-309), upper hinge region hIgG1 (310-314), middle hinge region hIgG1 (315-329), hinge h1 hIgG3 (330-341), murine IL-10 (342-501).

[0533] [Table 14] SEQ ID NO:33 Amino acid sequence of VB5052. Human CCL3L1 signal sequence "Mip1a" (1-23), human CCL3L1 "hMip1a" (24-93), hinge h1 hIgG3 (94-105), hinge h4 hIgG3 (106-120), linker (121-130), hCH3 IgG3 (131-237), linker (238-242), MOG amino acids 27-63 (243-279).

[0534] [Table 15] SEQ ID NO:34 Amino acid sequence of VB5002b. Human CCL3L1 signal sequence "Mip1a" (1-23), human CCL3L1 "hMip1a" (24-93), hinge h1 hIgG3 (94-105), hinge h4 hIgG3 (106-120), linker (121-130), hCH3 IgG3 (131-237), linker (238-242), MOG amino acids 27-63 (243-279). Part of the MOG (27-63) sequence was obtained from the paper by Krienke et al. 2021.

[0535] [Table 16] SEQ ID NO:35 Amino acid sequence of VB5051. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), MOG amino acids 27-63 (20-56).

[0536] MNFGLRLIFLVLTLKGVQCSPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAP SEQ ID NO:36 Amino acid sequence of VB5001b. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), MOG amino acids 27-63 (20-56). Part of the MOG (27-63) sequence was obtained from the paper by Krienke et al. 2021.

[0537] MNFGLRLIFLVLTLKGVQCSPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEAQP SEQ ID NO:37 Amino acid sequence of VB5077. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), mouse single chain variable fragment "scFv" anti-DEC205 (20-265), hinge h1 hIgG3 (266-277), hinge h4 hIgG3 (278-292), linker (293-297), Met e 1 "241-260", "210-230", "136-155", "76-95", "46-65", "16-35" (293-468), upper hinge region hIgG1 (469-473), middle hinge region hIgG1 (474-488), murine IL-10 (489-648).

[0538] [Table 17] SEQ ID NO:38 Amino acid sequence of VB5078. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), mouse single chain variable fragment "scFv" anti-DEC205 (20-265), hinge h1 hIgG3 (266-277), hinge h4 hIgG3 (278-292), linker (293-297), Met e 1 "241-260", "210-230", "136-155", "76-95", "46-65", "16-35" (293-468), upper hinge region hIgG1 (469-473), middle hinge region hIgG1 (474-488), hinge h1 hIgG3 (489-500), murine IL-10 (501-660).

[0539] [Table 18] SEQ ID NO:41 Amino acid sequence of VB5041. Mouse immunoglobulin heavy chain signal sequence "Ig VH signal sequence" (1-19), mouse single chain variable fragment "scFv" anti-DEC205 (20-265), hinge h1 hIgG3 (266-277), hinge h4 hIgG3 (278-292), linker (293-297), MOG amino acids 35-55 (298-318), upper hinge region hIgG1 (319-323), middle hinge region hIgG1 (323-338), hinge h1 hIgG3 (339-350), murine IL-10 (315-510).

[0540] [Table 19] Embodiment 1. A tolerance-inducing construct comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) A tolerance-inducing construct comprising a multimeric protein consisting of multiple polypeptides defined in ii), for example a dimeric protein consisting of two polypeptides defined in ii).

[0541] 2. A tolerance-inducing construct comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) A tolerance-inducing construct comprising a multimeric protein consisting of multiple polypeptides as defined in ii).

[0542] 3. A tolerance-inducing construct comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, the polypeptide being, in a specified order: a. a first targeting unit, a first junction region; B.Antigenic unit; c. a second bonding region; and d. a second targeting unit; a polynucleotide in which the antigenic unit comprises one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) A tolerance-inducing construct comprising a dimeric protein consisting of two polypeptides as defined in ii).

[0543] 4. A tolerance-inducing construct according to any one of embodiments 1 to 3, wherein the multimeric protein, such as a dimeric protein, consists of a plurality of polypeptides, such as two polypeptides, which are linked to each other via their junction regions, preferably via their respective first junction regions and their respective second junction regions.

[0544] 5. A tolerance-inducing construct according to any one of embodiments 1 to 4, wherein the multimeric protein consists of multiple polypeptides linked to each other via their junction regions, preferably via their respective first junction regions and their respective second junction regions.

[0545] 6. A tolerance-inducing construct according to any one of embodiments 1 to 5, wherein the dimeric protein consists of two polypeptides linked to each other via their junction regions, preferably via their respective first junction regions and their respective second junction regions.

[0546] 7. A tolerance-inducing construct according to any one of embodiments 1 to 6, wherein the first and second junction regions comprise a flexible unit and a binding unit.

[0547] 8. A tolerance-inducing construct according to any one of embodiments 1 to 7, wherein the first and / or second junction region comprises a binding unit which is a non-covalent binding unit.

[0548] 9. A tolerance-inducing construct according to any one of embodiments 1 to 8, wherein the non-covalent binding unit is a trimerization unit.

[0549] 10. The tolerance-inducing construct according to any one of embodiments 1 to 9, wherein the trimerization unit is a collagen-derived trimerization unit.

[0550] 11. The tolerance-inducing construct of embodiment 10, wherein the collagen-derived trimerization unit is a human collagen XVIII trimerization domain.

[0551] 12. The tolerance-inducing construct of embodiment 10, wherein the collagen-derived trimerization unit is a human collagen XV trimerization domain.

[0552] 13. A tolerance-inducing construct according to any one of embodiments 1 to 8, wherein the non-covalent binding unit is a tetramerization unit.

[0553] 14. The tolerance-inducing construct of embodiment 13, wherein the tetramerization domain is a domain derived from p53.

[0554] 15. A tolerance-inducing construct according to any one of embodiments 1 to 8, wherein the non-covalent binding unit is a dimerization unit.

[0555] 16. The tolerance-inducing construct of embodiment 15, wherein the dimerization unit comprises a hinge region and an immunoglobulin domain.

[0556] 17. The tolerance-inducing construct of embodiment 16, wherein the dimerization unit is an immunoglobulin constant domain.

[0557] 18. The tolerance-inducing construct of embodiment 15, wherein the dimerization unit comprises a dHLX protein.

[0558] 19. A tolerance-inducing construct according to any one of embodiments 1 to 18, wherein the first and / or second junction region comprises a binding unit which is a covalent binding unit.

[0559] 20. A tolerance-inducing construct according to any one of embodiments 1 to 19, wherein the first and / or second junction region comprises or consists of a naturally occurring sequence.

[0560] 21. A tolerance-inducing construct according to any one of embodiments 1 to 19, wherein the first and / or second junction region comprises or consists of an artificial sequence.

[0561] 22. A tolerance-inducing construct according to any one of embodiments 19 to 21, wherein the first and second junction regions comprise covalent bonding units comprising one or more cysteine ​​residues.

[0562] 23. The tolerance-inducing construct of embodiment 22, wherein the covalent binding unit comprises at least two cysteine ​​residues.

[0563] 24. A tolerance-inducing construct according to embodiment 22 or 23, wherein the covalent binding unit comprises at least two cysteine ​​residues, such as at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or 13 cysteine ​​residues.

[0564] 25. The tolerance-inducing construct of embodiments 19 to 22, wherein the covalent binding unit comprises a cysteine-rich sequence.

[0565] 26. A tolerance-inducing construct according to any one of embodiments 19 to 25, wherein the covalent binding unit of the first junction region contains a different number of cysteine ​​residues than the covalent binding unit of the second junction region.

[0566] 27. A tolerance-inducing construct according to any one of embodiments 22 to 26, wherein the cysteine ​​residue contained in the covalent bond unit of the first junction region is positioned differently from the cysteine ​​residue contained in the covalent bond unit of the second junction region.

[0567] 28. A tolerance-inducing construct according to embodiments 22 to 27, wherein the number of amino acid residues between the cysteine ​​residues of the covalent bond units of the first junction region is different from that of the second junction region.

[0568] 29. A tolerogenic construct according to any one of embodiments 22 to 28, wherein the number of cysteine ​​residues is based on the length of the antigen unit.

[0569] 30. A tolerance-inducing construct according to any one of embodiments 19 to 29, wherein at least one of the covalent binding units is derived from an immunoglobulin.

[0570] 31. The tolerance-inducing construct according to embodiment 30, wherein the covalent binding unit is a hinge region derived from an immunoglobulin, such as exon h4 of IgG3 or the central hinge of IgG1.

[0571] 32. The tolerance-inducing construct according to embodiment 30, wherein the hinge region is Ig-derived, such as IgG-derived, such as IgG1, IgG2 or IgG3.

[0572] 33. The tolerance-inducing construct of embodiment 30, wherein the hinge region is derived from IgM.

[0573] 34. The tolerance-inducing construct of embodiment 30, wherein the hinge region comprises or consists of a nucleotide sequence having SEQ ID NO: 157 or an amino acid sequence encoded by said nucleotide sequence.

[0574] 35. A tolerance-inducing construct according to embodiment 30, wherein the covalent binding unit comprises or consists of an amino acid sequence having at least 40% sequence identity to amino acid sequence 13 to 27 of SEQ ID NO:1, for example at least 50%, at least 60%, at least 70%, at least 80% or at least 90% sequence identity.

[0575] 36. A tolerance-inducing construct according to embodiment 30, wherein the covalent bond unit comprises or consists of the amino acid sequence 13 to 27 of SEQ ID NO:1, and wherein any one of the amino acids of the flexible unit has been replaced, deleted or inserted by another amino acid, provided that no more than 6 amino acids, such as no more than 5 amino acids, such as no more than 4 amino acids, such as no more than 3 amino acids, such as no more than 2 amino acids or no more than 1 amino acid have been so replaced, deleted or inserted.

[0576] 37. A tolerance-inducing construct according to embodiment 30, wherein the covalent binding unit consists of the amino acid sequence 13 to 23-27 of SEQ ID NO:1.

[0577] 38. The tolerance-inducing construct of embodiment 31, wherein the covalent binding unit is hinge exon h4 of IgG3.

[0578] 39. The tolerance-inducing construct according to embodiment 30, wherein the covalent binding unit comprises the sequence EPKSCDTPPPCPRCP (sequence number 156; corresponding to amino acids 13 to 27 of sequence number 1).

[0579] 40. A tolerance-inducing construct according to any one of embodiments 1 to 30, wherein the covalent binding unit comprises or consists of an amino acid sequence having at least 40% sequence identity to amino acid sequence 5 to 15 of SEQ ID NO: 2, insofar as the cysteine ​​residues are retained in their number and positions with, for example, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% sequence identity.

[0580] 41. A tolerance-inducing construct according to embodiments 1 to 30, wherein the covalent bond unit comprises or consists of the amino acid sequence 5 to 15 of SEQ ID NO: 2, and wherein any one of the amino acids of the flexible unit has been replaced, deleted or inserted by another amino acid, provided that no more than 5 amino acids, such as no more than 4 amino acids, such as no more than 3 amino acids, such as no more than 2 amino acids or no more than 1 amino acid have been so replaced, deleted or inserted.

[0581] 42. A tolerance-inducing construct according to embodiment 41, wherein the covalent binding unit consists of or comprises amino acid sequence 5 to 15 of SEQ ID NO:2.

[0582] 43. The tolerance-inducing construct of embodiment 30, wherein the covalent binding unit is the central hinge region of IgG1.

[0583] 44. A tolerance-inducing construct according to any one of embodiments 19 to 43, wherein the covalent binding unit is a non-immunogenic sequence.

[0584] 45. A tolerance-inducing construct according to any one of embodiments 19 to 44, wherein the covalent binding unit is a naturally occurring peptide sequence.

[0585] 46. ​​A tolerance-inducing construct according to any one of embodiments 19 to 45, wherein the covalent bond unit consists of 2 to 100 amino acids, such as 3 to 70 amino acids, such as 4 to 50 amino acids or 5 to 30 amino acids.

[0586] 47. A tolerance-inducing construct according to any one of embodiments 19 to 46, wherein the covalent binding unit consists of 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids.

[0587] 48. A tolerance-inducing construct according to any one of embodiments 19 to 47, wherein at least one of the covalent binding units is an artificial sequence.

[0588] 49. A tolerance-inducing construct according to any one of embodiments 8 to 48, wherein the first and second junction regions comprise binding units which are non-covalent binding units.

[0589] 50. A tolerance-inducing construct according to any one of embodiments 8 to 49, wherein the non-covalent binding unit contributes to multimerization through non-covalent interactions, such as hydrophobic interactions.

[0590] 51. A tolerance-inducing construct according to any one of embodiments 8 to 50, wherein the non-covalent binding unit contributes to dimerization through non-covalent interactions, such as hydrophobic interactions.

[0591] 52. A tolerance-inducing construct according to any one of embodiments 8 to 51, wherein the non-covalent binding unit has the ability to form a multimeric protein via non-covalent interactions.

[0592] 53. A tolerance-inducing construct according to any one of embodiments 8 to 52, wherein the non-covalent binding unit has the ability to form dimers via non-covalent interactions.

[0593] 54. A tolerance-inducing construct according to any one of embodiments 8 to 53, wherein at least one of the non-covalent binding units is a naturally occurring sequence.

[0594] 55. A tolerance-inducing construct according to any one of embodiments 8 to 54, wherein at least one of the non-covalent binding units is an artificial sequence.

[0595] 56. A tolerance-inducing construct according to any one of embodiments 8 to 55, wherein the non-covalent binding unit is or comprises an immunoglobulin.

[0596] 57. A tolerance-inducing construct according to any one of embodiments 8 to 56, wherein the non-covalent binding unit consists of or comprises an immunoglobulin domain, such as an immunoglobulin constant domain (C domain), for example a carboxy-terminal constant domain (i.e., CH3 domain), a CH1 domain or a CH2 domain, or a sequence substantially identical to a C domain or a variant thereof.

[0597] 58. A tolerance-inducing construct according to any one of embodiments 8 to 57, wherein the non-covalent binding unit comprises or consists of a CH3 domain derived from IgG, for example derived from IgG3 or IgG1, preferably derived from IgG1.

[0598] 59. A tolerance-inducing construct according to any one of embodiments 8 to 58, wherein the non-covalent binding unit comprises or consists of a CH3 domain derived from IgG3.

[0599] 60. A tolerance-inducing construct according to any one of embodiments 8 to 59, wherein the non-covalent binding unit comprises or consists of a carboxy-terminal C domain derived from an IgG3 having an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO: 3.

[0600] 61. A tolerance-inducing construct according to any one of embodiments 8 to 60, wherein the non-covalent binding unit comprises or consists of a carboxy-terminal C-domain derived from an IgG3 having an amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 3, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, such as at least 98% or such as at least 99% sequence identity.

[0601] 62. A tolerance-inducing construct according to any one of embodiments 8 to 61, wherein the non-covalent unit comprises or consists of a carboxy-terminal C-domain derived from IgG3 having the amino acid sequence of SEQ ID NO: 3, and wherein any one of the amino acids of the flexible unit has been replaced, deleted or inserted by another amino acid, with the proviso that not more than 21 amino acids, such as not more than 20 amino acids, such as not more than 19 amino acids, for example not more than 18 amino acids, such as not more than 17 amino acids, for example not more than 16 amino acids, such as not more than 15 amino acids, for example not more than 14 amino acids, such as not more than 13 amino acids, for example not more than 12 amino acids, such as not more than 11 amino acids, for example not more than 10 amino acids, such as not more than 9 amino acids, for example not more than 8 amino acids, such as not more than 7 amino acids, for example not more than 6 amino acids, such as not more than 5 amino acids, for example not more than 4 amino acids, such as not more than 3 amino acids, for example not more than 2 amino acids, such as not more than 1 amino acid.

[0602] 63. A tolerance-inducing construct according to any one of 8 to 62, wherein the non-covalent binding unit comprises or consists of a CH3 domain from IgG1.

[0603] 64. A tolerance-inducing construct according to any one of 8 to 63, wherein the non-covalent binding unit comprises or consists of a CH3 domain derived from an IgG1 having an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:4.

[0604] 65. A tolerance-inducing construct according to any one of 8 to 64, wherein the non-covalent binding unit comprises or consists of a CH3 domain from IgG1 having an amino acid sequence having at least 85% sequence identity to the amino acid sequence according to SEQ ID NO:4, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, such as at least 98% or such as at least 99% sequence identity.

[0605] 66. A tolerance-inducing construct according to any one of embodiments 8 to 65, wherein the non-covalent unit comprises or consists of a CH3 domain derived from IgG1 having the amino acid sequence of SEQ ID NO: 3, and wherein any one of the amino acids of the flexible unit has been replaced, deleted or inserted by another amino acid, with the proviso that not more than 21 amino acids, such as not more than 20 amino acids, such as not more than 19 amino acids, for example not more than 18 amino acids, such as not more than 17 amino acids, for example not more than 16 amino acids, such as not more than 15 amino acids, for example not more than 14 amino acids, such as not more than 13 amino acids, for example not more than 12 amino acids, such as not more than 11 amino acids, for example not more than 10 amino acids, such as not more than 9 amino acids, for example not more than 8 amino acids, such as not more than 7 amino acids, for example not more than 6 amino acids, such as not more than 5 amino acids, for example not more than 4 amino acids, such as not more than 3 amino acids, for example not more than 2 amino acids, such as not more than 1 amino acid.

[0606] 67. A tolerance-inducing construct according to any one of 8 to 66, wherein the non-covalent binding unit comprises or consists of a leucine zipper motif.

[0607] 68. The tolerance-inducing construct of embodiment 67, wherein the leucine zipper motif is derived from the bZIP class of eukaryotic transcription factors.

[0608] 69. A tolerance-inducing construct according to any one of 8 to 67, wherein the non-covalent binding unit comprises or consists of a Jun / Fos-based leucine zipper.

[0609] 70. A tolerance-inducing construct according to any one of 8 to 67, wherein the leucine zipper motif comprises or consists of the amino acid sequence of SEQ ID NO:5.

[0610] 71. A tolerance-inducing construct according to any one of 8 to 67, wherein the non-covalent binding unit comprises or consists of an amino acid sequence having at least 80% sequence identity, such as at least 81% or at least 81%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity to the amino acid sequence of SEQ ID NO:5.

[0611] 72. A tolerance-inducing construct according to any one of 8 to 67, wherein the non-covalent unit comprises or consists of the amino acid sequence of SEQ ID NO:5, and wherein any one of the amino acids of the flexible unit has been substituted, deleted or inserted by another amino acid, provided that the substitution, deletion or insertion is 12 or less, such as 11 or less, for example 10 or less, such as 9 or less, for example 8 or less, such as 7 or less, for example 6 or less, such as 5 or less, for example 4 or less amino acids, such as 3 or less amino acids, for example 2 or less amino acids, such as 1 or less amino acid.

[0612] 73. A tolerance-inducing construct according to any one of 8 to 72, wherein the non-covalent binding unit joins multiple polypeptides, e.g. two, three, four or more polypeptides, into a multimeric protein, e.g. a dimeric protein, a trimeric protein or a tetrameric protein.

[0613] 74. A tolerance-inducing construct according to any one of 8 to 73, wherein the non-covalent binding unit is or comprises a trimerization unit, such as a collagen-derived trimerization unit, such as a human collagen-derived trimerization domain, such as a human collagen-derived XVIII trimerization domain or a human collagen XV trimerization domain.

[0614] 75. A tolerance-inducing construct according to any one of 8 to 74, wherein the non-covalent binding unit is a trimerization unit comprising or consisting of a nucleotide sequence having SEQ ID NO: 158 or an amino acid sequence encoded by said nucleotide sequence.

[0615] 76. A tolerance-inducing construct according to any one of 8 to 75, wherein the trimerization unit comprises or consists of the C-terminal domain of T4 fibritin.

[0616] 77. A tolerance-inducing construct according to any one of 8 to 76, wherein the non-covalent binding unit is a trimerization unit comprising or consisting of an amino acid sequence having SEQ ID NO: 159 or a nucleotide sequence encoding said amino acid sequence.

[0617] 78. A tolerance-inducing construct according to any one of 8 to 77, wherein the non-covalent binding unit comprises or consists of a tetramerization unit, such as a domain derived from p53.

[0618] 79. A tolerance-inducing construct according to any one of 8 to 78, wherein the non-covalent binding unit is a tetramerization unit comprising or consisting of a nucleotide sequence having SEQ ID NO: 160 or an amino acid sequence encoded by said nucleotide sequence.

[0619] 80. A tolerance-inducing construct according to any one of embodiments 1 to 79, wherein the first and / or second junction region comprises or consists of a naturally occurring sequence.

[0620] 81. A tolerance-inducing construct according to any one of embodiments 1 to 80, wherein the first and / or second junction region comprises or consists of an artificial sequence.

[0621] 82. A tolerogenic construct according to any one of the preceding embodiments, wherein the number of cysteine ​​residues in the first and / or second junction region is based on the length of the antigen unit.

[0622] 83. A tolerance-inducing construct according to any one of embodiments 1 to 82, wherein the junction region comprises a binding unit comprising a covalent binding unit and a non-covalent binding unit.

[0623] 84. A tolerance-inducing construct according to any one of embodiments 1 to 83, wherein the junction region is non-immunogenic. 85. A tolerance-inducing construct according to any one of embodiments 7 to 84, wherein the flexibility unit is between the targeting unit and the binding unit.

[0624] 86. A tolerance-inducing construct according to any one of embodiments 7 to 85, wherein the flexible unit is a non-immunogenic sequence.

[0625] 87. A tolerance-inducing construct according to any one of embodiments 7 to 86, wherein at least one of the flexible units is a naturally occurring peptide sequence.

[0626] 88. A tolerance-inducing construct according to any one of embodiments 7 to 87, wherein the flexibility unit is derived from an immunoglobulin.

[0627] 89. A tolerance-inducing construct according to any one of embodiments 7 to 88, wherein the flexible unit is a hinge region derived from an immunoglobulin, such as exon h1 of IgG3 or the lower hinge of IgG1.

[0628] 90. A tolerance-inducing construct according to any one of embodiments 7 to 89, wherein the flexible unit comprises or consists of the hinge exon h1 of IgG3.

[0629] 91. A tolerance-inducing construct according to any one of embodiments 7 to 90, wherein the flexible unit comprises or consists of the lower hinge region of IgG1.

[0630] 92. A tolerance-inducing construct according to any one of embodiments 7 to 91, wherein the flexible unit comprises or consists of amino acid sequence 1 to 12 of SEQ ID NO:1.

[0631] 93. A tolerance-inducing construct according to any one of embodiments 7 to 92, wherein the flexible unit comprises or consists of an amino acid sequence having at least 50% sequence identity, such as 60%, or such as 70%, or such as 80% or such as 90% sequence identity, to the amino acid sequence 16 to 23 of SEQ ID NO: 2.

[0632] 94. The tolerance-inducing construct of any one of embodiments 7 to 93, wherein any one of the amino acids of the flexible unit is substituted, deleted or inserted by another amino acid, provided that no more than 5 amino acids, such as no more than 4 amino acids, no more than 3 amino acids, no more than 2 amino acids or no more than 1 amino acid are so substituted, deleted or inserted.

[0633] 95. A tolerance-inducing construct according to any one of embodiments 7 to 94, wherein the flexible unit is derived from an immunoglobulin, such as a hinge region of an immunoglobulin, such as a hinge region of an immunoglobulin that does not contain a cysteine ​​residue.

[0634] 96. A tolerance-inducing construct according to any one of embodiments 7 to 95, wherein at least one of the flexible units is an artificial sequence.

[0635] 97. A tolerance-inducing construct according to any one of embodiments 7 to 83 and 96, wherein the flexible unit is a serine and / or glycine-rich linker.

[0636] 98. A tolerance-inducing construct according to any one of embodiments 7 to 84 and 97 to 98, wherein the flexible unit is a glycine-serine linker such as GGGGSGGGGS (sequence number 80).

[0637] 99. A tolerance-inducing construct according to any one of embodiments 7 to 99, wherein the flexible unit is not a target for proteases.

[0638] 100. A tolerance-inducing construct according to any one of embodiments 7 to 99, wherein the flexible unit consists of at most 20 amino acids, such as at most 15 amino acids, such as 12 amino acids or 10 amino acids.

[0639] 101. A tolerance-inducing construct according to any one of embodiments 7 to 100, wherein the flexible unit contained in the second junction region consists of 5 to 60 amino acids, for example 7 to 55 amino acids, or 8 to 50 amino acids, or 9 to 45 amino acids, or 10 to 40 amino acids, or 11 to 35 amino acids, or 12 to 30 amino acids, or 13 to 20 amino acids.

[0640] 102. A tolerance-inducing construct according to any one of embodiments 7 to 101, wherein the flexible unit comprises a small non-polar amino acid, such as glycine, alanine or leucine, or a polar amino acid, such as serine or threonine.

[0641] 103. A tolerance-inducing construct according to any one of embodiments 1 to 102, wherein the junction region is non-immunogenic.

[0642] 104. A tolerance-inducing construct described in any one of embodiments 1 to 103, wherein at least one of the first or second targeting units comprises a moiety that interacts with a surface molecule on an antigen-presenting cell, and preferably, both the first and second targeting units comprise a moiety that interacts with a surface molecule on an antigen-presenting cell.

[0643] 105. The tolerance-inducing construct of embodiment 104, wherein the surface molecule is selected from the group consisting of TGFβ receptors (TGFβR1, TGFβR2, or TGFβR3), IL10R such as IL-10RA and IL10-RB, IL2R, IL4R, IL6R, IL11R and IL13R, IL27R, IL35R, IL37R, CCR7, CD11b, CD11c, CD103, CD14, CD36, CD205, CD109, VISTA, MARCO, MHCII, MHCII, CD83, SIGLEC, MGL, CD80, CD86, Clec9A, Clec12A, Clec12B, DCIR2, Langerin, MR, DC-Sign, Treml4, Dectin-1, PDL1, PDL2, HVEM, aryl hydrocarbon receptor, and vitamin D receptor.

[0644] 106. A tolerance-inducing construct according to embodiment 105, wherein the targeting unit comprises a moiety which is a natural ligand, an antibody or part thereof, such as an scFv, or a synthetic ligand.

[0645] 107. A tolerance-inducing construct according to embodiment 106, wherein the natural ligand is selected from the group consisting of TGFβ, IL-10, IL1RA, IL2, IL4, IL6, IL11, IL13, IL27, IL35, IL37, CCL19, CCL21, ICAM-1 (intercellular adhesion molecule 1, also known as CD54), keratin, VSIG-3, SCGB3A2, CTLA-4, preferably CTLA-4, the extracellular domain of PD-1, preferably the extracellular domain of PD-1 and BTLA, preferably the extracellular domain of BTLA.

[0646] 108. A tolerance-inducing construct according to any one of embodiments 1 to 107, wherein the targeting unit comprises or consists of IL-10 or TGFβ, preferably human IL-10 or human TGFβ.

[0647] 109. A tolerance-inducing construct according to any one of embodiments 1 to 108, wherein the targeting unit comprises or consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence of human TGFβ.

[0648] 110. A tolerance-inducing construct according to any one of embodiments 1 to 109, wherein the targeting unit comprises or consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence of human TGFβ, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98%, for example at least 99% or such as 100% sequence identity thereto.

[0649] 111. A tolerance-inducing construct according to any one of embodiments 1 to 110, wherein the targeting unit comprises or consists of the amino acid sequence of human TGFβ, except that up to 22 amino acids, such as up to 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid have been substituted, deleted or inserted.

[0650] 112. A tolerance-inducing construct according to any one of embodiments 1 to 111, wherein the targeting unit comprises or consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence of human IL-10.

[0651] 113. A tolerance-inducing construct according to any one of embodiments 1 to 112, wherein the targeting unit comprises or consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence of human IL-10, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98%, for example at least 99% or such as 100% sequence identity thereto.

[0652] 114. A tolerance-inducing construct according to any one of embodiments 1 to 113, wherein the targeting unit comprises or consists of the amino acid sequence of human IL-10, except that up to 22 amino acids, such as up to 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid have been substituted, deleted or inserted.

[0653] 115. A tolerance-inducing construct according to any one of embodiments 1 to 114, wherein the targeting unit comprises or consists of the amino acid sequence of human IL-10 or a nucleotide sequence encoding human IL-10.

[0654] 116. A tolerance-inducing construct according to any one of embodiments 1 to 115, wherein the targeting unit is or comprises SCGB3A2 or VSIG-3, preferably human VSIG-3 or human SCGB3A2.

[0655] 117. A tolerance-inducing construct according to any one of embodiments 1 to 116, wherein the targeting unit comprises or consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence of human SCGB3A2.

[0656] 118. A tolerance-inducing construct according to any one of embodiments 1 to 117, wherein the targeting unit comprises or consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence of human SCGB3A2, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98%, for example at least 99% or such as 100% sequence identity.

[0657] 119. A tolerance-inducing construct according to any one of embodiments 1 to 118, wherein the targeting unit comprises or consists of the amino acid sequence of human SCGB3A2, except that up to 22 amino acids, such as up to 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid have been substituted, deleted or inserted.

[0658] 120. A tolerance-inducing construct according to any one of embodiments 1 to 119, wherein the targeting unit comprises or consists of the amino acid sequence of human SCGB3A2 or a nucleotide sequence encoding human SCGB3A2.

[0659] 121. A tolerance-inducing construct according to any one of embodiments 1 to 120, wherein the targeting unit comprises or consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence of human VSIG-3.

[0660] 122. A tolerance-inducing construct according to any one of embodiments 1 to 121, wherein the targeting unit comprises or consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence of human VSIG-3, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98%, for example at least 99% or such as 100% sequence identity.

[0661] 123. A tolerance-inducing construct according to any one of embodiments 1 to 122, wherein the targeting unit comprises or consists of the amino acid sequence of human VSIG-3, except that up to 22 amino acids, such as up to 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid have been substituted, deleted or inserted.

[0662] 124. A tolerance-inducing construct according to any one of embodiments 1 to 123, wherein the targeting unit comprises or consists of the amino acid sequence of human VSIG-3 or a nucleotide sequence encoding human VSIG-3.

[0663] 125. A tolerance-inducing construct according to any one of embodiments 1 to 124, wherein the targeting unit comprises or consists of an antibody or part thereof, such as an scFv, having specificity for CD205.

[0664] 126. The tolerance-inducing construct of any one of embodiments 1 to 125, wherein the first and second targeting units are identical.

[0665] 127. A tolerance-inducing construct according to any one of embodiments 1 to 125, wherein the first and second targeting units are different.

[0666] 128. A tolerance-inducing construct according to any one of embodiments 104 to 127, wherein the surface molecules are present on the same cell.

[0667] 129. A tolerance-inducing construct according to any one of embodiments 104 to 128, wherein binding of the first or second targeting unit causes internalization of the construct.

[0668] 130. A tolerogenic construct according to any one of embodiments 1 to 129, wherein the antigenic unit is located between the first junction region and the second junction region.

[0669] 131. A tolerance-inducing construct according to any one of embodiments 1 to 130, wherein the antigenic unit comprises one or more T cell epitopes of an autoantigen, such as one T cell epitope of an autoantigen, or two or more T cell epitopes of an autoantigen, such as multiple T cell epitopes of an autoantigen.

[0670] 132. The tolerogenic construct of embodiment 131, wherein the multiple T cell epitopes are from the same autoantigen, such as those contained in the same autoantigen.

[0671] 133. A tolerogenic construct according to embodiment 131 or 132, wherein the plurality of T cell epitopes are from a plurality of different autoantigens, such as those contained in different autoantigens.

[0672] 134. A tolerance-inducing construct according to any one of embodiments 1 to 133, wherein the antigenic unit comprises two or more T cell epitopes and the antigenic unit comprises one or more linkers separating the T cell epitopes.

[0673] 135. A tolerance-inducing construct according to any one of embodiments 1 to 134, wherein the antigenic unit comprises multiple antigens, such as multiple T cell epitopes of autoantigens, allergens, alloantigens or xenoantigens, and the T cell epitopes are preferably separated by a linker.

[0674] 136. A tolerance-inducing construct according to any one of embodiments 1 to 135, wherein the antigenic unit comprises multiple T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen, each T cell epitope being separated from other T cell epitopes by a linker.

[0675] 137. A tolerance-inducing construct according to any one of embodiments 1 to 136, wherein an antigen unit comprising n antigens comprises n-1 subunits, each subunit comprising a T cell epitope of an autoantigen, an allergen, an alloantigen or a xenoantigen, and a linker, and further comprising a terminal T cell epitope.

[0676] 138. A tolerance-inducing construct according to embodiment 137, wherein n is an integer between 1 and 50, such as between 3 and 50 or between 15 and 40 or between 10 and 30 or between 10 and 25 or between 10 and 20 or between 15 and 30 or between 15 and 25 or between 15 and 20.

[0677] 139. A tolerance-inducing construct according to any one of embodiments 1 to 138, wherein the antigen unit comprises a linker designed to be non-immunogenic.

[0678] 140. A tolerance-inducing construct according to any one of embodiments 131 to 139, wherein the antigenic unit comprises one or more T cell epitopes of an allergen, such as one T cell epitope of an allergen, or two or more T cell epitopes of an allergen, such as multiple T cell epitopes of an allergen.

[0679] 141. A tolerance-inducing construct according to any one of embodiments 131 to 140, wherein the multiple T cell epitopes are of the same allergen, such as those contained in the same allergen.

[0680] 142. A tolerance-inducing construct according to any one of embodiments 131-141, wherein the T cell epitopes are of different allergens, i.e. are contained in different allergens.

[0681] 143. A tolerance-inducing construct according to any one of embodiments 1 to 142, wherein the antigenic unit comprises one or more T cell epitopes of an alloantigen / xenoantigen, such as one T cell epitope of an alloantigen / xenoantigen, or two or more T cell epitopes of an alloantigen / xenoantigen, such as multiple T cell epitopes of an alloantigen / xenoantigen.

[0682] 144. A tolerogenic construct according to any one of embodiments 131 to 143, wherein the multiple T cell epitopes are of the same allo / xenoantigen, i.e. are contained in the same allo / xenoantigen.

[0683] 145. The tolerogenic construct of any of embodiments 131-144, wherein the plurality of T cell epitopes are from a plurality of different allo / xenoantigens, such as those contained in different allo / xenoantigens.

[0684] 146. A tolerogenic construct according to any one of the preceding embodiments, wherein the antigenic unit comprises one T cell epitope.

[0685] 147. A tolerogenic construct according to any one of embodiments 1 to 146, wherein the antigenic unit comprises two or more T cell epitopes, such as multiple T cell epitopes.

[0686] 148. The tolerance-inducing construct according to any one of embodiments 1 to 147, wherein the antigenic unit comprises a T cell epitope having a length of 7 to 150 amino acids, preferably 7 to 100 amino acids, for example, about 10 to about 100 amino acids, or about 15 to about 100 amino acids, or about 20 to about 75 amino acids, or about 25 to about 50 amino acids, for example, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids.

[0687] 149. A tolerance-inducing construct according to any one of embodiments 131 to 148, wherein the length of one T cell epitope is such that the protein is not folded correctly.

[0688] 150. A tolerogenic construct according to any one of embodiments 131 to 149, wherein the T cell epitope has a length suitable for presentation by the MHC (major histocompatibility complex).

[0689] 151. A tolerogenic construct according to any one of the preceding embodiments, wherein the antigenic unit comprises a T cell epitope having a length suitable for specific presentation on MHC class I or MHC class II.

[0690] 152. A tolerogenic construct according to any one of embodiments 131 to 151, wherein the T cell epitope has a length of 7 to 11 amino acids for MHC class I presentation. In another embodiment, the T cell epitope sequence has a length of 9 to 60 amino acids, such as 9 to 30 amino acids, for example 15 to 60 amino acids, for example 15 to 30 amino acids, for MHC class II presentation.

[0691] 153. A tolerance-inducing construct according to any one of embodiments 131 to 152, wherein the T cell epitope has a length of 15 amino acids for MHC class II presentation.

[0692] 154. A tolerance-inducing construct according to any one of embodiments 1 to 153, wherein the antigen unit comprises up to 3500 amino acids, such as 60 to 3500 amino acids, such as about 80 or about 100 or about 150 amino acids to about 3000 amino acids, such as about 200 to about 2500 amino acids, such as about 300 to about 2000 amino acids or about 400 to about 1500 amino acids or about 500 to about 1000 amino acids.

[0693] 155. The antigenic unit may comprise 1 to 10 T cell epitopes, such as 1, 2, 3, 4, 5, 6, 7, 8, or 9 or 10 T cell epitopes, or 11 to 20 T cell epitopes, such as 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 T cell epitopes, or 21 to 30 T cell epitopes, such as 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 109, 155. The tolerance-inducing construct of any one of embodiments 1 to 154, comprising 9 or 30 T cell epitopes, or 31 to 40 T cell epitopes, such as 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 T cell epitopes, or 41 to 50 T cell epitopes, such as 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 T cell epitopes.

[0694] 156. The subunit antigenic unit comprises 1 to 3 T cell epitopes, such as 1, 2, 3 or 1 to 5 T cell epitopes, such as 1, 2, 3, 4, 5 or 3 to 6 T cell epitopes, such as 3, 4, 5, 6 or 5 to 15 T cell epitopes, such as 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 T cell epitopes, or 156. The tolerance-inducing construct of any one of embodiments 137 to 155, comprising 7 to 17 T cell epitopes, such as 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or 17 T cell epitopes, or 9 to 19 T cell epitopes, such as 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19 T cell epitopes.

[0695] 157. A tolerogenic construct according to any one of embodiments 131 to 156, wherein the T cell epitopes are randomly arranged in the antigenic units.

[0696] 158. A tolerance-inducing construct according to any one of embodiments 131 to 157, wherein the T cell epitopes are arranged in the order of more antigenic to less antigenic in the direction from the multimerization / dimerization unit to the end of the antigenic unit.

[0697] 159. A tolerance-inducing construct according to any one of embodiments 131 to 158, wherein the T cell epitopes are arranged in the order of more antigenic to less antigenic in the direction from the first junction region to the second junction region.

[0698] 160. A tolerance-inducing construct according to any one of embodiments 131 to 158, wherein the most hydrophobic T cell epitope is positioned substantially in the center of the first antigenic unit and the most hydrophilic T cell epitope is positioned towards the junction region.

[0699] 161. A tolerance-inducing construct according to any one of embodiments 131-158, wherein the T cell epitopes alternate between hydrophilic and hydrophobic T cell epitopes.

[0700] 162. A tolerance-inducing construct according to any one of embodiments 131 to 158, wherein GC-rich sequences encoding T cell epitopes are positioned such that GC clusters are avoided.

[0701] 163. The tolerance-inducing construct of embodiment 162, wherein the GC-rich T cell sequences are arranged such that there is at least one non-GC-rich T cell sequence between them.

[0702] 164. The tolerance-inducing construct according to any one of the preceding embodiments, wherein the construct is a polynucleotide further comprising a nucleotide sequence encoding a signal peptide.

[0703] 165. A tolerance-inducing construct according to any one of embodiments 1 to 164, wherein the polynucleotide comprises a nucleotide sequence encoding a signal peptide comprising an amino acid sequence having at least 85%, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, such as at least 98% or for example at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 6.

[0704] 166. The tolerance-inducing construct of any one of embodiments 1 to 165, wherein the polynucleotide comprises a nucleotide sequence encoding a signal peptide comprising the amino acid sequence of SEQ ID NO:6.

[0705] 167. A tolerance-inducing construct according to any one of embodiments 1 to 166, wherein the polynucleotide comprises a nucleotide sequence encoding a signal peptide consisting of an amino acid sequence having at least 80%, preferably at least 85%, such as at least 86%, for example at least 87%, such as at least 88%, for example at least 89%, such as at least 90%, for example at least 91%, such as at least 92%, for example at least 93%, such as at least 94%, for example at least 95%, such as at least 96%, for example at least 97%, for example at least 98% or for example at least 99% identity to the amino acid sequence of SEQ ID NO: 6.

[0706] 168. A tolerance-inducing construct according to any one of embodiments 1 to 167, wherein the polynucleotide comprises a nucleotide sequence encoding a signal peptide having the amino acid sequence of SEQ ID NO:6.

[0707] 169. A tolerance-inducing construct according to any one of embodiments 1 to 168, wherein the signal peptide comprises or consists of the amino acid sequence of SEQ ID NO: 6, and wherein any one of the amino acids of the signal peptide has been replaced, deleted or inserted by another amino acid, provided that no more than 5 amino acids, such as no more than 4 amino acids, such as no more than 3 amino acids, such as no more than 2 amino acids or no more than 1 amino acid have been so replaced, deleted or inserted.

[0708] 170. A polynucleotide according to any one of embodiments 1 to 169.

[0709] 171. A vector comprising a polynucleotide according to embodiment 170.

[0710] 172. A host cell comprising a polynucleotide according to any one of the embodiments and / or a vector according to any one of the embodiments 169 or 170.

[0711] 173. A polypeptide encoded by a nucleic acid having a nucleotide sequence according to any one of embodiments 1 to 169.

[0712] 174. A multimeric protein, such as a dimeric protein, according to any one of embodiments 1 to 169, in which a plurality of polypeptides, such as two polypeptides, are linked to each other via their respective first junction regions and via their respective second junction regions.

[0713] 175. A multimeric protein according to any one of embodiments 1 to 169, wherein the polypeptides are linked to each other via their respective first junction regions and via their respective second junction regions.

[0714] 176. The dimeric protein according to any one of embodiments 1 to 175, wherein the two polypeptides are linked to each other via their respective first junction regions and via their respective second junction regions. 177. A method for preparing a pharmaceutical composition comprising: a) providing a polynucleotide, a polypeptide or a multimeric protein, such as a dimeric protein, according to any one of embodiments 1 to 176; b) combining a polynucleotide, a polypeptide, or a multimeric protein, such as a dimeric protein, with a pharma- ceutically acceptable carrier.

[0715] 178. A method for preparing a pharmaceutical composition comprising: a) providing a polynucleotide, a polypeptide or a multimeric protein, such as a dimeric protein, according to any one of embodiments 1 to 176; b) combining a polynucleotide, a polypeptide, or a multimeric protein, such as a dimeric protein, with a pharma- ceutically acceptable carrier.

[0716] 179. A method for preparing a pharmaceutical composition comprising: a) providing a polynucleotide, a polypeptide or a dimeric protein according to any one of embodiments 1 to 176; b) combining the polynucleotide, polypeptide, or dimeric protein with a pharma- ceutically acceptable carrier.

[0717] 180. A pharmaceutical composition comprising a polynucleotide, a polypeptide or a multimeric protein, such as a dimeric protein, according to any one of embodiments 1 to 176, and a pharma- ceutically acceptable carrier.

[0718] 181. A pharmaceutical composition comprising a polynucleotide, a polypeptide or a multimeric protein according to any one of embodiments 1 to 175 and a pharma- ceutically acceptable carrier.

[0719] 182. A pharmaceutical composition comprising a polynucleotide, a polypeptide or a dimeric protein according to any one of embodiments 1 to 176 and a pharma- ceutically acceptable carrier.

[0720] 183. A pharmaceutical composition comprising a polynucleotide according to any one of embodiments 1 to 176, and further comprising one or more pharma- ceutically acceptable excipients and / or diluents.

[0721] 184. A pharmaceutical composition comprising a polynucleotide according to any one of embodiments 1 to 176, wherein the pharma- ceutically acceptable carrier is selected from the group consisting of saline, buffered saline, PBS, dextrose, water, glycerol, ethanol, sterile isotonic aqueous buffer, and combinations thereof.

[0722] 185. A pharmaceutical composition according to embodiments 180 to 185 for use as a medicament.

[0723] 186...

Claims

1. A tolerance-inducing construct, comprising: i) a polynucleotide comprising a nucleotide sequence encoding a polypeptide, said polypeptide comprising, in a specified order: a. a first targeting unit, a first junction region; b. antigenic unit; c. a second bond area; and d. a second targeting unit; a polynucleotide, the antigenic unit comprising one or more T cell epitopes of an autoantigen, an allergen, an alloantigen or a xenoantigen; or ii) a polypeptide encoded by a nucleotide sequence defined in i); or iii) A tolerance-inducing construct comprising a multimeric protein, such as a plurality of polypeptides as defined in ii), such as a dimeric protein consisting of two polypeptides.

2. The tolerance-inducing construct of claim 1, wherein the multimeric protein, such as the dimeric protein, consists of multiple polypeptides, such as two polypeptides, linked to each other via their junction regions, preferably via their respective first junction regions and via their respective second junction regions.

3. the first and second attachment regions comprise flexible units and linking units; the binding unit is a non-covalent binding unit or a covalent binding unit; Optionally, the non-covalent binding unit comprises or consists of a trimerization unit such as the C-terminal domain of T4 fibritin, or a collagen-derived trimerization unit, for example the human collagen XVIII trimerization domain or the human collagen XV trimerization domain, or a tetramerization unit, such as a domain derived from p53, Alternatively, it comprises or consists of a dimerization unit, such as a dimerization unit comprising a hinge region and an immunoglobulin domain, such as an immunoglobulin constant domain, or a dimerization unit comprising a dHLX protein, The tolerance-inducing construct of claim 1.

4. the first and second junction regions comprise covalent bond units; the covalent binding unit comprises a cysteine ​​residue, e.g. at least two cysteine ​​residues, or comprises a cysteine-rich sequence; Optionally, the covalent binding units of the first interface region comprise a different number of cysteine ​​residues than the covalent binding units of the second interface region; And / or the cysteine ​​residues contained in the covalent bond units of the first junction region are positioned differently from the cysteine ​​residues contained in the covalent bond units of the second junction region, e.g., the number of amino acid residues between the cysteine ​​residues of the covalent bond units of the first junction region is different from that of the second junction region.

5. at least one of the covalent binding units is derived from an immunoglobulin, such as a hinge region derived from an immunoglobulin, such as exon h4 of IgG3 or the middle hinge of IgG1; And / or at least one of the covalent binding units is an artificial sequence.

6. the first and second junction regions comprise non-covalent binding units; Preferably, the non-covalent binding unit (a) is or comprises an immunoglobulin or is derived from an immunoglobulin, such as a CH3 domain derived from IgG3 or IgG1; Alternatively, (b) a leucine zipper motif, which is or contains a Jun / Fos-based leucine zipper, or is derived from the bZIP class of eukaryotic transcription factors, such as the amino acid sequence of SEQ ID NO:

5.

7. at least one of the flexible units is a naturally occurring peptide sequence; For example, the flexible unit is derived from an immunoglobulin, such as a hinge region derived from an immunoglobulin, such as exon h1 of IgG3 or the lower hinge of IgG1, and / or at least one of the flexible units is an artificial sequence; For example, the flexible unit is a glycine-serine linker such as GGGGSGGGGS (SEQ ID NO: 80).

8. at least one of the first or second targeting units comprises a moiety that interacts with a surface molecule on an antigen presenting cell, preferably both the first and second targeting units comprise a moiety that interacts with a surface molecule on an antigen presenting cell; Optionally, said surface molecules are present on the same cell; and / or optionally, said interaction is binding, and binding of said first or said second targeting unit causes internalization of said construct; Preferably, said surface molecule is selected from the group consisting of TGFβ receptor (TGFβR1, TGFβR2 or TGFβR3), IL10R, e.g. IL-10RA and IL10-RB, IL2R, IL4R, IL6R, IL11R and IL13R, IL27R, IL35R, IL37R, CCR7, CD11b, CD11c, CD103, CD14, CD36, CD205, CD109, VISTA, MARCO, MHCII, MHCII, CD83, SIGLEC, MGL, CD80, CD86, Clec9A, Clec12A, Clec12B, DCIR2, Langerin, MR, DC-Sign, Treml4, Dectin-1, PDL1, PDL2, HVEM, aryl hydrocarbon receptor and vitamin D receptor; And preferably, the targeting unit comprises a moiety which is a natural ligand, an antibody or part thereof, such as an scFv, or a synthetic ligand, More preferably, the targeting unit comprises a natural ligand, said natural ligand being selected from the group consisting of TGFβ, IL-10, IL1RA, IL2, IL4, IL6, IL11, IL13, IL27, IL35, IL37, CCL19, CCL21, ICAM-1 (intercellular adhesion molecule 1 also known as CD54), keratin, VSIG-3, SCGB3A2, CTLA-4, preferably CTLA-4, the extracellular domain of PD-1, preferably the extracellular domain of PD-1 and BTLA, preferably the extracellular domain of BTLA.

9. the first and second targeting units are identical; Or, the first and second targeting units are different, the tolerance-inducing construct of claim 1 .

10. A multimeric protein, such as a dimeric protein, in which the multiple polypeptides, such as the two polypeptides defined in claim 1, are linked to each other via their respective first junction regions and via their respective second junction regions.

11. 11. A pharmaceutical composition comprising a polynucleotide, a polypeptide as defined in any one of claims 1 to 9 or a multimeric protein, such as a dimeric protein, as defined in claim 10, and a pharma- ceutically acceptable carrier.

12. A pharmaceutical composition according to claim 11 for use as a medicament.

13. 12. A pharmaceutical composition according to claim 11 for use in the treatment of conditions involving unwanted immune responses, such as in the prophylactic or therapeutic treatment of autoimmune diseases, allergic diseases and transplant rejection.

14. A vector comprising the polynucleotide according to any one of claims 1 to 9.

15. A host cell comprising the vector of claim 14.

Images